3LQBA

Crystal structure of the hatching enzyme zhe1 from the zebrafish danio rerio
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
ALICEDKSCFWKKNANNIVEVPYVVSGEFSINDKSVIANAISIFHAQTCIRFVPRSIQADYLSIENKDGCYSAIGRTGGKQVVSLNRKGCVYSGIAQHELNHALGFYHEQSRSDRDQYVRINWNNISPGMAYNFLKQKTNNQNTPYDYGSLMHYGKTAFAIQPGLETITPIPDENVQIGQRQGLSKIDILRINKLYGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of zebrafish hatching enzyme 1 from the zebrafish Danio rerio
pubmed doi rcsb
molecule keywords LOC792177 protein
molecule tags Hydrolase
source organism Danio rerio
total genus 69
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lqbA00
1XFXA 1KUHA 3LK8A 4G0DA 3O64A 4JIJA 4WKIA 1K7QA 3TT4A 3RTSA 5D1SA 2CKIA 2JIHA 1I73A 1SRPA 4GQLA 4L6TA 4PKWA 5CXAA 3Q2HA 1C7KA 5L79A 1GO8P 1D8MA 2OXZA 3HY7A 1MMQA 1ZS0A 3WV2A 2MZEA 1IAGA 4PKQA 1KUFA 1SATA 1B8YA 3CKIA 4ILWD 1O0TA 2O3EA 4DD8A 2V4BA 4XM7A 1SMPA 3ELMA 1PWQA 2OY4A 1A86A 1IABA 2Y6CA 3B8ZA 3LUNA 1ATLA 2E3XA 3LEAA 3EDHA 2XS4A 2MZHA 4XBHA 5H8XA 5I0LA 1HFSA 4WKEA 1AKLA 4AYKA 1A85A 1XFUA 1CXVA 2AYKA 1GE5A 3G42A 1ZTQA 4J4MA 2MLRA 1CGLA 1XFYA 3NX7A 4GWMA 2J0TA 4G9LA 4H30A 1YCMA 3DPEA 3F19A 4PKRA 1JK3A 4CTHA 1IAAA 2A8HA 1UMSA 3L0VA 5D3CA 3HBUP 1R55A 2JSDA 4XM6A 2OW9A 2YB9A 5JMYA 2X3CA 1KUGA 4JPAA 4EFSA 3USNA 3ZUKA 2X7MA 3AYKA 1RM8A 2D1OA 4GR0A 4Q1LA 4IN9A 3KRYA 4HX3A 3HDAP 2X3AA 4ON1A 1Q3AA 2JNPA 1AF0A 3F16A 1Z3JA 1BQOA 1O0QA 1R1IA 3EDZA 1XFVA 2CLTA 2MZIA 1HY7A 1SLNA 3KMEA 3KWVC 1JKYA 1S4BP 1BUVM 1ASTA 1RMZA 1Y8JA 3TSKA 1JAQA 1UTTA 5D7WA 1JIZA 1MMPA 1FM1A 1GE6A 1B3DA 3LUMA 2YIGA 4H1QA 4WZVA 1QJJA 2K9CA 2D1NA 3P24A 5B5PA 2OZRA 2POJA 4JA1A 3LIRA 3I7GA 1G9KA 4H84A 1JJ9A 4AUOA 4L63A 2RJPA 1OS2A 1FBLA 4GUYA 1FLSA 2OW2A 2DW1A 4PKTA 1XFZA 3LJTA 4QKZA 3RTTA 1CAQA 3HBVP 1D7XA 1G4KA 1QIBA 2ERQA 1OM8A 1Y0VA 1OMJA 2OVZA 1PWPA 3K7NA 3LJZA 3LGPA 1PWUA 1SLMA 2OI0A 1GXDA 2OW0A 1MMBA 1YOUA 2ERPA 3E8RA 3WV1A 1OM6A 2E2DA 3WV3A 2X3BA 1UEAA 3EHYA 4A3WA 3EDIA 1C3IA 1C8TA 3G5CA 4H49A 3AIGA 3LE9A 1XFWA 3KECA 4A7BA 1YP1A 4XCTA 2Y6DA 5BOYA 1YQYA 1D5JA 1L6JA 4L19A 3P1VA 1MMRA 1JIWP 1BQQM 3LILA 3HDBA 1BKCA 1CIZA 1CGEA 3B2ZA 1JAOA 1PWVA 2MLSA 5I4OA 1ZVXA 2USNA 1K7IA 5D2BA 3GBOA 3TVCA 4HMAA 1MNCA 1KUIA 2K2GA 3V96B 3N2VA 5CZMA 456CA 1D8FA 3F15A 1USNA 4DF9A 1IAEA 3EWJA 1ZP5A 3AYUA 1GE7A 2W15A 4DV8A 2XS3A 830CA 1XURA 2N8RA 1K7GA 2L0RA 1DTHA 4GF1A 4DPEA 1G49A 2WO8A 3K7LA 2OW1A 2WO9A 2J83A 3I7IA 2JT6A 2DW2A 2I47A 3DL1A 1ZXCA 3KMCA 2RJQA 4PKUA 3HB2P 2DDYA 4I03A 1J7NA 1UTZA 5D1TA 2EROA 5LABA 3OHLA 2Z2DA 1JAPA 2W13A 4ZR5A 1G05A 3KEKA 4FU4A 3LKAA 1KBCA 1HOVA 1EAKA 3O2XA 2FV9A 4IJOA 2FV5A 1OS9A 5BOTA 5I2ZA 1BZSA 1HTDA 2W14A 1XUCA 2KRJA 1QICA 5BPAA 1IADA 1EUBA 4AIGA 1BIWA 1PWWA 4H3XA 2TCLA 1BM6A 3OHOA 3DWBA 4GR8A 3HYGA 3DSLA 4WF6A 3LIKA 3DNGA 