1B8YA

X-ray structure of human stromelysin catalytic domain complexed with non-peptide inhibitors: implications for inhibitor selectivity
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
167
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (STROMELYSIN-1)
publication title X-ray structure of human stromelysin catalytic domain complexed with nonpeptide inhibitors: implications for inhibitor selectivity.
pubmed rcsb
source organism Homo sapiens
total genus 50
structure length 167
sequence length 167
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1999-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1b8yA00
1CAQA 3LK8A 3LJZA 1SMPA 3U1RA 2OY2A 1D8FA 1ZP5A 4JIJA 1HV5A 3LEAA 2D1OA 2N8RA 2OW1A 4FVLA 2W13A 1XFXA 1I76A 4AIGA 3LJGA 3TT4A 2XS3A 3LKAA 3UVCA 3WV3A 3EHYA 3TS4A 5I2ZA 1FM1A 1UTZA 2RJQA 2RJPA 3GBOA 2QPJA 1FBLA 2X7MA 1ZVXA 3KHIA 3F18A 4G9LA 1G05A 2O36A 2MZHA 1BM6A 2DDYA 2OXWA 4CTHA 1QJIA 3HBVP 1ZXVA 2J0TA 1MMPA 1EUBA 1HTDA 1ND1A 4AYKA 3DPFA 1BIWA 1QICA 1XFYA 1XUDA 2DW0A 3LIRA 1IAGA 3LGPA 4XM7A 2USNA 3LILA 1GXDA 1MMRA 4ON1A 1K7IA 3N2VA 4IN9A 1MMBA 966CA 1JH1A 1J7NA 4GR0A 3USNA 1XUCA 1PWVA 4GQLA 830CA 5H8XA 1UEAA 4H49A 1JKYA 5B5PA 1BZSA 2OW0A 4DD8A 4H76A 3VTGA 3WV2A 1IACA 1IABA 4HMAA 2OY4A 3F16A 1CGLA 5CUHA 1KUKA 1R1IA 1KUGA 1Y0VA 3MA2A 1OS2A 3I7IA 1UMTA 456CA 2DW1A 1Y8JA 4JQGA 2V4BA 1KAPP 1XFWA 4I35A 2JIHA 2OW2A 3HDAP 1Q3AA 1BSWA 4ZR5A 1G12A 2PJTA 3B8ZA 1BKCA 1IADA 1L6JA 1H71P 1KUHA 3L0VA 3HY9A 1BKCE 3BA0A 3TSKA 1AYKA 1JJ9A 3L0TA 4GUYA 2OW9A 4WF6A 5BOYA 1OM8A 2JT5A 3KMEA 3OHLA 3K7NA 4IJOA 1BQQM 4JPAA 2W0DA 1QJJA 4EFSA 3ZVSA 2A8HA 2AYKA 1XFVA 2CLTA 1ZTQA 1Y93A 4XM8A 1Z3JA 3EDHA 1OMJA 1BKCI 2WO9A 1GE5A 3KMCA 1CGEA 3TVCA 1JANA 2W15A 4GF1A 1CK7A 1JIWP 1SU3A 5I4OA 1R1JA 1GE6A 2JT6A 4L6TA 4PKVA 3V96B 2I47A 3EDZA 3NX7A 3DSLA 3LQBA 3G42A 4XBHA 4H82A 3SHIA 4DPEA 2HU6A 2SRTA 3I7GA 3F19A 4WKEA 1MNCA 2O3EA 1G9KA 1MMQA 4H30A 5I3MA 1IAAA 3K7LA 3HBUP 1FLSA 3KRYA 3RTTA 1HOVA 1C3IA 4J4MA 5I12A 5L79A 2MLRA 4H3XA 4JA1A 2FV9A 1CXVA 1SATA 2OZRA 1B3DA 1A86A 3VI1A 1GO8P 3RTSA 3P1VA 4ILWD 2X3AA 1GE7A 1CGFA 4GR8A 1K7GA 2ERQA 2YB9A 2L0RA 5D1SA 4QKZA 3P24A 4A3WA 2DW2A 1D8MA 1AKLA 1G49A 1ZS0A 4WK7A 1EB6A 3DL1A 3EDIA 3EHXA 3LJTA 3OHOA 5D1UA 2Y6CA 2OXZA 3LMCA 1SRPA 4PKRA 4FU4A 2W14A 1SLNA 2E3XA 2KRJA 4DF9A 3F1AA 1DMTA 3HDBA 2K9CA 1ATLA 5L7FA 1BUDA 4IUWA 2FV5A 3AYKA 4PKSA 3KWVC 1JIZA 1C8TA 1C7KA 1XFUA 1GKDA 2OVZA 3Q2HA 5LABA 4FXYP 4HX3A 2W12A 3HYGA 3KEKA 3LUMA 1HFSA 1WNIA 3KEJA 3B92A 3WV1A 4H2EA 1R54A 4GWMA 2E2DA 1D7XA 4L19A 1R55A 1B8YA 3AYUA 5D3CA 3F17A 1UTTA 4FXQA 1PWPA 3EWJA 2D1NA 1YP1A 4XM6A 4AXQA 1HY7A 2Y6DA 1JAQA 3DNGA 3ZXHA 3B2ZA 3EDGA 1QIAA 3CKIA 2J83A 4I03A 2X3BA 1YOUA 1O0QA 4H84A 4WKIA 4PKWA 2Z2DA 1I1IP 2X3CA 3LIKA 3O64A 1OM6A 