1BUVM

Crystal structure of the mt1-mmp-timp-2 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
174
structure length
174
Chain Sequence
IQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MEMBRANE-TYPE MATRIX METALLOPROTEINASE (CDMT1-MMP))
publication title Crystal structure of the complex formed by the membrane type 1-matrix metalloproteinase with the tissue inhibitor of metalloproteinases-2, the soluble progelatinase A receptor.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 35
structure length 174
sequence length 174
ec nomenclature ec 3.4.24.80: Membrane-type matrix metalloproteinase-1.
pdb deposition date 1998-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1buvM00
1XFZA 3Q2GA 1JH1A 1Y0VA 1D7XA 1QUAA 3DWBA 1FM1A 5D3CA 5I0LA 3L0VA 1YP1A 4JIJA 1K7GA 2DW2A 3TSKA 3DPFA 1UEAA 1MMQA 2OW2A 1I73A 1YQYA 1GO8P 1QJJA 1GXDA 3TS4A 1XFYA 1PWQA 1SATA 5D2BA 2A8HA 2YIGA 1CGFA 1XUDA 1C8TA 2XS4A 3F15A 4WF6A 1QICA 3DSLA 5CZMA 1XFUA 2MLRA 3E8RA 1IACA 2MLSA 2X3CA 4ZR5A 5I3MA 2W12A 2JSDA 4G9LA 1O0TA 1KUHA 3B2ZA 2OY2A 1RM8A 2JIHA 2OW1A 1SMPA 3HBUP 1JKYA 5H8XA 5LABA 1EB6A 4GWNA 1OM6A 2OVXA 3LIRA 1HOVA 1JAQA 1KUGA 1HFSA 3WV3A 2ERPA 4PKVA 4H30A 1IADA 1ZXCA 2MZIA 3I7IA 4GR0A 2X3AA 4XM8A 3V96B 3OHOA 1D8FA 3DL1A 1BQQM 2DW0A 3KMEA 1OMJA 1GE6A 1GKDA 4EFSA 1QIBA 1ZVXA 1JIWP 1CK7A 4L6TA 1OO9A 1SLNA 2XS3A 1JAPA 3KMCA 2L0RA 3LILA 3WV1A 4DV8A 1ROSA 3LJZA 1ZXVA 3NX7A 1PWVA 3I7GA 1GE5A 4I03A 3EDGA 4AYKA 1UMSA 2JNPA 1MNCA 4XCTA 3G5CA 2W0DA 4GR8A 2PJTA 3F1AA 1CAQA 1S4BP 2X7MA 4IJOA 3AYKA 4H76A 1BUDA 1GO7P 2D1NA 1FBLA 1D8MA 3N2VA 2J83A 3EDZA 2QPJA 2K9CA 2W13A 3KEKA 4PKRA 4WKIA 2HU6A 3EWJA 3ELMA 3RTSA 3OHLA 4WZVA 5BOYA 1AF0A 1UMTA 4H1QA 2FV9A 3Q2HA 1R54A 1ASTA 3LEAA 4L19A 1DMTA 3O64A 3LQBA 1B3DA 4JQGA 1KUFA 2OW9A 4FXQA 1KBCA 3ZUKA 3G42A 4ON1A 1HV5A 2WO9A 3SHIA 3VTGA 4AXQA 1OS2A 1MMPA 1O0QA 3LMCA 3F18A 5I2ZA 1BIWA 1SRPA 1SLMA 2KRJA 2AIGP 4PKUA 4H82A 1IABA 2J0TA 1BUVM 1KAPP 3HDBA 4GF1A 4XM6A 4G0DA 5JMYA 3TVCA 4HX3A 1Z3JA 1SU3A 4A3WA 3BA0A 1Y93A 5L79A 1ZP5A 3EHXA 3TT4A 3F17A 3WV2A 2YB9A 3LJTA 3F19A 3LKAA 1BSWA 3KECA 4IUWA 3MA2A 5D1TA 2SRTA 3RTTA 4DPEA 2DDFA 1I1IP 4XBHA 4Q1LA 4WK7A 2CLTA 1EUBA 1PWUA 2K2GA 2OY4A 1GKCA 2E2DA 3AYUA 5D1SA 3DPEA 3LIKA 4I35A 1BZSA 2FV5A 2DW1A 1XFXA 3UVCA 2N8RA 5D7WA 4ILWD 4PKTA 1AKLA 1GE7A 1HY7A 3F16A 3KHIA 4AUOA 1CXVA 4H49A 2WO8A 1JAOA 4JP4A 4FU4A 4IN9A 1BKCA 1R1JA 1L6JA 3HBVP 2W15A 1K7IA 3HYGA 2USNA 1R55A 1BKCI 3U1RA 2DDYA 5CUHA 1XFVA 2MZEA 1ND1A 3EHYA 2V4BA 3B8ZA 3LK8A 1CIZA 2D1OA 966CA 3ZVSA 1OM7A 2W14A 2Y6CA 4WKEA 3P24A 2OXUA 1YOUA 1IAEA 1OM8A 1AYKA 2CKIA 1KUIA 1JJ9A 1YCMA 5D1UA 2JT5A 4PKQA 1JIZA 1UTTA 5BOTA 1KUKA 3LUNA 1G4KA 3KRYA 3B92A 1K7QA 4R3VA 1C7KA 4GWMA 4L63A 2O36A 4QKZA 3EDIA 1G12A 3GBOA 1R1HA 3CKIA 3LQ0A 830CA 