2OVXA

Mmp-9 active site mutant with barbiturate inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
159
structure length
159
Chain Sequence
FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) (92 kDa ty
publication title Crystal Structures of MMP-9 Complexes with Five Inhibitors: Contribution of the Flexible Arg424 Side-chain to Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2ovxA00
1XUCA 3B2ZA 1K7GA 2USNA 1QIBA 3B8ZA 1DTHA 4AYKA 1QICA 1CGEA 1RM8A 3KEJA 2YB9A 1CXVA 4DPEA 3VTGA 1BKCI 3EDIA 3EWJA 5D1TA 3TSKA 1ZP5A 5JMYA 1GO7P 830CA 1XFZA 1B8YA 5BOTA 2N8RA 2OW2A 1XFVA 1KAPP 3DSLA 3WV2A 2DDFA 4L6TA 2Y6CA 5CUHA 4J4MA 1R1HA 5BPAA 1CK7A 2X3CA 3DNGA 1CGFA 3F19A 1OM8A 3HBVP 1XUDA 3O2XA 5D2BA 3L0TA 3HB2P 2JSDA 3RTSA 3N2VA 1MNCA 4IJOA 3V96B 2E2DA 1H71P 4JP4A 1JAPA 1Y0VA 1R55A 4GUYA 2K2GA 4A7BA 2Y6DA 1WNIA 1UEAA 1QJJA 4FXQA 3LQBA 3GBOA 4H1QA 4JA1A 1KBCA 1BKCA 1YP1A 4XM7A 3E8RA 3EHXA 5I43A 1D8MA 5I2ZA 1GE5A 1G05A 3RTTA 4CTHA 1JIZA 1PWPA 2V4BA 4HX3A 1BM6A 1O0TA 2RJPA 1XFXA 1AF0A 1SATA 1UTTA 3LEAA 2W15A 456CA 1ZXVA 4H84A 4H49A 1HFSA 4EFSA 1J7NA 3AIGA 2WO9A 1DMTA 2W0DA 4H82A 5LABA 1ASTA 2I47A 4GF1A 1RMZA 1KUFA 3N2UA 3ZXHA 4PKTA 1Z3JA 1QIAA 2OY4A 1S4BP 1IAAA 1G4KA 1MMBA 1I1IP 2XS3A 3USNA 3LILA 1ZS0A 3KECA 1HV5A 5I4OA 3WV3A 2MLSA 966CA 2DW0A 1IABA 3AYUA 1CAQA 1I73A 2E3XA 1GE7A 2D1OA 1JAQA 4ON1A 5D1SA 1K7QA 1OMJA 3EHYA 1OO9A 2OXZA 1G9KA 1Q3AA 3WV1A 3F1AA 2W14A 3LIKA 3EDHA 2W12A 2MZHA 2JT6A 4Q1LA 4G0DA 2OW1A 1FBLA 1K7IA 2WO8A 4JIJA 1ND1A 3LMCA 1SRPA 4XM6A 2OI0A 2PJTA 1GKCA 3OHOA 4WKEA 3ZUKA 1L6JA 1MMQA 2D1NA 1OS2A 2X7MA 3KEKA 5H8XA 1BQOA 4XCTA 2OVZA 3G5CA 4R3VA 5D3CA 1JKYA 3L0VA 1JIWP 3LKAA 4PKUA 3LJTA 1USNA 4L63A 1KUIA 4GQLA 1AYKA 4GR8A 1KUHA 1OS9A 1GO8P 4FU4A 2FV9A 1HTDA 3DPEA 4GWNA 5L7FA 2OW9A 1IAEA 1GE6A 1R54A 1JH1A 4WK7A 2O3EA 4JQGA 5B5PA 3Q2HA 3O64A 3LK8A 4GR3A 1FLSA 1UMSA 3DWBA 1PWWA 3BA0A 1GXDA 1MMPA 1ZTQA 2OZRA 4PKWA 3K7NA 