3AIGA 1XURA 2WO8A 1BQOA 2ERPA 1HFCA 3DWBA 3LQ0A 4XCTA 2EROA 1RM8A 2OVXA 4GR3A 5D7WA 1RMZA 1EAKA 1KBCA 1AF0A 5D1TA 3N2UA 3G5CA 5CZMA 2MZIA 3E8RA 4H1QA 4G0DA 1DTHA 1O0TA 3DPEA 5CXAA 2YIGA 3ELMA 1KUIA 3LUNA 5JMYA 1USNA 1PWUA 1JK3A 4PKQA 2AIGP 1I73A 3F15A 1YQYA 1CQRA 1CIZA 1JAPA 3O2XA 5B5OA 1OM7A 1UMSA 1JAOA 1OS9A 4AUOA 4GWNA 4JP4A 2JNPA 1KUFA 5I0LA 4WZVA 2DDFA 3LE9A 3HB2P 2POJA 1A85A 4R3VA 1BUVM 2K2GA 1QIBA 3HY7A 4DV8A 4L63A 2JSDA 1S4BP 1K7QA 4PKUA 3KECA 3ZUKA 2OXUA 1YCMA 1G4KA 1SLMA 1ROSA 1ZXCA 1PWQA 1IAEA 1XFZA 2WOAA 2CKIA 5I43A 5BPAA 2TCLA 1GKCA 1GO7P 3Q2GA 4A7BA 1QUAA 1D5JA 1OO9A 4Q1LA 1R1HA 5BOTA 2XS4A 5D2BA 4PKTA 1PWWA 2MLSA 1ASTA 2MZEA 2OI0A
chains in the Genus database with same CATH superfamily
1CAQA 3LK8A 3LJZA 1SMPA 3U1RA 2OY2A 1D8FA 1ZP5A 4JIJA 1HV5A 3LEAA 2D1OA 2N8RA 2OW1A 4FVLA 2W13A 1XFXA 1I76A 4AIGA 3LJGA 3TT4A 2XS3A 3LKAA 3UVCA 3WV3A 3EHYA 3TS4A 5I2ZA 1FM1A 1UTZA 2RJQA 2RJPA 3GBOA 2QPJA 1FBLA 2X7MA 1ZVXA 3KHIA 3F18A 4G9LA 1G05A 2O36A 2MZHA 1BM6A 2DDYA 2OXWA 4CTHA 1QJIA 3HBVP 1ZXVA 2J0TA 1MMPA 1EUBA 1HTDA 1ND1A 4AYKA 3DPFA 1BIWA 1QICA 1XFYA 1XUDA 2DW0A 3LIRA 1IAGA 3LGPA 4XM7A 2USNA 3LILA 1GXDA 1MMRA 3DTEA 4ON1A 1K7IA 3N2VA 4IN9A 1MMBA 966CA 1JH1A 1J7NA 4GR0A 3USNA 1XUCA 1PWVA 4GQLA 830CA 5H8XA 1UEAA 4H49A 1JKYA 5B5PA 1BZSA 2OW0A 4DD8A 4H76A 3VTGA 3WV2A 1IACA 1IABA 4HMAA 2OY4A 3F16A 1CGLA 5CUHA 1KUKA 1R1IA 1KUGA 1Y0VA 3MA2A 1OS2A 3I7IA 1UMTA 456CA 2DW1A 1Y8JA 4JQGA 2V4BA 1KAPP 1XFWA 4I35A 2JIHA 2OW2A 3HDAP 1Q3AA 3DTKA 1BSWA 4ZR5A 1G12A 2PJTA 3B8ZA 1BKCA 1IADA 1L6JA 1H71P 1KUHA 3L0VA 3HY9A 1BKCE 3BA0A 3TSKA 1AYKA 1JJ9A 3L0TA 4GUYA 2OW9A 4WF6A 5BOYA 1OM8A 2JT5A 3KMEA 3OHLA 3K7NA 4IJOA 1BQQM 4JPAA 2W0DA 1QJJA 3DTIA 4EFSA 3ZVSA 2A8HA 2AYKA 1XFVA 2CLTA 1ZTQA 1Y93A 4XM8A 1Z3JA 3EDHA 1OMJA 1BKCI 2WO9A 1GE5A 3KMCA 1CGEA 3TVCA 1JANA 2W15A 4GF1A 1CK7A 1JIWP 1SU3A 5I4OA 1R1JA 1GE6A 2JT6A 4L6TA 4PKVA 3V96B 2I47A 3EDZA 3NX7A 3DSLA 3LQBA 3G42A 4XBHA 4H82A 3SHIA 4DPEA 2HU6A 2SRTA 3I7GA 3F19A 4WKEA 1MNCA 2O3EA 1OZ9A 1G9KA 1MMQA 4H30A 5I3MA 1IAAA 3K7LA 3HBUP 1FLSA 3KRYA 3RTTA 1HOVA 1C3IA 4J4MA 5I12A 5L79A 2MLRA 4H3XA 4JA1A 2FV9A 1CXVA 1SATA 2OZRA 1B3DA 1A86A 3VI1A 1GO8P 3RTSA 3P1VA 4ILWD 2X3AA 1GE7A 1CGFA 4GR8A 1K7GA 2ERQA 2YB9A 2L0RA 5D1SA 4QKZA 3P24A 4A3WA 2DW2A 1D8MA 1AKLA 1G49A 1ZS0A 4WK7A 1EB6A 3DL1A 3EDIA 3EHXA 3LJTA 3OHOA 5D1UA 2Y6CA 2OXZA 3LMCA 1SRPA 4PKRA 4FU4A 2W14A 1SLNA 2E3XA 2KRJA 4DF9A 3F1AA 1DMTA 3HDBA 2K9CA 1ATLA 5L7FA 1BUDA 4IUWA 2FV5A 3AYKA 4PKSA 3KWVC 1JIZA 1C8TA 1C7KA 1XFUA 1GKDA 2OVZA 3Q2HA 5LABA 4FXYP 4HX3A 2W12A 3HYGA 3KEKA 3LUMA 1HFSA 1WNIA 3KEJA 3B92A 3WV1A 4H2EA 1R54A 4GWMA 2YUFA 2E2DA 1D7XA 4L19A 1R55A 1B8YA 3AYUA 5D3CA 3F17A 1UTTA 4FXQA 1PWPA 3EWJA 2D1NA 1YP1A 4XM6A 4AXQA 1HY7A 2Y6DA 1JAQA 3DNGA 3ZXHA 