4J4MA 4FVLA 4A7BA 2OW0A 4H84A 3EDHA 5B5PA 1EAKA 2O3EA 3O2XA 1G49A 1DTHA 1WNIA 4HMAA 1G05A 1A85A 2ERQA 5CXAA 3HB2P 2I47A 4AIGA 2RJPA 1UTZA 2TCLA 3K7NA 1PWWA 3P1VA 1I76A 2OVZA 1MMRA 1QJIA 1XFWA 1JANA 1OS9A 1HFCA 2POJA 2X3BA 1IAAA 1BKCE 2Z2DA 1C3IA 1IAGA 2MZHA 1CGEA 1PWPA 4PKSA 3N2UA 1ZTQA 1Q3AA 2JT6A 1R1IA 1USNA 1H71P 1FLSA 3LE9A 3LUMA 4CTHA 5L7FA 3K7LA 3HDAP 4H3XA 1JK3A 3DNGA 1RMZA 4DD8A 2WOAA 1ZS0A 2E3XA 1ATLA 3LGPA 4H2EA 1D5JA 3KEJA 1Y8JA 5I4OA 1CQRA 1QIAA 1MMBA 1CGLA 3USNA 2EROA 2OI0A 3KWVC 4GR3A 4GUYA 3HY9A 1A86A 5B5OA 4PKWA 5I43A 3AIGA 3LJGA 4JPAA 4FXYP 1G9KA 1XUCA 2Y6DA 2OXZA 1XURA 456CA 4DF9A 2AYKA 1J7NA 1HTDA 2OXWA 2OZRA 3VI1A 1BQOA 4GQLA 3L0TA 5I12A 1BM6A 4XM7A 2RJQA 3HY7A 1B8YA 5BPAA 4JA1A 3ZXHA
chains in the Genus database with same CATH superfamily
1XFZA 3Q2GA 1JH1A 1Y0VA 1D7XA 1QUAA 3DWBA 1FM1A 5D3CA 5I0LA 3L0VA 1YP1A 4JIJA 1K7GA 2DW2A 3TSKA 3DPFA 1UEAA 1MMQA 2OW2A 1I73A 1YQYA 1GO8P 1QJJA 1GXDA 3TS4A 1XFYA 1PWQA 1SATA 5D2BA 2A8HA 2YIGA 1CGFA 1XUDA 1C8TA 2XS4A 3F15A 4WF6A 1QICA 3DSLA 5CZMA 1XFUA 2MLRA 3E8RA 1IACA 2MLSA 2X3CA 4ZR5A 5I3MA 2W12A 2JSDA 4G9LA 1O0TA 1KUHA 3B2ZA 2OY2A 1RM8A 2JIHA 2OW1A 1SMPA 3HBUP 1JKYA 5H8XA 5LABA 1EB6A 4GWNA 1OM6A 2OVXA 3LIRA 1HOVA 1JAQA 1KUGA 1HFSA 3WV3A 2ERPA 4PKVA 4H30A 1IADA 1ZXCA 2MZIA 3I7IA 4GR0A 2X3AA 4XM8A 3V96B 3OHOA 1D8FA 3DL1A 1BQQM 1OZ9A 2DW0A 3KMEA 1OMJA 1GE6A 1GKDA 4EFSA 1QIBA 1ZVXA 1JIWP 1CK7A 4L6TA 1OO9A 1SLNA 2XS3A 1JAPA 3KMCA 2L0RA 3LILA 3WV1A 4DV8A 1ROSA 3LJZA 1ZXVA 3NX7A 1PWVA 3I7GA 1GE5A 4I03A 3EDGA 4AYKA 1UMSA 2JNPA 1MNCA 4XCTA 3G5CA 2W0DA 4GR8A 2PJTA 3F1AA 1CAQA 1S4BP 2X7MA 4IJOA 3AYKA 4H76A 1BUDA 1GO7P 2D1NA 1FBLA 1D8MA 3N2VA 2J83A 3EDZA 2QPJA 2K9CA 2W13A 3KEKA 4PKRA 4WKIA 2HU6A 3EWJA 3ELMA 3RTSA 3OHLA 4WZVA 5BOYA 1AF0A 1UMTA 4H1QA 2FV9A 3Q2HA 1R54A 1ASTA 3LEAA 4L19A 1DMTA 3O64A 3LQBA 1B3DA 4JQGA 1KUFA 2OW9A 4FXQA 1KBCA 3ZUKA 3G42A 4ON1A 1HV5A 2WO9A 3SHIA 3VTGA 4AXQA 1OS2A 1MMPA 1O0QA 3LMCA 3F18A 5I2ZA 1BIWA 1SRPA 1SLMA 2KRJA 2AIGP 4PKUA 4H82A 1IABA 2J0TA 1BUVM 1KAPP 3HDBA 4GF1A 4XM6A 4G0DA 5JMYA 3TVCA 4HX3A 1Z3JA 1SU3A 4A3WA 3BA0A 1Y93A 5L79A 1ZP5A 3EHXA 3TT4A 3F17A 3WV2A 2YB9A 3LJTA 3F19A 3LKAA 1BSWA 3KECA 4IUWA 3MA2A 5D1TA 2SRTA 3RTTA 4DPEA 2DDFA 1I1IP 4XBHA 4Q1LA 1XAXA 4WK7A 2CLTA 1EUBA 1PWUA 2K2GA 2OY4A 1GKCA 2E2DA 3AYUA 5D1SA 3DPEA 3LIKA 4I35A 1BZSA 2FV5A 2DW1A 1XFXA 3UVCA 2N8RA 5D7WA 4ILWD 4PKTA 1AKLA 1GE7A 1HY7A 3F16A 3KHIA 4AUOA 1CXVA 1TVIA 4H49A 4L7AA 2WO8A 1JAOA 4JP4A 4FU4A 4IN9A 1BKCA 1R1JA 1L6JA 3HBVP 2W15A 1K7IA 3HYGA 2USNA 1R55A 1BKCI 3U1RA 2DDYA 5CUHA 1XFVA 2MZEA 1ND1A 3EHYA 2V4BA 3B8ZA 3LK8A 1CIZA 2D1OA 966CA 3ZVSA 1OM7A 2W14A 2Y6CA 4WKEA 3P24A 2OXUA 1YOUA 1IAEA 1OM8A 1AYKA 2CKIA 1KUIA 1JJ9A 1YCMA 5D1UA 2JT5A 4PKQA 1JIZA 1UTTA 5BOTA 1KUKA 3LUNA 1G4KA 