966CA 3LJGA 4H2EA 5L7FA 1WNIA 2DW0A 1IACA 1Y93A 5CUHA 1JH1A 1OO9A 1HV5A 2SRTA 5I3MA 2WOAA 1XUDA 2OY2A 4FXYP 3VTGA 3HY9A 1I76A 1GO7P 4JP4A 2OXWA 1R54A 4R3VA 2JT5A 3KEJA 3UVCA 1AYKA 1QUAA 1ZXVA 3VI1A 3B92A 1UMTA 4PKSA 1CK7A 4GR3A 1KUKA 2HU6A 1OM7A 3U1RA 1BUDA 3MA2A 3TS4A 3LMCA 2AIGP 4I35A 5D1UA 4H82A 3LQBA 4WK7A 2DDFA 3EHXA 5B5OA 4FVLA 4H76A 3N2UA 1BSWA 2O36A 1BKCI 1EB6A 4FXQA 4AXQA 1CGFA 2PJTA 1G12A 2W0DA 3F1AA 2QPJA 1H71P 1ROSA 5I12A 3LQ0A 1JANA 2OVXA 1SU3A 1GKCA 1GKDA 2OXUA 1I1IP 3BA0A 1DMTA 4GWNA 2W12A 4JQGA 1R1JA 3SHIA 1BKCE 3F17A 4PKVA 3ZVSA 3F18A 1HFCA 3EDGA 3KHIA 1ND1A 1KAPP 1QJIA 4IUWA 1R1HA 3Q2GA 4XM8A 5I43A 3L0TA 1QIAA 3ZXHA 1CQRA 3DPFA
chains in the Genus database with same CATH superfamily
1XFXA 1XAXA 1KUHA 3LK8A 4G0DA 3O64A 4JIJA 4WKIA 1K7QA 3TT4A 3RTSA 5D1SA 2CKIA 2JIHA 1I73A 1SRPA 4GQLA 4L6TA 4PKWA 5CXAA 3Q2HA 1C7KA 5L79A 1GO8P 1D8MA 2OXZA 3HY7A 1MMQA 1ZS0A 3WV2A 2MZEA 1IAGA 4PKQA 1KUFA 1SATA 1B8YA 3CKIA 4ILWD 1O0TA 2O3EA 4DD8A 2V4BA 4XM7A 1SMPA 3ELMA 1PWQA 2OY4A 1A86A 1IABA 2Y6CA 3B8ZA 3LUNA 1ATLA 2E3XA 3LEAA 3EDHA 2XS4A 2MZHA 4XBHA 1OZ9A 5H8XA 5I0LA 1HFSA 4WKEA 1AKLA 4AYKA 1A85A 1XFUA 1CXVA 2AYKA 1GE5A 3G42A 1ZTQA 4J4MA 2MLRA 1CGLA 1XFYA 3NX7A 4GWMA 2J0TA 4G9LA 4H30A 1YCMA 3DPEA 3F19A 4PKRA 1JK3A 4CTHA 1IAAA 2A8HA 1UMSA 3L0VA 5D3CA 3HBUP 1R55A 2JSDA 4XM6A 2OW9A 2YB9A 5JMYA 2X3CA 1KUGA 4JPAA 4EFSA 3USNA 3ZUKA 2X7MA 3DTEA 3AYKA 1RM8A 2D1OA 4GR0A 4Q1LA 4IN9A 3KRYA 4HX3A 3HDAP 2X3AA 4ON1A 1Q3AA 2JNPA 1AF0A 3F16A 1XM5A 1Z3JA 1BQOA 1O0QA 1R1IA 3EDZA 1TVIA 1XFVA 2CLTA 2MZIA 1HY7A 1SLNA 3KMEA 3KWVC 1JKYA 1S4BP 1BUVM 1ASTA 1RMZA 1Y8JA 3TSKA 1JAQA 1UTTA 5D7WA 1JIZA 1MMPA 1FM1A 1GE6A 1B3DA 3LUMA 2YIGA 4H1QA 4WZVA 1QJJA 2K9CA 2D1NA 3P24A 5B5PA 2OZRA 2POJA 4JA1A 3LIRA 3I7GA 1G9KA 4H84A 1JJ9A 4AUOA 4L63A 2RJPA 1OS2A 1FBLA 4GUYA 1FLSA 2OW2A 2DW1A 4PKTA 1XFZA 3LJTA 4QKZA 3RTTA 1CAQA 3HBVP 1D7XA 1G4KA 1QIBA 2ERQA 1OM8A 1Y0VA 1OMJA 2OVZA 1PWPA 3K7NA 3LJZA 3LGPA 1PWUA 1SLMA 2OI0A 1GXDA 2OW0A 1MMBA 1YOUA 2ERPA 3E8RA 3WV1A 1OM6A 2E2DA 3WV3A 3DTKA 2X3BA 1UEAA 3EHYA 4A3WA 3EDIA 1C3IA 1C8TA 3G5CA 4H49A 3AIGA 3LE9A 1XFWA 3KECA 4A7BA 1YP1A 4XCTA 2Y6DA 5BOYA 1YQYA 1D5JA 1L6JA 4L19A 3P1VA 1MMRA 1JIWP 1BQQM 3LILA 3HDBA 1BKCA 1CIZA 1CGEA 3B2ZA 1JAOA 1PWVA 2MLSA 5I4OA 1ZVXA 2USNA 1K7IA 5D2BA 3GBOA 3TVCA 4HMAA 1MNCA 1KUIA 2K2GA 3V96B 3N2VA 5CZMA 456CA 1D8FA 3F15A 1USNA 4L7AA 4DF9A 1IAEA 3EWJA 1ZP5A 3AYUA 1GE7A 2W15A 4DV8A 2XS3A 830CA 1XURA 2N8RA 1K7GA 2L0RA 1DTHA 4GF1A 4DPEA 1G49A 2WO8A 3K7LA 2OW1A 2WO9A 2J83A 3I7IA 2JT6A 2DW2A 2I47A 3DL1A 1ZXCA 3KMCA 2RJQA 4PKUA 3HB2P 2DDYA 4I03A 1J7NA 1UTZA 5D1TA 2EROA 5LABA 3OHLA 2Z2DA 1JAPA 2W13A 4ZR5A 1G05A 3KEKA 4FU4A 3LKAA 1KBCA 1HOVA 1EAKA 3O2XA 2FV9A 4IJOA 2FV5A 1OS9A 5BOTA 5I2ZA 1BZSA 1HTDA 2W14A 