3B2ZA 3EDGA 1QIAA 3CKIA 2J83A 4I03A 2X3BA 1YOUA 1O0QA 4H84A 4WKIA 4PKWA 2Z2DA 1I1IP 2X3CA 3LIKA 3O64A 1OM6A 3AIGA 1XURA 2WO8A 1BQOA 2ERPA 1HFCA 3DWBA 3LQ0A 4XCTA 2EROA 1RM8A 2OVXA 4GR3A 5D7WA 4L7AA 1RMZA 1EAKA 1KBCA 1AF0A 5D1TA 3N2UA 3G5CA 5CZMA 1TVIA 2MZIA 3E8RA 4H1QA 4G0DA 1DTHA 1O0TA 3DPEA 5CXAA 2YIGA 3ELMA 1KUIA 3LUNA 5JMYA 1USNA 1PWUA 1JK3A 4PKQA 2AIGP 1I73A 3F15A 1YQYA 1CQRA 1CIZA 1JAPA 3O2XA 5B5OA 1OM7A 1UMSA 1JAOA 1OS9A 4AUOA 4GWNA 4JP4A 2JNPA 1KUFA 5I0LA 4WZVA 2DDFA 3LE9A 3HB2P 2POJA 1A85A 4R3VA 1BUVM 2K2GA 1QIBA 3HY7A 4DV8A 4L63A 2JSDA 1S4BP 1K7QA 4PKUA 3KECA 3ZUKA 2OXUA 1YCMA 1XM5A 1G4KA 1SLMA 1ROSA 1ZXCA 1PWQA 1IAEA 1XFZA 2WOAA 2CKIA 5I43A 5BPAA 2TCLA 1GKCA 1GO7P 1XAXA 3Q2GA 4A7BA 1QUAA 1D5JA 1OO9A 4Q1LA 1R1HA 5BOTA 2XS4A 5D2BA 4PKTA 1PWWA 2MLSA 1ASTA 2MZEA 2OI0A
chains in the Genus database with same CATH topology
1CAQA 3LK8A 3LJZA 1SMPA 3U1RA 2OY2A 1D8FA 1ZP5A 4JIJA 1HV5A 3LEAA 2D1OA 2N8RA 2OW1A 4FVLA 2W13A 1XFXA 1I76A 4AIGA 3LJGA 3TT4A 2XS3A 3LKAA 3UVCA 3WV3A 3EHYA 3TS4A 5I2ZA 1FM1A 1UTZA 2RJQA 2RJPA 3GBOA 2QPJA 1FBLA 2X7MA 1ZVXA 3KHIA 3F18A 4G9LA 1G05A 2O36A 2MZHA 1BM6A 2DDYA 2OXWA 4CTHA 1QJIA 3HBVP 1ZXVA 2J0TA 1MMPA 1EUBA 1HTDA 1ND1A 4AYKA 3DPFA 1BIWA 1QICA 1XFYA 1XUDA 2DW0A 3LIRA 1IAGA 3LGPA 4XM7A 2USNA 3LILA 1GXDA 1MMRA 3DTEA 4ON1A 1K7IA 3N2VA 4IN9A 1MMBA 966CA 1JH1A 1J7NA 4GR0A 3USNA 1XUCA 1PWVA 4GQLA 830CA 5H8XA 1UEAA 4H49A 1JKYA 5B5PA 1BZSA 2OW0A 4DD8A 4H76A 3VTGA 3WV2A 1IACA 1IABA 4HMAA 2OY4A 3F16A 1CGLA 5CUHA 1KUKA 1R1IA 1KUGA 1Y0VA 3MA2A 1OS2A 3I7IA 1UMTA 456CA 2DW1A 1Y8JA 4JQGA 2V4BA 1KAPP 1XFWA 4I35A 2JIHA 2OW2A 3HDAP 1Q3AA 3DTKA 1BSWA 4ZR5A 1G12A 2PJTA 3B8ZA 1BKCA 1IADA 1L6JA 1H71P 1KUHA 3L0VA 3HY9A 1BKCE 3BA0A 3TSKA 1AYKA 1JJ9A 3L0TA 4GUYA 2OW9A 4WF6A 5BOYA 1OM8A 2JT5A 3KMEA 3OHLA 3K7NA 4IJOA 1BQQM 4JPAA 2W0DA 1QJJA 3DTIA 4EFSA 3ZVSA 2A8HA 2AYKA 1XFVA 2CLTA 1ZTQA 1Y93A 4XM8A 1Z3JA 3EDHA 1OMJA 1BKCI 2WO9A 1GE5A 3KMCA 1CGEA 3TVCA 1JANA 2W15A 4GF1A 1CK7A 1JIWP 1SU3A 5I4OA 1R1JA 1GE6A 2JT6A 4L6TA 4PKVA 3V96B 2I47A 3EDZA 3NX7A 3DSLA 3LQBA 3G42A 4XBHA 4H82A 3SHIA 4DPEA 2HU6A 2SRTA 3I7GA 3F19A 4WKEA 1MNCA 2O3EA 1G9KA 1MMQA 4H30A 5I3MA 1IAAA 3K7LA 3HBUP 1FLSA 3KRYA 3RTTA 1HOVA 1C3IA 4J4MA 5I12A 5L79A 2MLRA 4H3XA 4JA1A 2FV9A 1CXVA 1SATA 2OZRA 1B3DA 1A86A 3VI1A 1GO8P 3RTSA 3P1VA 4ILWD 2X3AA 1GE7A 1CGFA 4GR8A 1K7GA 2ERQA 2YB9A 2L0RA 5D1SA 4QKZA 3P24A 4A3WA 2DW2A 1D8MA 1AKLA 1G49A 1ZS0A 4WK7A 1EB6A 3DL1A 3EDIA 3EHXA 3LJTA 3OHOA 5D1UA 2Y6CA 2OXZA 3LMCA 1SRPA 4PKRA 4FU4A 2W14A 1SLNA 2E3XA 2KRJA 4DF9A 3F1AA 1DMTA 3HDBA 2K9CA 1ATLA 5L7FA 1BUDA 4IUWA 2FV5A 3AYKA 4PKSA 3KWVC 1JIZA 1C8TA 1C7KA 1XFUA 1GKDA 2OVZA 3Q2HA 5LABA 4FXYP 4HX3A 2W12A 3HYGA 3KEKA 3LUMA 1HFSA 1WNIA 3KEJA 3B92A 3WV1A 4H2EA 1R54A 4GWMA 2YUFA 