3KRYA 3B92A 1K7QA 4R3VA 1C7KA 4GWMA 4L63A 2O36A 4QKZA 3EDIA 1G12A 3GBOA 3DTIA 1R1HA 3CKIA 3LQ0A 830CA 4J4MA 4FVLA 4A7BA 2OW0A 4H84A 3EDHA 5B5PA 1EAKA 2O3EA 3O2XA 1G49A 1DTHA 1WNIA 4HMAA 1G05A 1A85A 2ERQA 5CXAA 3HB2P 2I47A 4AIGA 2RJPA 1UTZA 2TCLA 3K7NA 1PWWA 3P1VA 1I76A 2OVZA 1MMRA 1QJIA 1XFWA 1JANA 1OS9A 1HFCA 2POJA 2X3BA 1IAAA 1BKCE 2Z2DA 1C3IA 1IAGA 2MZHA 1CGEA 1PWPA 4PKSA 3N2UA 1ZTQA 1Q3AA 2JT6A 1R1IA 3DTEA 1USNA 1H71P 1FLSA 3LE9A 3LUMA 4CTHA 5L7FA 3K7LA 3HDAP 4H3XA 1JK3A 3DNGA 1RMZA 4DD8A 2WOAA 1ZS0A 2E3XA 1ATLA 3LGPA 4H2EA 1D5JA 1XM5A 3KEJA 1Y8JA 5I4OA 1CQRA 1QIAA 1MMBA 1CGLA 3USNA 2EROA 2OI0A 3KWVC 4GR3A 4GUYA 3HY9A 1A86A 5B5OA 4PKWA 5I43A 3AIGA 3LJGA 4JPAA 4FXYP 1G9KA 1XUCA 2Y6DA 2OXZA 1XURA 456CA 4DF9A 2AYKA 1J7NA 1HTDA 2OXWA 2OZRA 3VI1A 1BQOA 4GQLA 3L0TA 5I12A 1BM6A 4XM7A 2RJQA 3HY7A 1B8YA 2YUFA 5BPAA 3DTKA 4JA1A 3ZXHA
chains in the Genus database with same CATH topology
1XFZA 3Q2GA 1JH1A 1Y0VA 1D7XA 1QUAA 3DWBA 1FM1A 5D3CA 5I0LA 3L0VA 1YP1A 4JIJA 1K7GA 2DW2A 3TSKA 3DPFA 1UEAA 1MMQA 2OW2A 1I73A 1YQYA 1GO8P 1QJJA 1GXDA 3TS4A 1XFYA 1PWQA 1SATA 5D2BA 2A8HA 2YIGA 1CGFA 1XUDA 1C8TA 2XS4A 3F15A 4WF6A 1QICA 3DSLA 5CZMA 1XFUA 2MLRA 3E8RA 1IACA 2MLSA 2X3CA 4ZR5A 5I3MA 2W12A 2JSDA 4G9LA 1O0TA 1KUHA 3B2ZA 2OY2A 1RM8A 2JIHA 2OW1A 1SMPA 3HBUP 1JKYA 5H8XA 5LABA 1EB6A 4GWNA 1OM6A 2OVXA 3LIRA 1HOVA 1JAQA 1KUGA 1HFSA 3WV3A 2ERPA 4PKVA 4H30A 1IADA 1ZXCA 2MZIA 3I7IA 4GR0A 2X3AA 4XM8A 3V96B 3OHOA 1D8FA 3DL1A 1BQQM 2DW0A 3KMEA 1OMJA 1GE6A 1GKDA 4EFSA 1QIBA 1ZVXA 1JIWP 1CK7A 4L6TA 1OO9A 1SLNA 2XS3A 1JAPA 3KMCA 2L0RA 3LILA 3WV1A 4DV8A 1ROSA 3LJZA 1ZXVA 3NX7A 1PWVA 3I7GA 1GE5A 4I03A 3EDGA 4AYKA 1UMSA 2JNPA 1MNCA 4XCTA 3G5CA 2W0DA 4GR8A 2PJTA 3F1AA 1CAQA 1S4BP 2X7MA 4IJOA 3AYKA 4H76A 1BUDA 1GO7P 2D1NA 1FBLA 1D8MA 3N2VA 2J83A 3EDZA 2QPJA 2K9CA 2W13A 3KEKA 4PKRA 4WKIA 2HU6A 3EWJA 3ELMA 3RTSA 3OHLA 4WZVA 5BOYA 1AF0A 1UMTA 4H1QA 2FV9A 3Q2HA 1R54A 1ASTA 3LEAA 4L19A 1DMTA 3O64A 3LQBA 1B3DA 4JQGA 1KUFA 2OW9A 4FXQA 1KBCA 3ZUKA 3G42A 4ON1A 1HV5A 2WO9A 3SHIA 3VTGA 4AXQA 1OS2A 1MMPA 1O0QA 3LMCA 3F18A 5I2ZA 1BIWA 1SRPA 1SLMA 2KRJA 2AIGP 4PKUA 4H82A 1IABA 2J0TA 1BUVM 1KAPP 3HDBA 4GF1A 4XM6A 4G0DA 5JMYA 3TVCA 4HX3A 1Z3JA 1SU3A 4A3WA 3BA0A 1Y93A 5L79A 1ZP5A 3EHXA 3TT4A 3F17A 3WV2A 2YB9A 3LJTA 3F19A 3LKAA 1BSWA 3KECA 4IUWA 3MA2A 5D1TA 2SRTA 3RTTA 4DPEA 2DDFA 1I1IP 4XBHA 4Q1LA 4WK7A 2CLTA 1EUBA 1PWUA 2K2GA 2OY4A 1GKCA 2E2DA 3AYUA 5D1SA 3DPEA 3LIKA 4I35A 1BZSA 2FV5A 2DW1A 1XFXA 3UVCA 2N8RA 5D7WA 4ILWD 4PKTA 1AKLA 1GE7A 1HY7A 3F16A 3KHIA 4AUOA 1CXVA 4H49A 4L7AA 2WO8A 1JAOA 4JP4A 4FU4A 4IN9A 1BKCA 1R1JA 1L6JA 3HBVP 2W15A 1K7IA 3HYGA 2USNA 1R55A 1BKCI 3U1RA 2DDYA 5CUHA 1XFVA 2MZEA 1ND1A 3EHYA 2V4BA 3B8ZA 3LK8A 1CIZA 2D1OA 966CA 3ZVSA 1OM7A 2W14A 2Y6CA 4WKEA 3P24A 2OXUA 