1XUCA 2KRJA 1QICA 5BPAA 1IADA 1EUBA 4AIGA 1BIWA 1PWWA 4H3XA 2TCLA 1BM6A 3OHOA 3DWBA 4GR8A 3HYGA 3DSLA 4WF6A 3LIKA 3DNGA 966CA 3LJGA 4H2EA 5L7FA 1WNIA 2DW0A 1IACA 1Y93A 5CUHA 1JH1A 1OO9A 1HV5A 2SRTA 5I3MA 2WOAA 1XUDA 2OY2A 4FXYP 3VTGA 3HY9A 1I76A 1GO7P 4JP4A 2OXWA 1R54A 4R3VA 2JT5A 3KEJA 3UVCA 1AYKA 1QUAA 1ZXVA 3VI1A 3B92A 1UMTA 4PKSA 1CK7A 4GR3A 1KUKA 2HU6A 1OM7A 3U1RA 2YUFA 1BUDA 3MA2A 3TS4A 3LMCA 2AIGP 4I35A 5D1UA 4H82A 3LQBA 4WK7A 2DDFA 3EHXA 5B5OA 4FVLA 4H76A 3N2UA 1BSWA 2O36A 1BKCI 1EB6A 4FXQA 4AXQA 1CGFA 2PJTA 1G12A 2W0DA 3F1AA 2QPJA 1H71P 1ROSA 5I12A 3LQ0A 1JANA 2OVXA 1SU3A 1GKCA 1GKDA 2OXUA 1I1IP 3BA0A 1DMTA 4GWNA 2W12A 4JQGA 1R1JA 3SHIA 1BKCE 3F17A 4PKVA 3ZVSA 3F18A 1HFCA 3EDGA 3KHIA 1ND1A 1KAPP 1QJIA 4IUWA 1R1HA 3Q2GA 4XM8A 5I43A 3L0TA 3DTIA 1QIAA 3ZXHA 1CQRA 3DPFA
chains in the Genus database with same CATH topology
1XFXA 1KUHA 3LK8A 4G0DA 3O64A 4JIJA 4WKIA 1K7QA 3TT4A 3RTSA 5D1SA 2CKIA 2JIHA 1I73A 1SRPA 4GQLA 4L6TA 4PKWA 5CXAA 3Q2HA 1C7KA 5L79A 1GO8P 1D8MA 2OXZA 3HY7A 1MMQA 1ZS0A 3WV2A 2MZEA 1IAGA 4PKQA 1KUFA 1SATA 1B8YA 3CKIA 4ILWD 1O0TA 2O3EA 4DD8A 2V4BA 4XM7A 1SMPA 3ELMA 1PWQA 2OY4A 1A86A 1IABA 2Y6CA 3B8ZA 3LUNA 1ATLA 2E3XA 3LEAA 3EDHA 2XS4A 2MZHA 4XBHA 5H8XA 5I0LA 1HFSA 4WKEA 1AKLA 4AYKA 1A85A 1XFUA 1CXVA 2AYKA 1GE5A 3G42A 1ZTQA 4J4MA 2MLRA 1CGLA 1XFYA 3NX7A 4GWMA 2J0TA 4G9LA 4H30A 1YCMA 3DPEA 3F19A 4PKRA 1JK3A 4CTHA 1IAAA 2A8HA 1UMSA 3L0VA 5D3CA 3HBUP 1R55A 2JSDA 4XM6A 2OW9A 2YB9A 5JMYA 2X3CA 1KUGA 4JPAA 4EFSA 3USNA 3ZUKA 2X7MA 3DTEA 3AYKA 1RM8A 2D1OA 4GR0A 4Q1LA 4IN9A 3KRYA 4HX3A 3HDAP 2X3AA 4ON1A 1Q3AA 2JNPA 1AF0A 3F16A 1Z3JA 1BQOA 1O0QA 1R1IA 3EDZA 1XFVA 2CLTA 2MZIA 1HY7A 1SLNA 3KMEA 3KWVC 1JKYA 1S4BP 1BUVM 1ASTA 1RMZA 1Y8JA 3TSKA 1JAQA 1UTTA 5D7WA 1JIZA 1MMPA 1FM1A 1GE6A 1B3DA 3LUMA 2YIGA 4H1QA 4WZVA 1QJJA 2K9CA 2D1NA 3P24A 5B5PA 2OZRA 2POJA 4JA1A 3LIRA 3I7GA 1G9KA 4H84A 1JJ9A 4AUOA 4L63A 2RJPA 1OS2A 1FBLA 4GUYA 1FLSA 2OW2A 2DW1A 4PKTA 1XFZA 3LJTA 4QKZA 3RTTA 1CAQA 3HBVP 1D7XA 1G4KA 1QIBA 2ERQA 1OM8A 1Y0VA 1OMJA 2OVZA 1PWPA 3K7NA 3LJZA 3LGPA 1PWUA 1SLMA 2OI0A 1GXDA 2OW0A 1MMBA 1YOUA 2ERPA 3E8RA 3WV1A 1OM6A 2E2DA 3WV3A 3DTKA 2X3BA 1UEAA 3EHYA 4A3WA 3EDIA 1C3IA 1C8TA 3G5CA 4H49A 3AIGA 3LE9A 1XFWA 3KECA 4A7BA 1YP1A 4XCTA 2Y6DA 5BOYA 1YQYA 1D5JA 1L6JA 4L19A 3P1VA 1MMRA 1JIWP 1BQQM 3LILA 3HDBA 1BKCA 1CIZA 1CGEA 3B2ZA 1JAOA 1PWVA 2MLSA 5I4OA 1ZVXA 2USNA 1K7IA 5D2BA 3GBOA 3TVCA 4HMAA 1MNCA 1KUIA 2K2GA 3V96B 3N2VA 5CZMA 456CA 1D8FA 3F15A 1USNA 4L7AA 4DF9A 1IAEA 3EWJA 1ZP5A 3AYUA 1GE7A 2W15A 4DV8A 2XS3A 830CA 1XURA 2N8RA 1K7GA 2L0RA 1DTHA 4GF1A 4DPEA 1G49A 2WO8A 3K7LA 2OW1A 2WO9A 2J83A 3I7IA 2JT6A 2DW2A 2I47A 3DL1A 1ZXCA 3KMCA 2RJQA 4PKUA 3HB2P 2DDYA 4I03A 1J7NA 1UTZA 5D1TA 2EROA 5LABA 3OHLA 2Z2DA 1JAPA 2W13A 