2E2DA 1D7XA 4L19A 1R55A 1B8YA 3AYUA 5D3CA 3F17A 1UTTA 4FXQA 1PWPA 3EWJA 2D1NA 1YP1A 4XM6A 4AXQA 1HY7A 2Y6DA 1JAQA 3DNGA 3ZXHA 3B2ZA 3EDGA 1QIAA 3CKIA 2J83A 4I03A 2X3BA 1YOUA 1O0QA 4H84A 4WKIA 4PKWA 2Z2DA 1I1IP 2X3CA 3LIKA 3O64A 1OM6A 3AIGA 1XURA 2WO8A 1BQOA 2ERPA 1HFCA 3DWBA 3LQ0A 4XCTA 2EROA 1RM8A 2OVXA 4GR3A 5D7WA 4L7AA 1RMZA 1EAKA 1KBCA 1AF0A 5D1TA 3N2UA 3G5CA 5CZMA 2MZIA 3E8RA 4H1QA 4G0DA 1DTHA 1O0TA 3DPEA 5CXAA 2YIGA 3ELMA 1KUIA 3LUNA 5JMYA 1USNA 1PWUA 1JK3A 4PKQA 2AIGP 1I73A 3F15A 1YQYA 1CQRA 1CIZA 1JAPA 3O2XA 5B5OA 1OM7A 1UMSA 1JAOA 1OS9A 4AUOA 4GWNA 4JP4A 2JNPA 1KUFA 5I0LA 4WZVA 2DDFA 3LE9A 3HB2P 2POJA 1A85A 4R3VA 1BUVM 2K2GA 1QIBA 3HY7A 4DV8A 4L63A 2JSDA 1S4BP 1K7QA 4PKUA 3KECA 3ZUKA 2OXUA 1YCMA 1G4KA 1SLMA 1ROSA 1ZXCA 1PWQA 1IAEA 1XFZA 2WOAA 2CKIA 5I43A 5BPAA 2TCLA 1GKCA 1GO7P 3Q2GA 4A7BA 1QUAA 1D5JA 1OO9A 4Q1LA 1R1HA 5BOTA 2XS4A 5D2BA 4PKTA 1PWWA 2MLSA 1ASTA 2MZEA 2OI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CAQ A;  3LK8 A;  3LJZ A;  1SMP A;  3U1R A;  2OY2 A;  1D8F A;  1ZP5 A;  4JIJ A;  1HV5 A;  3LEA A;  2D1O A;  2N8R A;  2OW1 A;  4FVL A;  2W13 A;  1XFX A;  1I76 A;  4AIG A;  3LJG A;  3TT4 A;  2XS3 A;  3LKA A;  3UVC A;  3WV3 A;  3EHY A;  3TS4 A;  5I2Z A;  1FM1 A;  1UTZ A;  2RJQ A;  2RJP A;  3GBO A;  2QPJ A;  1FBL A;  2X7M A;  1ZVX A;  3KHI A;  3F18 A;  4G9L A;  1G05 A;  2O36 A;  2MZH A;  1BM6 A;  2DDY A;  2OXW A;  4CTH A;  1QJI A;  3HBV P;  1ZXV A;  2J0T A;  1MMP A;  1EUB A;  1HTD A;  1ND1 A;  4AYK A;  3DPF A;  1BIW A;  1QIC A;  1XFY A;  1XUD A;  2DW0 A;  3LIR A;  1IAG A;  3LGP A;  4XM7 A;  2USN A;  3LIL A;  1GXD A;  1MMR A;  4ON1 A;  1K7I A;  3N2V A;  4IN9 A;  1MMB A;  966C A;  1JH1 A;  1J7N A;  4GR0 A;  3USN A;  1XUC A;  1PWV A;  4GQL A;  830C A;  5H8X A;  1UEA A;  4H49 A;  1JKY A;  5B5P A;  1BZS A;  2OW0 A;  4DD8 A;  4H76 A;  3VTG A;  3WV2 A;  1IAC A;  1IAB A;  4HMA A;  2OY4 A;  3F16 A;  1CGL A;  5CUH A;  1KUK A;  1R1I A;  1KUG A;  1Y0V A;  3MA2 A;  1OS2 A;  3I7I A;  1UMT A;  456C A;  2DW1 A;  1Y8J A;  4JQG A;  2V4B A;  1KAP P;  1XFW A;  4I35 A;  2JIH A;  2OW2 A;  3HDA P;  1Q3A A;  1BSW A;  4ZR5 A;  1G12 A;  2PJT A;  3B8Z A;  1BKC A;  1IAD A;  1L6J A;  1H71 P;  1KUH A;  3L0V A;  3HY9 A;  1BKC E;  3BA0 A;  3TSK A;  1AYK A;  1JJ9 A;  3L0T A;  4GUY A;  2OW9 A;  4WF6 A;  5BOY A;  1OM8 A;  2JT5 A;  3KME A;  3OHL A;  3K7N A;  4IJO A;  1BQQ M;  4JPA A;  2W0D A;  1QJJ A;  4EFS A;  3ZVS A;  2A8H A;  2AYK A;  1XFV A;  2CLT A;  1ZTQ A;  1Y93 A;  4XM8 A;  1Z3J A;  3EDH A;  1OMJ A;  1BKC I;  2WO9 A;  1GE5 A;  3KMC A;  1CGE A;  3TVC A;  1JAN A;  2W15 A;  4GF1 A;  1CK7 A;  1JIW P;  1SU3 A;  5I4O A;  1R1J A;  1GE6 A;  2JT6 A;  4L6T A;  4PKV A;  3V96 B;  2I47 A;  3EDZ A;  3NX7 A;  3DSL A;  3LQB A;  3G42 A;  4XBH A;  