1YOUA 1IAEA 1OM8A 1AYKA 2CKIA 1KUIA 1JJ9A 1YCMA 5D1UA 2JT5A 4PKQA 1JIZA 1UTTA 5BOTA 1KUKA 3LUNA 1G4KA 3KRYA 3B92A 1K7QA 4R3VA 1C7KA 4GWMA 4L63A 2O36A 4QKZA 3EDIA 1G12A 3GBOA 3DTIA 1R1HA 3CKIA 3LQ0A 830CA 4J4MA 4FVLA 4A7BA 2OW0A 4H84A 3EDHA 5B5PA 1EAKA 2O3EA 3O2XA 1G49A 1DTHA 1WNIA 4HMAA 1G05A 1A85A 2ERQA 5CXAA 3HB2P 2I47A 4AIGA 2RJPA 1UTZA 2TCLA 3K7NA 1PWWA 3P1VA 1I76A 2OVZA 1MMRA 1QJIA 1XFWA 1JANA 1OS9A 1HFCA 2POJA 2X3BA 1IAAA 1BKCE 2Z2DA 1C3IA 1IAGA 2MZHA 1CGEA 1PWPA 4PKSA 3N2UA 1ZTQA 1Q3AA 2JT6A 1R1IA 3DTEA 1USNA 1H71P 1FLSA 3LE9A 3LUMA 4CTHA 5L7FA 3K7LA 3HDAP 4H3XA 1JK3A 3DNGA 1RMZA 4DD8A 2WOAA 1ZS0A 2E3XA 1ATLA 3LGPA 4H2EA 1D5JA 3KEJA 1Y8JA 5I4OA 1CQRA 1QIAA 1MMBA 1CGLA 3USNA 2EROA 2OI0A 3KWVC 4GR3A 4GUYA 3HY9A 1A86A 5B5OA 4PKWA 5I43A 3AIGA 3LJGA 4JPAA 4FXYP 1G9KA 1XUCA 2Y6DA 2OXZA 1XURA 456CA 4DF9A 2AYKA 1J7NA 1HTDA 2OXWA 2OZRA 3VI1A 1BQOA 4GQLA 3L0TA 5I12A 1BM6A 4XM7A 2RJQA 3HY7A 1B8YA 2YUFA 5BPAA 3DTKA 4JA1A 3ZXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFZ A;  3Q2G A;  1JH1 A;  1Y0V A;  1D7X A;  1QUA A;  3DWB A;  1FM1 A;  5D3C A;  5I0L A;  3L0V A;  1YP1 A;  4JIJ A;  1K7G A;  2DW2 A;  3TSK A;  3DPF A;  1UEA A;  1MMQ A;  2OW2 A;  1I73 A;  1YQY A;  1GO8 P;  1QJJ A;  1GXD A;  3TS4 A;  1XFY A;  1PWQ A;  1SAT A;  5D2B A;  2A8H A;  2YIG A;  1CGF A;  1XUD A;  1C8T A;  2XS4 A;  3F15 A;  4WF6 A;  1QIC A;  3DSL A;  5CZM A;  1XFU A;  2MLR A;  3E8R A;  1IAC A;  2MLS A;  2X3C A;  4ZR5 A;  5I3M A;  2W12 A;  2JSD A;  4G9L A;  1O0T A;  1KUH A;  3B2Z A;  2OY2 A;  1RM8 A;  2JIH A;  2OW1 A;  1SMP A;  3HBU P;  1JKY A;  5H8X A;  5LAB A;  1EB6 A;  4GWN A;  1OM6 A;  2OVX A;  3LIR A;  1HOV A;  1JAQ A;  1KUG A;  1HFS A;  3WV3 A;  2ERP A;  4PKV A;  4H30 A;  1IAD A;  1ZXC A;  2MZI A;  3I7I A;  4GR0 A;  2X3A A;  4XM8 A;  3V96 B;  3OHO A;  1D8F A;  3DL1 A;  1BQQ M;  2DW0 A;  3KME A;  1OMJ A;  1GE6 A;  1GKD A;  4EFS A;  1QIB A;  1ZVX A;  1JIW P;  1CK7 A;  4L6T A;  1OO9 A;  1SLN A;  2XS3 A;  1JAP A;  3KMC A;  2L0R A;  3LIL A;  3WV1 A;  4DV8 A;  1ROS A;  3LJZ A;  1ZXV A;  3NX7 A;  1PWV A;  3I7G A;  1GE5 A;  4I03 A;  3EDG A;  4AYK A;  1UMS A;  2JNP A;  1MNC A;  4XCT A;  3G5C A;  2W0D A;  4GR8 A;  2PJT A;  3F1A A;  1CAQ A;  1S4B P;  2X7M A;  4IJO A;  3AYK A;  4H76 A;  1BUD A;  1GO7 P;  2D1N A;  1FBL A;  1D8M A;  3N2V A;  2J83 A;  3EDZ A;  2QPJ A;  2K9C A;  2W13 A;  3KEK A;  4PKR A;  4WKI A;  2HU6 A;  3EWJ A;  3ELM A;  3RTS A;  3OHL A;  4WZV A;  5BOY A;  1AF0 A;  1UMT A;  4H1Q A;  2FV9 A;  3Q2H A;  1R54 A;  1AST A;  3LEA A;  4L19 A;  1DMT A;  3O64 A;  3LQB A;  1B3D A;  4JQG A;  1KUF A;  2OW9 A;  4FXQ A;  1KBC A;  3ZUK A;  3G42 A;  4ON1 A;  1HV5 A;  2WO9 A;  3SHI A;  3VTG A;  4AXQ A;  1OS2 A;  1MMP A;  1O0Q A;  3LMC A;  3F18 A;  5I2Z A;  1BIW A;  