4ZR5A 1G05A 3KEKA 4FU4A 3LKAA 1KBCA 1HOVA 1EAKA 3O2XA 2FV9A 4IJOA 2FV5A 1OS9A 5BOTA 5I2ZA 1BZSA 1HTDA 2W14A 1XUCA 2KRJA 1QICA 5BPAA 1IADA 1EUBA 4AIGA 1BIWA 1PWWA 4H3XA 2TCLA 1BM6A 3OHOA 3DWBA 4GR8A 3HYGA 3DSLA 4WF6A 3LIKA 3DNGA 966CA 3LJGA 4H2EA 5L7FA 1WNIA 2DW0A 1IACA 1Y93A 5CUHA 1JH1A 1OO9A 1HV5A 2SRTA 5I3MA 2WOAA 1XUDA 2OY2A 4FXYP 3VTGA 3HY9A 1I76A 1GO7P 4JP4A 2OXWA 1R54A 4R3VA 2JT5A 3KEJA 3UVCA 1AYKA 1QUAA 1ZXVA 3VI1A 3B92A 1UMTA 4PKSA 1CK7A 4GR3A 1KUKA 2HU6A 1OM7A 3U1RA 2YUFA 1BUDA 3MA2A 3TS4A 3LMCA 2AIGP 4I35A 5D1UA 4H82A 3LQBA 4WK7A 2DDFA 3EHXA 5B5OA 4FVLA 4H76A 3N2UA 1BSWA 2O36A 1BKCI 1EB6A 4FXQA 4AXQA 1CGFA 2PJTA 1G12A 2W0DA 3F1AA 2QPJA 1H71P 1ROSA 5I12A 3LQ0A 1JANA 2OVXA 1SU3A 1GKCA 1GKDA 2OXUA 1I1IP 3BA0A 1DMTA 4GWNA 2W12A 4JQGA 1R1JA 3SHIA 1BKCE 3F17A 4PKVA 3ZVSA 3F18A 1HFCA 3EDGA 3KHIA 1ND1A 1KAPP 1QJIA 4IUWA 1R1HA 3Q2GA 4XM8A 5I43A 3L0TA 3DTIA 1QIAA 3ZXHA 1CQRA 3DPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFX A;  1KUH A;  3LK8 A;  4G0D A;  3O64 A;  4JIJ A;  4WKI A;  1K7Q A;  3TT4 A;  3RTS A;  5D1S A;  2CKI A;  2JIH A;  1I73 A;  1SRP A;  4GQL A;  4L6T A;  4PKW A;  5CXA A;  3Q2H A;  1C7K A;  5L79 A;  1GO8 P;  1D8M A;  2OXZ A;  3HY7 A;  1MMQ A;  1ZS0 A;  3WV2 A;  2MZE A;  1IAG A;  4PKQ A;  1KUF A;  1SAT A;  1B8Y A;  3CKI A;  4ILW D;  1O0T A;  2O3E A;  4DD8 A;  2V4B A;  4XM7 A;  1SMP A;  3ELM A;  1PWQ A;  2OY4 A;  1A86 A;  1IAB A;  2Y6C A;  3B8Z A;  3LUN A;  1ATL A;  2E3X A;  3LEA A;  3EDH A;  2XS4 A;  2MZH A;  4XBH A;  5H8X A;  5I0L A;  1HFS A;  4WKE A;  1AKL A;  4AYK A;  1A85 A;  1XFU A;  1CXV A;  2AYK A;  1GE5 A;  3G42 A;  1ZTQ A;  4J4M A;  2MLR A;  1CGL A;  1XFY A;  3NX7 A;  4GWM A;  2J0T A;  4G9L A;  4H30 A;  1YCM A;  3DPE A;  3F19 A;  4PKR A;  1JK3 A;  4CTH A;  1IAA A;  2A8H A;  1UMS A;  3L0V A;  5D3C A;  3HBU P;  1R55 A;  2JSD A;  4XM6 A;  2OW9 A;  2YB9 A;  5JMY A;  2X3C A;  1KUG A;  4JPA A;  4EFS A;  3USN A;  3ZUK A;  2X7M A;  3AYK A;  1RM8 A;  2D1O A;  4GR0 A;  4Q1L A;  4IN9 A;  3KRY A;  4HX3 A;  3HDA P;  2X3A A;  4ON1 A;  1Q3A A;  2JNP A;  1AF0 A;  3F16 A;  1Z3J A;  1BQO A;  1O0Q A;  1R1I A;  3EDZ A;  1XFV A;  2CLT A;  2MZI A;  1HY7 A;  1SLN A;  3KME A;  3KWV C;  1JKY A;  1S4B P;  1BUV M;  1AST A;  1RMZ A;  1Y8J A;  3TSK A;  1JAQ A;  1UTT A;  5D7W A;  1JIZ A;  1MMP A;  1FM1 A;  1GE6 A;  1B3D A;  3LUM A;  2YIG A;  4H1Q A;  4WZV A;  1QJJ A;  2K9C A;  2D1N A;  3P24 A;  5B5P A;  2OZR A;  2POJ A;  4JA1 A;  3LIR A;  3I7G A;  1G9K A;  4H84 A;  1JJ9 A;  4AUO A;  4L63 A;  2RJP A;  1OS2 A;  1FBL A;  4GUY A;  1FLS A;  2OW2 A;  2DW1 A;  4PKT A;  1XFZ A;  3LJT A;  4QKZ A;  3RTT A;  1CAQ A;  3HBV P;  1D7X A;  1G4K A;  1QIB A;  2ERQ A;  1OM8 A;  1Y0V A;  1OMJ A;  2OVZ A;  1PWP A;  3K7N A;  3LJZ A;  3LGP A;  