4H82 A;  3SHI A;  4DPE A;  2HU6 A;  2SRT A;  3I7G A;  3F19 A;  4WKE A;  1MNC A;  2O3E A;  1G9K A;  1MMQ A;  4H30 A;  5I3M A;  1IAA A;  3K7L A;  3HBU P;  1FLS A;  3KRY A;  3RTT A;  1HOV A;  1C3I A;  4J4M A;  5I12 A;  5L79 A;  2MLR A;  4H3X A;  4JA1 A;  2FV9 A;  1CXV A;  1SAT A;  2OZR A;  1B3D A;  1A86 A;  3VI1 A;  1GO8 P;  3RTS A;  3P1V A;  4ILW D;  2X3A A;  1GE7 A;  1CGF A;  4GR8 A;  1K7G A;  2ERQ A;  2YB9 A;  2L0R A;  5D1S A;  4QKZ A;  3P24 A;  4A3W A;  2DW2 A;  1D8M A;  1AKL A;  1G49 A;  1ZS0 A;  4WK7 A;  1EB6 A;  3DL1 A;  3EDI A;  3EHX A;  3LJT A;  3OHO A;  5D1U A;  2Y6C A;  2OXZ A;  3LMC A;  1SRP A;  4PKR A;  4FU4 A;  2W14 A;  1SLN A;  2E3X A;  2KRJ A;  4DF9 A;  3F1A A;  1DMT A;  3HDB A;  2K9C A;  1ATL A;  5L7F A;  1BUD A;  4IUW A;  2FV5 A;  3AYK A;  4PKS A;  3KWV C;  1JIZ A;  1C8T A;  1C7K A;  1XFU A;  1GKD A;  2OVZ A;  3Q2H A;  5LAB A;  4FXY P;  4HX3 A;  2W12 A;  3HYG A;  3KEK A;  3LUM A;  1HFS A;  1WNI A;  3KEJ A;  3B92 A;  3WV1 A;  4H2E A;  1R54 A;  4GWM A;  2E2D A;  1D7X A;  4L19 A;  1R55 A;  1B8Y A;  3AYU A;  5D3C A;  3F17 A;  1UTT A;  4FXQ A;  1PWP A;  3EWJ A;  2D1N A;  1YP1 A;  4XM6 A;  4AXQ A;  1HY7 A;  2Y6D A;  1JAQ A;  3DNG A;  3ZXH A;  3B2Z A;  3EDG A;  1QIA A;  3CKI A;  2J83 A;  4I03 A;  2X3B A;  1YOU A;  1O0Q A;  4H84 A;  4WKI A;  4PKW A;  2Z2D A;  1I1I P;  2X3C A;  3LIK A;  3O64 A;  1OM6 A;  3AIG A;  1XUR A;  2WO8 A;  1BQO A;  2ERP A;  1HFC A;  3DWB A;  3LQ0 A;  4XCT A;  2ERO A;  1RM8 A;  2OVX A;  4GR3 A;  5D7W A;  1RMZ A;  1EAK A;  1KBC A;  1AF0 A;  5D1T A;  3N2U A;  3G5C A;  5CZM A;  2MZI A;  3E8R A;  4H1Q A;  4G0D A;  1DTH A;  1O0T A;  3DPE A;  5CXA A;  2YIG A;  3ELM A;  1KUI A;  3LUN A;  5JMY A;  1USN A;  1PWU A;  1JK3 A;  4PKQ A;  2AIG P;  1I73 A;  3F15 A;  1YQY A;  1CQR A;  1CIZ A;  1JAP A;  3O2X A;  5B5O A;  1OM7 A;  1UMS A;  1JAO A;  1OS9 A;  4AUO A;  4GWN A;  4JP4 A;  2JNP A;  1KUF A;  5I0L A;  4WZV A;  2DDF A;  3LE9 A;  3HB2 P;  2POJ A;  1A85 A;  4R3V A;  1BUV M;  2K2G A;  1QIB A;  3HY7 A;  4DV8 A;  4L63 A;  2JSD A;  1S4B P;  1K7Q A;  4PKU A;  3KEC A;  3ZUK A;  2OXU A;  1YCM A;  1G4K A;  1SLM A;  1ROS A;  1ZXC A;  1PWQ A;  1IAE A;  1XFZ A;  2WOA A;  2CKI A;  5I43 A;  5BPA A;  2TCL A;  1GKC A;  1GO7 P;  3Q2G A;  4A7B A;  1QUA A;  1D5J A;  1OO9 A;  4Q1L A;  1R1H A;  5BOT A;  2XS4 A;  5D2B A;  4PKT A;  1PWW A;  2MLS A;  1AST A;  2MZE A;  2OI0 A; 
#chains in the Genus database with same CATH topology