1SRP A;  1SLM A;  2KRJ A;  2AIG P;  4PKU A;  4H82 A;  1IAB A;  2J0T A;  1BUV M;  1KAP P;  3HDB A;  4GF1 A;  4XM6 A;  4G0D A;  5JMY A;  3TVC A;  4HX3 A;  1Z3J A;  1SU3 A;  4A3W A;  3BA0 A;  1Y93 A;  5L79 A;  1ZP5 A;  3EHX A;  3TT4 A;  3F17 A;  3WV2 A;  2YB9 A;  3LJT A;  3F19 A;  3LKA A;  1BSW A;  3KEC A;  4IUW A;  3MA2 A;  5D1T A;  2SRT A;  3RTT A;  4DPE A;  2DDF A;  1I1I P;  4XBH A;  4Q1L A;  4WK7 A;  2CLT A;  1EUB A;  1PWU A;  2K2G A;  2OY4 A;  1GKC A;  2E2D A;  3AYU A;  5D1S A;  3DPE A;  3LIK A;  4I35 A;  1BZS A;  2FV5 A;  2DW1 A;  1XFX A;  3UVC A;  2N8R A;  5D7W A;  4ILW D;  4PKT A;  1AKL A;  1GE7 A;  1HY7 A;  3F16 A;  3KHI A;  4AUO A;  1CXV A;  4H49 A;  2WO8 A;  1JAO A;  4JP4 A;  4FU4 A;  4IN9 A;  1BKC A;  1R1J A;  1L6J A;  3HBV P;  2W15 A;  1K7I A;  3HYG A;  2USN A;  1R55 A;  1BKC I;  3U1R A;  2DDY A;  5CUH A;  1XFV A;  2MZE A;  1ND1 A;  3EHY A;  2V4B A;  3B8Z A;  3LK8 A;  1CIZ A;  2D1O A;  966C A;  3ZVS A;  1OM7 A;  2W14 A;  2Y6C A;  4WKE A;  3P24 A;  2OXU A;  1YOU A;  1IAE A;  1OM8 A;  1AYK A;  2CKI A;  1KUI A;  1JJ9 A;  1YCM A;  5D1U A;  2JT5 A;  4PKQ A;  1JIZ A;  1UTT A;  5BOT A;  1KUK A;  3LUN A;  1G4K A;  3KRY A;  3B92 A;  1K7Q A;  4R3V A;  1C7K A;  4GWM A;  4L63 A;  2O36 A;  4QKZ A;  3EDI A;  1G12 A;  3GBO A;  1R1H A;  3CKI A;  3LQ0 A;  830C A;  4J4M A;  4FVL A;  4A7B A;  2OW0 A;  4H84 A;  3EDH A;  5B5P A;  1EAK A;  2O3E A;  3O2X A;  1G49 A;  1DTH A;  1WNI A;  4HMA A;  1G05 A;  1A85 A;  2ERQ A;  5CXA A;  3HB2 P;  2I47 A;  4AIG A;  2RJP A;  1UTZ A;  2TCL A;  3K7N A;  1PWW A;  3P1V A;  1I76 A;  2OVZ A;  1MMR A;  1QJI A;  1XFW A;  1JAN A;  1OS9 A;  1HFC A;  2POJ A;  2X3B A;  1IAA A;  1BKC E;  2Z2D A;  1C3I A;  1IAG A;  2MZH A;  1CGE A;  1PWP A;  4PKS A;  3N2U A;  1ZTQ A;  1Q3A A;  2JT6 A;  1R1I A;  1USN A;  1H71 P;  1FLS A;  3LE9 A;  3LUM A;  4CTH A;  5L7F A;  3K7L A;  3HDA P;  4H3X A;  1JK3 A;  3DNG A;  1RMZ A;  4DD8 A;  2WOA A;  1ZS0 A;  2E3X A;  1ATL A;  3LGP A;  4H2E A;  1D5J A;  3KEJ A;  1Y8J A;  5I4O A;  1CQR A;  1QIA A;  1MMB A;  1CGL A;  3USN A;  2ERO A;  2OI0 A;  3KWV C;  4GR3 A;  4GUY A;  3HY9 A;  1A86 A;  5B5O A;  4PKW A;  5I43 A;  3AIG A;  3LJG A;  4JPA A;  4FXY P;  1G9K A;  1XUC A;  2Y6D A;  2OXZ A;  1XUR A;  456C A;  4DF9 A;  2AYK A;  1J7N A;  1HTD A;  2OXW A;  2OZR A;  3VI1 A;  1BQO A;  4GQL A;  3L0T A;  5I12 A;  1BM6 A;  4XM7 A;  2RJQ A;  3HY7 A;  1B8Y A;  5BPA A;  4JA1 A;  3ZXH A; 
#chains in the Genus database with same CATH topology