1PWU A;  1SLM A;  2OI0 A;  1GXD A;  2OW0 A;  1MMB A;  1YOU A;  2ERP A;  3E8R A;  3WV1 A;  1OM6 A;  2E2D A;  3WV3 A;  2X3B A;  1UEA A;  3EHY A;  4A3W A;  3EDI A;  1C3I A;  1C8T A;  3G5C A;  4H49 A;  3AIG A;  3LE9 A;  1XFW A;  3KEC A;  4A7B A;  1YP1 A;  4XCT A;  2Y6D A;  5BOY A;  1YQY A;  1D5J A;  1L6J A;  4L19 A;  3P1V A;  1MMR A;  1JIW P;  1BQQ M;  3LIL A;  3HDB A;  1BKC A;  1CIZ A;  1CGE A;  3B2Z A;  1JAO A;  1PWV A;  2MLS A;  5I4O A;  1ZVX A;  2USN A;  1K7I A;  5D2B A;  3GBO A;  3TVC A;  4HMA A;  1MNC A;  1KUI A;  2K2G A;  3V96 B;  3N2V A;  5CZM A;  456C A;  1D8F A;  3F15 A;  1USN A;  4DF9 A;  1IAE A;  3EWJ A;  1ZP5 A;  3AYU A;  1GE7 A;  2W15 A;  4DV8 A;  2XS3 A;  830C A;  1XUR A;  2N8R A;  1K7G A;  2L0R A;  1DTH A;  4GF1 A;  4DPE A;  1G49 A;  2WO8 A;  3K7L A;  2OW1 A;  2WO9 A;  2J83 A;  3I7I A;  2JT6 A;  2DW2 A;  2I47 A;  3DL1 A;  1ZXC A;  3KMC A;  2RJQ A;  4PKU A;  3HB2 P;  2DDY A;  4I03 A;  1J7N A;  1UTZ A;  5D1T A;  2ERO A;  5LAB A;  3OHL A;  2Z2D A;  1JAP A;  2W13 A;  4ZR5 A;  1G05 A;  3KEK A;  4FU4 A;  3LKA A;  1KBC A;  1HOV A;  1EAK A;  3O2X A;  2FV9 A;  4IJO A;  2FV5 A;  1OS9 A;  5BOT A;  5I2Z A;  1BZS A;  1HTD A;  2W14 A;  1XUC A;  2KRJ A;  1QIC A;  5BPA A;  1IAD A;  1EUB A;  4AIG A;  1BIW A;  1PWW A;  4H3X A;  2TCL A;  1BM6 A;  3OHO A;  3DWB A;  4GR8 A;  3HYG A;  3DSL A;  4WF6 A;  3LIK A;  3DNG A;  966C A;  3LJG A;  4H2E A;  5L7F A;  1WNI A;  2DW0 A;  1IAC A;  1Y93 A;  5CUH A;  1JH1 A;  1OO9 A;  1HV5 A;  2SRT A;  5I3M A;  2WOA A;  1XUD A;  2OY2 A;  4FXY P;  3VTG A;  3HY9 A;  1I76 A;  1GO7 P;  4JP4 A;  2OXW A;  1R54 A;  4R3V A;  2JT5 A;  3KEJ A;  3UVC A;  1AYK A;  1QUA A;  1ZXV A;  3VI1 A;  3B92 A;  1UMT A;  4PKS A;  1CK7 A;  4GR3 A;  1KUK A;  2HU6 A;  1OM7 A;  3U1R A;  1BUD A;  3MA2 A;  3TS4 A;  3LMC A;  2AIG P;  4I35 A;  5D1U A;  4H82 A;  3LQB A;  4WK7 A;  2DDF A;  3EHX A;  5B5O A;  4FVL A;  4H76 A;  3N2U A;  1BSW A;  2O36 A;  1BKC I;  1EB6 A;  4FXQ A;  4AXQ A;  1CGF A;  2PJT A;  1G12 A;  2W0D A;  3F1A A;  2QPJ A;  1H71 P;  1ROS A;  5I12 A;  3LQ0 A;  1JAN A;  2OVX A;  1SU3 A;  1GKC A;  1GKD A;  2OXU A;  1I1I P;  3BA0 A;  1DMT A;  4GWN A;  2W12 A;  4JQG A;  1R1J A;  3SHI A;  1BKC E;  3F17 A;  4PKV A;  3ZVS A;  3F18 A;  1HFC A;  3EDG A;  3KHI A;  1ND1 A;  1KAP P;  1QJI A;  4IUW A;  1R1H A;  3Q2G A;  4XM8 A;  5I43 A;  3L0T A;  1QIA A;  3ZXH A;  1CQR A;  3DPF A; 
#chains in the Genus database with same CATH topology