 1CAQ A;  3LK8 A;  3LJZ A;  1SMP A;  3U1R A;  2OY2 A;  1D8F A;  1ZP5 A;  4JIJ A;  1HV5 A;  3LEA A;  2D1O A;  2N8R A;  2OW1 A;  4FVL A;  2W13 A;  1XFX A;  1I76 A;  4AIG A;  3LJG A;  3TT4 A;  2XS3 A;  3LKA A;  3UVC A;  3WV3 A;  3EHY A;  3TS4 A;  5I2Z A;  1FM1 A;  1UTZ A;  2RJQ A;  2RJP A;  3GBO A;  2QPJ A;  1FBL A;  2X7M A;  1ZVX A;  3KHI A;  3F18 A;  4G9L A;  1G05 A;  2O36 A;  2MZH A;  1BM6 A;  2DDY A;  2OXW A;  4CTH A;  1QJI A;  3HBV P;  1ZXV A;  2J0T A;  1MMP A;  1EUB A;  1HTD A;  1ND1 A;  4AYK A;  3DPF A;  1BIW A;  1QIC A;  1XFY A;  1XUD A;  2DW0 A;  3LIR A;  1IAG A;  3LGP A;  4XM7 A;  2USN A;  3LIL A;  1GXD A;  1MMR A;  3DTE A;  4ON1 A;  1K7I A;  3N2V A;  4IN9 A;  1MMB A;  966C A;  1JH1 A;  1J7N A;  4GR0 A;  3USN A;  1XUC A;  1PWV A;  4GQL A;  830C A;  5H8X A;  1UEA A;  4H49 A;  1JKY A;  5B5P A;  1BZS A;  2OW0 A;  4DD8 A;  4H76 A;  3VTG A;  3WV2 A;  1IAC A;  1IAB A;  4HMA A;  2OY4 A;  3F16 A;  1CGL A;  5CUH A;  1KUK A;  1R1I A;  1KUG A;  1Y0V A;  3MA2 A;  1OS2 A;  3I7I A;  1UMT A;  456C A;  2DW1 A;  1Y8J A;  4JQG A;  2V4B A;  1KAP P;  1XFW A;  4I35 A;  2JIH A;  2OW2 A;  3HDA P;  1Q3A A;  3DTK A;  1BSW A;  4ZR5 A;  1G12 A;  2PJT A;  3B8Z A;  1BKC A;  1IAD A;  1L6J A;  1H71 P;  1KUH A;  3L0V A;  3HY9 A;  1BKC E;  3BA0 A;  3TSK A;  1AYK A;  1JJ9 A;  3L0T A;  4GUY A;  2OW9 A;  4WF6 A;  5BOY A;  1OM8 A;  2JT5 A;  3KME A;  3OHL A;  3K7N A;  4IJO A;  1BQQ M;  4JPA A;  2W0D A;  1QJJ A;  3DTI A;  4EFS A;  3ZVS A;  2A8H A;  2AYK A;  1XFV A;  2CLT A;  1ZTQ A;  1Y93 A;  4XM8 A;  1Z3J A;  3EDH A;  1OMJ A;  1BKC I;  2WO9 A;  1GE5 A;  3KMC A;  1CGE A;  3TVC A;  1JAN A;  2W15 A;  4GF1 A;  1CK7 A;  1JIW P;  1SU3 A;  5I4O A;  1R1J A;  1GE6 A;  2JT6 A;  4L6T A;  4PKV A;  3V96 B;  2I47 A;  3EDZ A;  3NX7 A;  3DSL A;  3LQB A;  3G42 A;  4XBH A;  4H82 A;  3SHI A;  4DPE A;  2HU6 A;  2SRT A;  3I7G A;  3F19 A;  4WKE A;  1MNC A;  2O3E A;  1OZ9 A;  1G9K A;  1MMQ A;  4H30 A;  5I3M A;  1IAA A;  3K7L A;  3HBU P;  1FLS A;  3KRY A;  3RTT A;  1HOV A;  1C3I A;  4J4M A;  5I12 A;  5L79 A;  2MLR A;  4H3X A;  4JA1 A;  2FV9 A;  1CXV A;  1SAT A;  2OZR A;  1B3D A;  1A86 A;  3VI1 A;  1GO8 P;  3RTS A;  3P1V A;  4ILW D;  2X3A A;  1GE7 A;  1CGF A;  4GR8 A;  1K7G A;  2ERQ A;  2YB9 A;  2L0R A;  5D1S A;  4QKZ A;  3P24 A;  4A3W A;  2DW2 A;  1D8M A;  1AKL A;  1G49 A;  1ZS0 A;  4WK7 A;  1EB6 A;  3DL1 A;  3EDI A;  3EHX A;  3LJT A;  3OHO A;  5D1U A;  2Y6C A;  2OXZ A;  3LMC A;  1SRP A;  4PKR A;  4FU4 A;  2W14 A;  1SLN A;  2E3X A;  2KRJ A;  4DF9 A;  3F1A A;  1DMT A;  3HDB A;  2K9C A;  1ATL A;  5L7F A;  1BUD A;  4IUW A;  2FV5 A;  3AYK A;  4PKS A;  3KWV C;  1JIZ A;  1C8T A;  1C7K A;  1XFU A;  1GKD A;  2OVZ A;  3Q2H A;  5LAB A;  4FXY P;  4HX3 A;  2W12 A;  3HYG A;  3KEK A;  3LUM A;  1HFS A;  1WNI A;  3KEJ A;  3B92 A;  3WV1 A;  4H2E A;  1R54 A;  4GWM A;  2YUF A;  2E2D A;  1D7X A;  4L19 A;  1R55 A;  1B8Y A;  3AYU A;  5D3C A;  3F17 A;  1UTT A;  4FXQ A;  1PWP A;  3EWJ A;  2D1N A;  1YP1 A;  4XM6 A;  4AXQ A;  1HY7 A;  2Y6D A;  1JAQ A;  3DNG A;  3ZXH A;  3B2Z A;  3EDG A;  1QIA A;  