 1XFZ A;  3Q2G A;  1JH1 A;  1Y0V A;  1D7X A;  1QUA A;  3DWB A;  1FM1 A;  5D3C A;  5I0L A;  3L0V A;  1YP1 A;  4JIJ A;  1K7G A;  2DW2 A;  3TSK A;  3DPF A;  1UEA A;  1MMQ A;  2OW2 A;  1I73 A;  1YQY A;  1GO8 P;  1QJJ A;  1GXD A;  3TS4 A;  1XFY A;  1PWQ A;  1SAT A;  5D2B A;  2A8H A;  2YIG A;  1CGF A;  1XUD A;  1C8T A;  2XS4 A;  3F15 A;  4WF6 A;  1QIC A;  3DSL A;  5CZM A;  1XFU A;  2MLR A;  3E8R A;  1IAC A;  2MLS A;  2X3C A;  4ZR5 A;  5I3M A;  2W12 A;  2JSD A;  4G9L A;  1O0T A;  1KUH A;  3B2Z A;  2OY2 A;  1RM8 A;  2JIH A;  2OW1 A;  1SMP A;  3HBU P;  1JKY A;  5H8X A;  5LAB A;  1EB6 A;  4GWN A;  1OM6 A;  2OVX A;  3LIR A;  1HOV A;  1JAQ A;  1KUG A;  1HFS A;  3WV3 A;  2ERP A;  4PKV A;  4H30 A;  1IAD A;  1ZXC A;  2MZI A;  3I7I A;  4GR0 A;  2X3A A;  4XM8 A;  3V96 B;  3OHO A;  1D8F A;  3DL1 A;  1BQQ M;  1OZ9 A;  2DW0 A;  3KME A;  1OMJ A;  1GE6 A;  1GKD A;  4EFS A;  1QIB A;  1ZVX A;  1JIW P;  1CK7 A;  4L6T A;  1OO9 A;  1SLN A;  2XS3 A;  1JAP A;  3KMC A;  2L0R A;  3LIL A;  3WV1 A;  4DV8 A;  1ROS A;  3LJZ A;  1ZXV A;  3NX7 A;  1PWV A;  3I7G A;  1GE5 A;  4I03 A;  3EDG A;  4AYK A;  1UMS A;  2JNP A;  1MNC A;  4XCT A;  3G5C A;  2W0D A;  4GR8 A;  2PJT A;  3F1A A;  1CAQ A;  1S4B P;  2X7M A;  4IJO A;  3AYK A;  4H76 A;  1BUD A;  1GO7 P;  2D1N A;  1FBL A;  1D8M A;  3N2V A;  2J83 A;  3EDZ A;  2QPJ A;  2K9C A;  2W13 A;  3KEK A;  4PKR A;  4WKI A;  2HU6 A;  3EWJ A;  3ELM A;  3RTS A;  3OHL A;  4WZV A;  5BOY A;  1AF0 A;  1UMT A;  4H1Q A;  2FV9 A;  3Q2H A;  1R54 A;  1AST A;  3LEA A;  4L19 A;  1DMT A;  3O64 A;  3LQB A;  1B3D A;  4JQG A;  1KUF A;  2OW9 A;  4FXQ A;  1KBC A;  3ZUK A;  3G42 A;  4ON1 A;  1HV5 A;  2WO9 A;  3SHI A;  3VTG A;  4AXQ A;  1OS2 A;  1MMP A;  1O0Q A;  3LMC A;  3F18 A;  5I2Z A;  1BIW A;  1SRP A;  1SLM A;  2KRJ A;  2AIG P;  4PKU A;  4H82 A;  1IAB A;  2J0T A;  1BUV M;  1KAP P;  3HDB A;  4GF1 A;  4XM6 A;  4G0D A;  5JMY A;  3TVC A;  4HX3 A;  1Z3J A;  1SU3 A;  4A3W A;  3BA0 A;  1Y93 A;  5L79 A;  1ZP5 A;  3EHX A;  3TT4 A;  3F17 A;  3WV2 A;  2YB9 A;  3LJT A;  3F19 A;  3LKA A;  1BSW A;  3KEC A;  4IUW A;  3MA2 A;  5D1T A;  2SRT A;  3RTT A;  4DPE A;  2DDF A;  1I1I P;  4XBH A;  4Q1L A;  1XAX A;  4WK7 A;  2CLT A;  1EUB A;  1PWU A;  2K2G A;  2OY4 A;  1GKC A;  2E2D A;  3AYU A;  5D1S A;  3DPE A;  3LIK A;  4I35 A;  1BZS A;  2FV5 A;  2DW1 A;  1XFX A;  3UVC A;  2N8R A;  5D7W A;  4ILW D;  4PKT A;  1AKL A;  1GE7 A;  1HY7 A;  3F16 A;  3KHI A;  4AUO A;  1CXV A;  1TVI A;  4H49 A;  4L7A A;  2WO8 A;  1JAO A;  4JP4 A;  4FU4 A;  4IN9 A;  1BKC A;  1R1J A;  1L6J A;  3HBV P;  2W15 A;  1K7I A;  3HYG A;  2USN A;  1R55 A;  1BKC I;  3U1R A;  2DDY A;  5CUH A;  1XFV A;  2MZE A;  1ND1 A;  3EHY A;  2V4B A;  3B8Z A;  3LK8 A;  1CIZ A;  2D1O A;  966C A;  3ZVS A;  1OM7 A;  2W14 A;  2Y6C A;  4WKE A;  3P24 A;  2OXU A;  1YOU A;  1IAE A;  1OM8 A;  1AYK A;  2CKI A;  1KUI A;  1JJ9 A;  1YCM A;  5D1U A;  2JT5 A;  4PKQ A;  1JIZ A;  1UTT A;  5BOT A;  1KUK A;  3LUN A;  1G4K A;  3KRY A;  3B92 A;  1K7Q A;  4R3V A;  1C7K A;  4GWM A;  4L63 A;  2O36 A;  4QKZ A;  3EDI A;  1G12 