 1XFX A;  1XAX A;  1KUH A;  3LK8 A;  4G0D A;  3O64 A;  4JIJ A;  4WKI A;  1K7Q A;  3TT4 A;  3RTS A;  5D1S A;  2CKI A;  2JIH A;  1I73 A;  1SRP A;  4GQL A;  4L6T A;  4PKW A;  5CXA A;  3Q2H A;  1C7K A;  5L79 A;  1GO8 P;  1D8M A;  2OXZ A;  3HY7 A;  1MMQ A;  1ZS0 A;  3WV2 A;  2MZE A;  1IAG A;  4PKQ A;  1KUF A;  1SAT A;  1B8Y A;  3CKI A;  4ILW D;  1O0T A;  2O3E A;  4DD8 A;  2V4B A;  4XM7 A;  1SMP A;  3ELM A;  1PWQ A;  2OY4 A;  1A86 A;  1IAB A;  2Y6C A;  3B8Z A;  3LUN A;  1ATL A;  2E3X A;  3LEA A;  3EDH A;  2XS4 A;  2MZH A;  4XBH A;  1OZ9 A;  5H8X A;  5I0L A;  1HFS A;  4WKE A;  1AKL A;  4AYK A;  1A85 A;  1XFU A;  1CXV A;  2AYK A;  1GE5 A;  3G42 A;  1ZTQ A;  4J4M A;  2MLR A;  1CGL A;  1XFY A;  3NX7 A;  4GWM A;  2J0T A;  4G9L A;  4H30 A;  1YCM A;  3DPE A;  3F19 A;  4PKR A;  1JK3 A;  4CTH A;  1IAA A;  2A8H A;  1UMS A;  3L0V A;  5D3C A;  3HBU P;  1R55 A;  2JSD A;  4XM6 A;  2OW9 A;  2YB9 A;  5JMY A;  2X3C A;  1KUG A;  4JPA A;  4EFS A;  3USN A;  3ZUK A;  2X7M A;  3DTE A;  3AYK A;  1RM8 A;  2D1O A;  4GR0 A;  4Q1L A;  4IN9 A;  3KRY A;  4HX3 A;  3HDA P;  2X3A A;  4ON1 A;  1Q3A A;  2JNP A;  1AF0 A;  3F16 A;  1XM5 A;  1Z3J A;  1BQO A;  1O0Q A;  1R1I A;  3EDZ A;  1TVI A;  1XFV A;  2CLT A;  2MZI A;  1HY7 A;  1SLN A;  3KME A;  3KWV C;  1JKY A;  1S4B P;  1BUV M;  1AST A;  1RMZ A;  1Y8J A;  3TSK A;  1JAQ A;  1UTT A;  5D7W A;  1JIZ A;  1MMP A;  1FM1 A;  1GE6 A;  1B3D A;  3LUM A;  2YIG A;  4H1Q A;  4WZV A;  1QJJ A;  2K9C A;  2D1N A;  3P24 A;  5B5P A;  2OZR A;  2POJ A;  4JA1 A;  3LIR A;  3I7G A;  1G9K A;  4H84 A;  1JJ9 A;  4AUO A;  4L63 A;  2RJP A;  1OS2 A;  1FBL A;  4GUY A;  1FLS A;  2OW2 A;  2DW1 A;  4PKT A;  1XFZ A;  3LJT A;  4QKZ A;  3RTT A;  1CAQ A;  3HBV P;  1D7X A;  1G4K A;  1QIB A;  2ERQ A;  1OM8 A;  1Y0V A;  1OMJ A;  2OVZ A;  1PWP A;  3K7N A;  3LJZ A;  3LGP A;  1PWU A;  1SLM A;  2OI0 A;  1GXD A;  2OW0 A;  1MMB A;  1YOU A;  2ERP A;  3E8R A;  3WV1 A;  1OM6 A;  2E2D A;  3WV3 A;  3DTK A;  2X3B A;  1UEA A;  3EHY A;  4A3W A;  3EDI A;  1C3I A;  1C8T A;  3G5C A;  4H49 A;  3AIG A;  3LE9 A;  1XFW A;  3KEC A;  4A7B A;  1YP1 A;  4XCT A;  2Y6D A;  5BOY A;  1YQY A;  1D5J A;  1L6J A;  4L19 A;  3P1V A;  1MMR A;  1JIW P;  1BQQ M;  3LIL A;  3HDB A;  1BKC A;  1CIZ A;  1CGE A;  3B2Z A;  1JAO A;  1PWV A;  2MLS A;  5I4O A;  1ZVX A;  2USN A;  1K7I A;  5D2B A;  3GBO A;  3TVC A;  4HMA A;  1MNC A;  1KUI A;  2K2G A;  3V96 B;  3N2V A;  5CZM A;  456C A;  1D8F A;  3F15 A;  1USN A;  4L7A A;  4DF9 A;  1IAE A;  3EWJ A;  1ZP5 A;  3AYU A;  1GE7 A;  2W15 A;  4DV8 A;  2XS3 A;  830C A;  1XUR A;  2N8R A;  1K7G A;  2L0R A;  1DTH A;  4GF1 A;  4DPE A;  1G49 A;  2WO8 A;  3K7L A;  2OW1 A;  2WO9 A;  2J83 A;  3I7I A;  2JT6 A;  2DW2 A;  2I47 A;  3DL1 A;  1ZXC A;  3KMC A;  2RJQ A;  4PKU A;  3HB2 P;  2DDY A;  4I03 A;  1J7N A;  1UTZ A;  5D1T A;  2ERO A;  5LAB A;  3OHL A;  2Z2D A;  1JAP A;  2W13 A;  4ZR5 A;  1G05 A;  3KEK A;  4FU4 A;  3LKA A;  1KBC A;  1HOV A;  1EAK A;  3O2X A;  2FV9 A;  4IJO A;  2FV5 A;  1OS9 A;  5BOT A;  5I2Z A;  1BZS A;  1HTD A;  2W14 A;  1XUC A;  2KRJ A;  1QIC A;  5BPA