3CKI A;  2J83 A;  4I03 A;  2X3B A;  1YOU A;  1O0Q A;  4H84 A;  4WKI A;  4PKW A;  2Z2D A;  1I1I P;  2X3C A;  3LIK A;  3O64 A;  1OM6 A;  3AIG A;  1XUR A;  2WO8 A;  1BQO A;  2ERP A;  1HFC A;  3DWB A;  3LQ0 A;  4XCT A;  2ERO A;  1RM8 A;  2OVX A;  4GR3 A;  5D7W A;  4L7A A;  1RMZ A;  1EAK A;  1KBC A;  1AF0 A;  5D1T A;  3N2U A;  3G5C A;  5CZM A;  1TVI A;  2MZI A;  3E8R A;  4H1Q A;  4G0D A;  1DTH A;  1O0T A;  3DPE A;  5CXA A;  2YIG A;  3ELM A;  1KUI A;  3LUN A;  5JMY A;  1USN A;  1PWU A;  1JK3 A;  4PKQ A;  2AIG P;  1I73 A;  3F15 A;  1YQY A;  1CQR A;  1CIZ A;  1JAP A;  3O2X A;  5B5O A;  1OM7 A;  1UMS A;  1JAO A;  1OS9 A;  4AUO A;  4GWN A;  4JP4 A;  2JNP A;  1KUF A;  5I0L A;  4WZV A;  2DDF A;  3LE9 A;  3HB2 P;  2POJ A;  1A85 A;  4R3V A;  1BUV M;  2K2G A;  1QIB A;  3HY7 A;  4DV8 A;  4L63 A;  2JSD A;  1S4B P;  1K7Q A;  4PKU A;  3KEC A;  3ZUK A;  2OXU A;  1YCM A;  1XM5 A;  1G4K A;  1SLM A;  1ROS A;  1ZXC A;  1PWQ A;  1IAE A;  1XFZ A;  2WOA A;  2CKI A;  5I43 A;  5BPA A;  2TCL A;  1GKC A;  1GO7 P;  1XAX A;  3Q2G A;  4A7B A;  1QUA A;  1D5J A;  1OO9 A;  4Q1L A;  1R1H A;  5BOT A;  2XS4 A;  5D2B A;  4PKT A;  1PWW A;  2MLS A;  1AST A;  2MZE A;  2OI0 A; 
#chains in the Genus database with same CATH homology
 1CAQ A;  3LK8 A;  3LJZ A;  1SMP A;  3U1R A;  2OY2 A;  1D8F A;  1ZP5 A;  4JIJ A;  1HV5 A;  3LEA A;  2D1O A;  2N8R A;  2OW1 A;  4FVL A;  2W13 A;  1XFX A;  1I76 A;  4AIG A;  3LJG A;  3TT4 A;  2XS3 A;  3LKA A;  3UVC A;  3WV3 A;  3EHY A;  3TS4 A;  5I2Z A;  1FM1 A;  1UTZ A;  2RJQ A;  2RJP A;  3GBO A;  2QPJ A;  1FBL A;  2X7M A;  1ZVX A;  3KHI A;  3F18 A;  4G9L A;  1G05 A;  2O36 A;  2MZH A;  1BM6 A;  2DDY A;  2OXW A;  4CTH A;  1QJI A;  3HBV P;  1ZXV A;  2J0T A;  1MMP A;  1EUB A;  1HTD A;  1ND1 A;  4AYK A;  3DPF A;  1BIW A;  1QIC A;  1XFY A;  1XUD A;  2DW0 A;  3LIR A;  1IAG A;  3LGP A;  4XM7 A;  2USN A;  3LIL A;  1GXD A;  1MMR A;  3DTE A;  4ON1 A;  1K7I A;  3N2V A;  4IN9 A;  1MMB A;  966C A;  1JH1 A;  1J7N A;  4GR0 A;  3USN A;  1XUC A;  1PWV A;  4GQL A;  830C A;  5H8X A;  1UEA A;  4H49 A;  1JKY A;  5B5P A;  1BZS A;  2OW0 A;  4DD8 A;  4H76 A;  3VTG A;  3WV2 A;  1IAC A;  1IAB A;  4HMA A;  2OY4 A;  3F16 A;  1CGL A;  5CUH A;  1KUK A;  1R1I A;  1KUG A;  1Y0V A;  3MA2 A;  1OS2 A;  3I7I A;  1UMT A;  456C A;  2DW1 A;  1Y8J A;  4JQG A;  2V4B A;  1KAP P;  1XFW A;  4I35 A;  2JIH A;  2OW2 A;  3HDA P;  1Q3A A;  3DTK A;  1BSW A;  4ZR5 A;  1G12 A;  2PJT A;  3B8Z A;  1BKC A;  1IAD A;  1L6J A;  1H71 P;  1KUH A;  3L0V A;  3HY9 A;  1BKC E;  3BA0 A;  3TSK A;  1AYK A;  1JJ9 A;  3L0T A;  4GUY A;  2OW9 A;  4WF6 A;  5BOY A;  1OM8 A;  2JT5 A;  3KME A;  3OHL A;  3K7N A;  4IJO A;  1BQQ M;  4JPA A;  2W0D A;  1QJJ A;  3DTI A;  4EFS A;  3ZVS A;  2A8H A;  2AYK A;  1XFV A;  2CLT A;  