A;  3GBO A;  3DTI A;  1R1H A;  3CKI A;  3LQ0 A;  830C A;  4J4M A;  4FVL A;  4A7B A;  2OW0 A;  4H84 A;  3EDH A;  5B5P A;  1EAK A;  2O3E A;  3O2X A;  1G49 A;  1DTH A;  1WNI A;  4HMA A;  1G05 A;  1A85 A;  2ERQ A;  5CXA A;  3HB2 P;  2I47 A;  4AIG A;  2RJP A;  1UTZ A;  2TCL A;  3K7N A;  1PWW A;  3P1V A;  1I76 A;  2OVZ A;  1MMR A;  1QJI A;  1XFW A;  1JAN A;  1OS9 A;  1HFC A;  2POJ A;  2X3B A;  1IAA A;  1BKC E;  2Z2D A;  1C3I A;  1IAG A;  2MZH A;  1CGE A;  1PWP A;  4PKS A;  3N2U A;  1ZTQ A;  1Q3A A;  2JT6 A;  1R1I A;  3DTE A;  1USN A;  1H71 P;  1FLS A;  3LE9 A;  3LUM A;  4CTH A;  5L7F A;  3K7L A;  3HDA P;  4H3X A;  1JK3 A;  3DNG A;  1RMZ A;  4DD8 A;  2WOA A;  1ZS0 A;  2E3X A;  1ATL A;  3LGP A;  4H2E A;  1D5J A;  1XM5 A;  3KEJ A;  1Y8J A;  5I4O A;  1CQR A;  1QIA A;  1MMB A;  1CGL A;  3USN A;  2ERO A;  2OI0 A;  3KWV C;  4GR3 A;  4GUY A;  3HY9 A;  1A86 A;  5B5O A;  4PKW A;  5I43 A;  3AIG A;  3LJG A;  4JPA A;  4FXY P;  1G9K A;  1XUC A;  2Y6D A;  2OXZ A;  1XUR A;  456C A;  4DF9 A;  2AYK A;  1J7N A;  1HTD A;  2OXW A;  2OZR A;  3VI1 A;  1BQO A;  4GQL A;  3L0T A;  5I12 A;  1BM6 A;  4XM7 A;  2RJQ A;  3HY7 A;  1B8Y A;  2YUF A;  5BPA A;  3DTK A;  4JA1 A;  3ZXH A; 
#chains in the Genus database with same CATH homology
 1XFZ A;  3Q2G A;  1JH1 A;  1Y0V A;  1D7X A;  1QUA A;  3DWB A;  1FM1 A;  5D3C A;  5I0L A;  3L0V A;  1YP1 A;  4JIJ A;  1K7G A;  2DW2 A;  3TSK A;  3DPF A;  1UEA A;  1MMQ A;  2OW2 A;  1I73 A;  1YQY A;  1GO8 P;  1QJJ A;  1GXD A;  3TS4 A;  1XFY A;  1PWQ A;  1SAT A;  5D2B A;  2A8H A;  2YIG A;  1CGF A;  1XUD A;  1C8T A;  2XS4 A;  3F15 A;  4WF6 A;  1QIC A;  3DSL A;  5CZM A;  1XFU A;  2MLR A;  3E8R A;  1IAC A;  2MLS A;  2X3C A;  4ZR5 A;  5I3M A;  2W12 A;  2JSD A;  4G9L A;  1O0T A;  1KUH A;  3B2Z A;  2OY2 A;  1RM8 A;  2JIH A;  2OW1 A;  1SMP A;  3HBU P;  1JKY A;  5H8X A;  5LAB A;  1EB6 A;  4GWN A;  1OM6 A;  2OVX A;  3LIR A;  1HOV A;  1JAQ A;  1KUG A;  1HFS A;  3WV3 A;  2ERP A;  4PKV A;  4H30 A;  1IAD A;  1ZXC A;  2MZI A;  3I7I A;  4GR0 A;  2X3A A;  4XM8 A;  3V96 B;  3OHO A;  1D8F A;  3DL1 A;  1BQQ M;  2DW0 A;  3KME A;  1OMJ A;  1GE6 A;  1GKD A;  4EFS A;  1QIB A;  1ZVX A;  1JIW P;  1CK7 A;  4L6T A;  1OO9 A;  1SLN A;  2XS3 A;  1JAP A;  3KMC A;  2L0R A;  3LIL A;  3WV1 A;  4DV8 A;  1ROS A;  3LJZ A;  1ZXV A;  3NX7 A;  1PWV A;  3I7G A;  1GE5 A;  4I03 A;  3EDG A;  4AYK A;  1UMS A;  2JNP A;  1MNC A;  4XCT A;  3G5C A;  2W0D A;  4GR8 A;  2PJT A;  3F1A A;  1CAQ A;  1S4B P;  2X7M A;  4IJO A;  3AYK A;  4H76 A;  1BUD A;  1GO7 P;  2D1N A;  1FBL A;  1D8M A;  3N2V A;  2J83 A;  3EDZ A;  2QPJ A;  2K9C A;  2W13 A;  3KEK A;  4PKR A;  4WKI A;  2HU6 A;  3EWJ A;  3ELM A;  3RTS A;  3OHL A;  4WZV A;  5BOY A;  1AF0 A;  1UMT A;  4H1Q A;  2FV9 A;  3Q2H A;  1R54 A;  1AST A;  