A;  1IAD A;  1EUB A;  4AIG A;  1BIW A;  1PWW A;  4H3X A;  2TCL A;  1BM6 A;  3OHO A;  3DWB A;  4GR8 A;  3HYG A;  3DSL A;  4WF6 A;  3LIK A;  3DNG A;  966C A;  3LJG A;  4H2E A;  5L7F A;  1WNI A;  2DW0 A;  1IAC A;  1Y93 A;  5CUH A;  1JH1 A;  1OO9 A;  1HV5 A;  2SRT A;  5I3M A;  2WOA A;  1XUD A;  2OY2 A;  4FXY P;  3VTG A;  3HY9 A;  1I76 A;  1GO7 P;  4JP4 A;  2OXW A;  1R54 A;  4R3V A;  2JT5 A;  3KEJ A;  3UVC A;  1AYK A;  1QUA A;  1ZXV A;  3VI1 A;  3B92 A;  1UMT A;  4PKS A;  1CK7 A;  4GR3 A;  1KUK A;  2HU6 A;  1OM7 A;  3U1R A;  2YUF A;  1BUD A;  3MA2 A;  3TS4 A;  3LMC A;  2AIG P;  4I35 A;  5D1U A;  4H82 A;  3LQB A;  4WK7 A;  2DDF A;  3EHX A;  5B5O A;  4FVL A;  4H76 A;  3N2U A;  1BSW A;  2O36 A;  1BKC I;  1EB6 A;  4FXQ A;  4AXQ A;  1CGF A;  2PJT A;  1G12 A;  2W0D A;  3F1A A;  2QPJ A;  1H71 P;  1ROS A;  5I12 A;  3LQ0 A;  1JAN A;  2OVX A;  1SU3 A;  1GKC A;  1GKD A;  2OXU A;  1I1I P;  3BA0 A;  1DMT A;  4GWN A;  2W12 A;  4JQG A;  1R1J A;  3SHI A;  1BKC E;  3F17 A;  4PKV A;  3ZVS A;  3F18 A;  1HFC A;  3EDG A;  3KHI A;  1ND1 A;  1KAP P;  1QJI A;  4IUW A;  1R1H A;  3Q2G A;  4XM8 A;  5I43 A;  3L0T A;  3DTI A;  1QIA A;  3ZXH A;  1CQR A;  3DPF A; 
#chains in the Genus database with same CATH homology
 1XFX A;  1KUH A;  3LK8 A;  4G0D A;  3O64 A;  4JIJ A;  4WKI A;  1K7Q A;  3TT4 A;  3RTS A;  5D1S A;  2CKI A;  2JIH A;  1I73 A;  1SRP A;  4GQL A;  4L6T A;  4PKW A;  5CXA A;  3Q2H A;  1C7K A;  5L79 A;  1GO8 P;  1D8M A;  2OXZ A;  3HY7 A;  1MMQ A;  1ZS0 A;  3WV2 A;  2MZE A;  1IAG A;  4PKQ A;  1KUF A;  1SAT A;  1B8Y A;  3CKI A;  4ILW D;  1O0T A;  2O3E A;  4DD8 A;  2V4B A;  4XM7 A;  1SMP A;  3ELM A;  1PWQ A;  2OY4 A;  1A86 A;  1IAB A;  2Y6C A;  3B8Z A;  3LUN A;  1ATL A;  2E3X A;  3LEA A;  3EDH A;  2XS4 A;  2MZH A;  4XBH A;  5H8X A;  5I0L A;  1HFS A;  4WKE A;  1AKL A;  4AYK A;  1A85 A;  1XFU A;  1CXV A;  2AYK A;  1GE5 A;  3G42 A;  1ZTQ A;  4J4M A;  2MLR A;  1CGL A;  1XFY A;  3NX7 A;  4GWM A;  2J0T A;  4G9L A;  4H30 A;  1YCM A;  3DPE A;  3F19 A;  4PKR A;  1JK3 A;  4CTH A;  1IAA A;  2A8H A;  1UMS A;  3L0V A;  5D3C A;  3HBU P;  1R55 A;  2JSD A;  4XM6 A;  2OW9 A;  2YB9 A;  5JMY A;  2X3C A;  1KUG A;  4JPA A;  4EFS A;  3USN A;  3ZUK A;  2X7M A;  3DTE A;  3AYK A;  1RM8 A;  2D1O A;  4GR0 A;  4Q1L A;  4IN9 A;  3KRY A;  4HX3 A;  3HDA P;  2X3A A;  4ON1 A;  1Q3A A;  2JNP A;  1AF0 A;  3F16 A;  1Z3J A;  1BQO A;  1O0Q A;  1R1I A;  3EDZ A;  1XFV A;  2CLT A;  2MZI A;  1HY7 A;  1SLN A;  3KME A;  3KWV C;  1JKY A;  1S4B P;  1BUV M;  1AST A;  1RMZ A;  1Y8J A;  3TSK A;  1JAQ A;  1UTT A;  5D7W A;  1JIZ A;  1MMP A;  1FM1 A;  1GE6 A;  1B3D A;  3LUM A;  2YIG A;  4H1Q A;  4WZV A;  1QJJ A;  2K9C A;  2D1N A;  3P24 A;  5B5P A;  2OZR A;  2POJ A;  4JA1 A;  3LIR A;  3I7G A;  1G9K A;  