1ZTQ A;  1Y93 A;  4XM8 A;  1Z3J A;  3EDH A;  1OMJ A;  1BKC I;  2WO9 A;  1GE5 A;  3KMC A;  1CGE A;  3TVC A;  1JAN A;  2W15 A;  4GF1 A;  1CK7 A;  1JIW P;  1SU3 A;  5I4O A;  1R1J A;  1GE6 A;  2JT6 A;  4L6T A;  4PKV A;  3V96 B;  2I47 A;  3EDZ A;  3NX7 A;  3DSL A;  3LQB A;  3G42 A;  4XBH A;  4H82 A;  3SHI A;  4DPE A;  2HU6 A;  2SRT A;  3I7G A;  3F19 A;  4WKE A;  1MNC A;  2O3E A;  1G9K A;  1MMQ A;  4H30 A;  5I3M A;  1IAA A;  3K7L A;  3HBU P;  1FLS A;  3KRY A;  3RTT A;  1HOV A;  1C3I A;  4J4M A;  5I12 A;  5L79 A;  2MLR A;  4H3X A;  4JA1 A;  2FV9 A;  1CXV A;  1SAT A;  2OZR A;  1B3D A;  1A86 A;  3VI1 A;  1GO8 P;  3RTS A;  3P1V A;  4ILW D;  2X3A A;  1GE7 A;  1CGF A;  4GR8 A;  1K7G A;  2ERQ A;  2YB9 A;  2L0R A;  5D1S A;  4QKZ A;  3P24 A;  4A3W A;  2DW2 A;  1D8M A;  1AKL A;  1G49 A;  1ZS0 A;  4WK7 A;  1EB6 A;  3DL1 A;  3EDI A;  3EHX A;  3LJT A;  3OHO A;  5D1U A;  2Y6C A;  2OXZ A;  3LMC A;  1SRP A;  4PKR A;  4FU4 A;  2W14 A;  1SLN A;  2E3X A;  2KRJ A;  4DF9 A;  3F1A A;  1DMT A;  3HDB A;  2K9C A;  1ATL A;  5L7F A;  1BUD A;  4IUW A;  2FV5 A;  3AYK A;  4PKS A;  3KWV C;  1JIZ A;  1C8T A;  1C7K A;  1XFU A;  1GKD A;  2OVZ A;  3Q2H A;  5LAB A;  4FXY P;  4HX3 A;  2W12 A;  3HYG A;  3KEK A;  3LUM A;  1HFS A;  1WNI A;  3KEJ A;  3B92 A;  3WV1 A;  4H2E A;  1R54 A;  4GWM A;  2YUF A;  2E2D A;  1D7X A;  4L19 A;  1R55 A;  1B8Y A;  3AYU A;  5D3C A;  3F17 A;  1UTT A;  4FXQ A;  1PWP A;  3EWJ A;  2D1N A;  1YP1 A;  4XM6 A;  4AXQ A;  1HY7 A;  2Y6D A;  1JAQ A;  3DNG A;  3ZXH A;  3B2Z A;  3EDG A;  1QIA A;  3CKI A;  2J83 A;  4I03 A;  2X3B A;  1YOU A;  1O0Q A;  4H84 A;  4WKI A;  4PKW A;  2Z2D A;  1I1I P;  2X3C A;  3LIK A;  3O64 A;  1OM6 A;  3AIG A;  1XUR A;  2WO8 A;  1BQO A;  2ERP A;  1HFC A;  3DWB A;  3LQ0 A;  4XCT A;  2ERO A;  1RM8 A;  2OVX A;  4GR3 A;  5D7W A;  4L7A A;  1RMZ A;  1EAK A;  1KBC A;  1AF0 A;  5D1T A;  3N2U A;  3G5C A;  5CZM A;  2MZI A;  3E8R A;  4H1Q A;  4G0D A;  1DTH A;  1O0T A;  3DPE A;  5CXA A;  2YIG A;  3ELM A;  1KUI A;  3LUN A;  5JMY A;  1USN A;  1PWU A;  1JK3 A;  4PKQ A;  2AIG P;  1I73 A;  3F15 A;  1YQY A;  1CQR A;  1CIZ A;  1JAP A;  3O2X A;  5B5O A;  1OM7 A;  1UMS A;  1JAO A;  1OS9 A;  4AUO A;  4GWN A;  4JP4 A;  2JNP A;  1KUF A;  5I0L A;  4WZV A;  2DDF A;  3LE9 A;  3HB2 P;  2POJ A;  1A85 A;  4R3V A;  1BUV M;  2K2G A;  1QIB A;  3HY7 A;  4DV8 A;  4L63 A;  2JSD A;  1S4B P;  1K7Q A;  4PKU A;  3KEC A;  3ZUK A;  2OXU A;  1YCM A;  1G4K A;  1SLM A;  1ROS A;  1ZXC A;  1PWQ A;  1IAE A;  1XFZ A;  2WOA A;  2CKI A;  5I43 A;  5BPA A;  2TCL A;  1GKC A;  1GO7 P;  3Q2G A;  4A7B A;  1QUA A;  1D5J A;  1OO9 A;  4Q1L A;  1R1H A;  5BOT A;  2XS4 A;  5D2B A;  4PKT A;  1PWW A;  2MLS A;  1AST A;  2MZE A;  2OI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...