3LEA A;  4L19 A;  1DMT A;  3O64 A;  3LQB A;  1B3D A;  4JQG A;  1KUF A;  2OW9 A;  4FXQ A;  1KBC A;  3ZUK A;  3G42 A;  4ON1 A;  1HV5 A;  2WO9 A;  3SHI A;  3VTG A;  4AXQ A;  1OS2 A;  1MMP A;  1O0Q A;  3LMC A;  3F18 A;  5I2Z A;  1BIW A;  1SRP A;  1SLM A;  2KRJ A;  2AIG P;  4PKU A;  4H82 A;  1IAB A;  2J0T A;  1BUV M;  1KAP P;  3HDB A;  4GF1 A;  4XM6 A;  4G0D A;  5JMY A;  3TVC A;  4HX3 A;  1Z3J A;  1SU3 A;  4A3W A;  3BA0 A;  1Y93 A;  5L79 A;  1ZP5 A;  3EHX A;  3TT4 A;  3F17 A;  3WV2 A;  2YB9 A;  3LJT A;  3F19 A;  3LKA A;  1BSW A;  3KEC A;  4IUW A;  3MA2 A;  5D1T A;  2SRT A;  3RTT A;  4DPE A;  2DDF A;  1I1I P;  4XBH A;  4Q1L A;  4WK7 A;  2CLT A;  1EUB A;  1PWU A;  2K2G A;  2OY4 A;  1GKC A;  2E2D A;  3AYU A;  5D1S A;  3DPE A;  3LIK A;  4I35 A;  1BZS A;  2FV5 A;  2DW1 A;  1XFX A;  3UVC A;  2N8R A;  5D7W A;  4ILW D;  4PKT A;  1AKL A;  1GE7 A;  1HY7 A;  3F16 A;  3KHI A;  4AUO A;  1CXV A;  4H49 A;  4L7A A;  2WO8 A;  1JAO A;  4JP4 A;  4FU4 A;  4IN9 A;  1BKC A;  1R1J A;  1L6J A;  3HBV P;  2W15 A;  1K7I A;  3HYG A;  2USN A;  1R55 A;  1BKC I;  3U1R A;  2DDY A;  5CUH A;  1XFV A;  2MZE A;  1ND1 A;  3EHY A;  2V4B A;  3B8Z A;  3LK8 A;  1CIZ A;  2D1O A;  966C A;  3ZVS A;  1OM7 A;  2W14 A;  2Y6C A;  4WKE A;  3P24 A;  2OXU A;  1YOU A;  1IAE A;  1OM8 A;  1AYK A;  2CKI A;  1KUI A;  1JJ9 A;  1YCM A;  5D1U A;  2JT5 A;  4PKQ A;  1JIZ A;  1UTT A;  5BOT A;  1KUK A;  3LUN A;  1G4K A;  3KRY A;  3B92 A;  1K7Q A;  4R3V A;  1C7K A;  4GWM A;  4L63 A;  2O36 A;  4QKZ A;  3EDI A;  1G12 A;  3GBO A;  3DTI A;  1R1H A;  3CKI A;  3LQ0 A;  830C A;  4J4M A;  4FVL A;  4A7B A;  2OW0 A;  4H84 A;  3EDH A;  5B5P A;  1EAK A;  2O3E A;  3O2X A;  1G49 A;  1DTH A;  1WNI A;  4HMA A;  1G05 A;  1A85 A;  2ERQ A;  5CXA A;  3HB2 P;  2I47 A;  4AIG A;  2RJP A;  1UTZ A;  2TCL A;  3K7N A;  1PWW A;  3P1V A;  1I76 A;  2OVZ A;  1MMR A;  1QJI A;  1XFW A;  1JAN A;  1OS9 A;  1HFC A;  2POJ A;  2X3B A;  1IAA A;  1BKC E;  2Z2D A;  1C3I A;  1IAG A;  2MZH A;  1CGE A;  1PWP A;  4PKS A;  3N2U A;  1ZTQ A;  1Q3A A;  2JT6 A;  1R1I A;  3DTE A;  1USN A;  1H71 P;  1FLS A;  3LE9 A;  3LUM A;  4CTH A;  5L7F A;  3K7L A;  3HDA P;  4H3X A;  1JK3 A;  3DNG A;  1RMZ A;  4DD8 A;  2WOA A;  1ZS0 A;  2E3X A;  1ATL A;  3LGP A;  4H2E A;  1D5J A;  3KEJ A;  1Y8J A;  5I4O A;  1CQR A;  1QIA A;  1MMB A;  1CGL A;  3USN A;  2ERO A;  2OI0 A;  3KWV C;  4GR3 A;  4GUY A;  3HY9 A;  1A86 A;  5B5O A;  4PKW A;  5I43 A;  3AIG A;  3LJG A;  4JPA A;  4FXY P;  1G9K A;  1XUC A;  2Y6D A;  2OXZ A;  1XUR A;  456C A;  4DF9 A;  2AYK A;  1J7N A;  1HTD A;  2OXW A;  2OZR A;  3VI1 A;  1BQO A;  4GQL A;  3L0T A;  5I12 A;  1BM6 A;  4XM7 A;  2RJQ A;  3HY7 A;  1B8Y A;  2YUF A;  5BPA A;  3DTK A;  4JA1 A;  3ZXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...