4H84 A;  1JJ9 A;  4AUO A;  4L63 A;  2RJP A;  1OS2 A;  1FBL A;  4GUY A;  1FLS A;  2OW2 A;  2DW1 A;  4PKT A;  1XFZ A;  3LJT A;  4QKZ A;  3RTT A;  1CAQ A;  3HBV P;  1D7X A;  1G4K A;  1QIB A;  2ERQ A;  1OM8 A;  1Y0V A;  1OMJ A;  2OVZ A;  1PWP A;  3K7N A;  3LJZ A;  3LGP A;  1PWU A;  1SLM A;  2OI0 A;  1GXD A;  2OW0 A;  1MMB A;  1YOU A;  2ERP A;  3E8R A;  3WV1 A;  1OM6 A;  2E2D A;  3WV3 A;  3DTK A;  2X3B A;  1UEA A;  3EHY A;  4A3W A;  3EDI A;  1C3I A;  1C8T A;  3G5C A;  4H49 A;  3AIG A;  3LE9 A;  1XFW A;  3KEC A;  4A7B A;  1YP1 A;  4XCT A;  2Y6D A;  5BOY A;  1YQY A;  1D5J A;  1L6J A;  4L19 A;  3P1V A;  1MMR A;  1JIW P;  1BQQ M;  3LIL A;  3HDB A;  1BKC A;  1CIZ A;  1CGE A;  3B2Z A;  1JAO A;  1PWV A;  2MLS A;  5I4O A;  1ZVX A;  2USN A;  1K7I A;  5D2B A;  3GBO A;  3TVC A;  4HMA A;  1MNC A;  1KUI A;  2K2G A;  3V96 B;  3N2V A;  5CZM A;  456C A;  1D8F A;  3F15 A;  1USN A;  4L7A A;  4DF9 A;  1IAE A;  3EWJ A;  1ZP5 A;  3AYU A;  1GE7 A;  2W15 A;  4DV8 A;  2XS3 A;  830C A;  1XUR A;  2N8R A;  1K7G A;  2L0R A;  1DTH A;  4GF1 A;  4DPE A;  1G49 A;  2WO8 A;  3K7L A;  2OW1 A;  2WO9 A;  2J83 A;  3I7I A;  2JT6 A;  2DW2 A;  2I47 A;  3DL1 A;  1ZXC A;  3KMC A;  2RJQ A;  4PKU A;  3HB2 P;  2DDY A;  4I03 A;  1J7N A;  1UTZ A;  5D1T A;  2ERO A;  5LAB A;  3OHL A;  2Z2D A;  1JAP A;  2W13 A;  4ZR5 A;  1G05 A;  3KEK A;  4FU4 A;  3LKA A;  1KBC A;  1HOV A;  1EAK A;  3O2X A;  2FV9 A;  4IJO A;  2FV5 A;  1OS9 A;  5BOT A;  5I2Z A;  1BZS A;  1HTD A;  2W14 A;  1XUC A;  2KRJ A;  1QIC A;  5BPA A;  1IAD A;  1EUB A;  4AIG A;  1BIW A;  1PWW A;  4H3X A;  2TCL A;  1BM6 A;  3OHO A;  3DWB A;  4GR8 A;  3HYG A;  3DSL A;  4WF6 A;  3LIK A;  3DNG A;  966C A;  3LJG A;  4H2E A;  5L7F A;  1WNI A;  2DW0 A;  1IAC A;  1Y93 A;  5CUH A;  1JH1 A;  1OO9 A;  1HV5 A;  2SRT A;  5I3M A;  2WOA A;  1XUD A;  2OY2 A;  4FXY P;  3VTG A;  3HY9 A;  1I76 A;  1GO7 P;  4JP4 A;  2OXW A;  1R54 A;  4R3V A;  2JT5 A;  3KEJ A;  3UVC A;  1AYK A;  1QUA A;  1ZXV A;  3VI1 A;  3B92 A;  1UMT A;  4PKS A;  1CK7 A;  4GR3 A;  1KUK A;  2HU6 A;  1OM7 A;  3U1R A;  2YUF A;  1BUD A;  3MA2 A;  3TS4 A;  3LMC A;  2AIG P;  4I35 A;  5D1U A;  4H82 A;  3LQB A;  4WK7 A;  2DDF A;  3EHX A;  5B5O A;  4FVL A;  4H76 A;  3N2U A;  1BSW A;  2O36 A;  1BKC I;  1EB6 A;  4FXQ A;  4AXQ A;  1CGF A;  2PJT A;  1G12 A;  2W0D A;  3F1A A;  2QPJ A;  1H71 P;  1ROS A;  5I12 A;  3LQ0 A;  1JAN A;  2OVX A;  1SU3 A;  1GKC A;  1GKD A;  2OXU A;  1I1I P;  3BA0 A;  1DMT A;  4GWN A;  2W12 A;  4JQG A;  1R1J A;  3SHI A;  1BKC E;  3F17 A;  4PKV A;  3ZVS A;  3F18 A;  1HFC A;  3EDG A;  3KHI A;  1ND1 A;  1KAP P;  1QJI A;  4IUW A;  1R1H A;  3Q2G A;  4XM8 A;  5I43 A;  3L0T A;  3DTI A;  1QIA A;  3ZXH A;  1CQR A;  3DPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...