4XM8A 2WOAA 3I7GA 3AYKA 3F17A 2MLRA 1BUDA 1IADA 3KHIA 2DW2A 3ZVSA 4H3XA 4H76A 1PWVA 2RJQA 4ZR5A 1SLMA 4GWMA 4QKZA 1B3DA 4WKIA 4AIGA 2J0TA 3F18A 4A3WA 1UMTA 1CQRA 1IAGA 1A85A 1JJ9A 5CZMA 4PKVA 1FM1A 1YCMA 5BOYA 2OY2A 1BUVM 1YQYA 1QUAA 1SU3A 4I35A 2CLTA 1YOUA 1PWQA 2TCLA 2JT5A 1BSWA 1Y93A 4G9LA 3LIRA 1OM6A 1SMPA 3F15A 1R1JA 4PKSA 3HDAP 2X3BA 1ZVXA 2HU6A 5D7WA 1R1IA 4WF6A 1BZSA 5B5OA 3NX7A 4ILWD 1O0QA 1G12A 3TVCA 4DD8A 3HDBA 4FXYP 4IUWA 3U1RA 2OXUA 2DW1A 3HYGA 1ATLA 2YIGA 1ZXCA 4AUOA 3TT4A 2OXWA 2X3AA 2MZIA 4H30A 3KWVC 1AKLA 1SLNA 1HFCA 1HOVA 3EDZA 1D7XA 1BKCE 3Q2GA 2W13A 1BQQM 1PWUA 5CXAA 1EAKA 5I3MA 4GR0A 3B92A 1D8FA 3CKIA 3LJZA 1CGLA 3HBUP 2KRJA 3ELMA 4DV8A 2J83A 3LE9A 1EB6A 3TS4A 1HY7A 3LQ0A 2OW0A 1KUGA 3KRYA 3DPFA 2DDYA 3LJGA 2A8HA 1JK3A 1A86A 2MZEA 5I0LA 5D1UA 3P1VA 1D5JA 2O36A 3HY9A 4PKQA 3SHIA 3LUMA 4IN9A 2CKIA 4PKRA 1Y8JA 1KUKA 3HY7A 2POJA 1JAOA 1C3IA 3I7IA 2FV5A 1XFYA 2K9CA 3VI1A 3K7LA 1I76A 3KMCA 4AXQA 4WZVA 1UTZA 2JIHA 2QPJA 1MMRA 3EDGA 1ROSA 3P24A 2ERPA 2ERQA 2AIGP 2Z2DA 5I12A 3F16A 1C8TA 4H2EA 4DF9A 4I03A 4L19A 4HMAA 5L79A 3G42A 3KMEA 1GKDA 4XBHA 1XFWA 2L0RA 1IACA 3DL1A 1BIWA 2AYKA 3LGPA 1XFUA 3OHLA 1QJIA 3MA2A 1OM7A 2JNPA 3UVCA 1JANA 2OVXA 1C7KA 3LUNA 1G49A 4JPAA 4FVLA 1XURA 1EUBA 2SRTA 2XS4A 1CIZA 2EROA
chains in the Genus database with same CATH superfamily
1XUCA 3B2ZA 1K7GA 2USNA 1QIBA 3B8ZA 1DTHA 4AYKA 1QICA 1CGEA 1RM8A 3KEJA 2YB9A 1CXVA 4DPEA 3VTGA 1BKCI 3EDIA 3EWJA 5D1TA 3TSKA 1ZP5A 5JMYA 1GO7P 830CA 1XFZA 1B8YA 5BOTA 2N8RA 2OW2A 1XFVA 1KAPP 3DSLA 3WV2A 2DDFA 4L6TA 2Y6CA 5CUHA 4J4MA 1R1HA 5BPAA 1CK7A 2X3CA 3DNGA 1CGFA 3F19A 1OM8A 3HBVP 1XUDA 3O2XA 5D2BA 3L0TA 3HB2P 2JSDA 3RTSA 3N2VA 1MNCA 4IJOA 3V96B 2E2DA 1H71P 4JP4A 1JAPA 1Y0VA 1R55A 4GUYA 2K2GA 4A7BA 2Y6DA 1WNIA 1UEAA 1QJJA 4FXQA 3LQBA 3GBOA 4H1QA 4JA1A 1KBCA 1BKCA 1YP1A 4XM7A 3E8RA 3EHXA 5I43A 1D8MA 5I2ZA 1GE5A 1G05A 3RTTA 4CTHA 1JIZA 1PWPA 2V4BA 4HX3A 1BM6A 1O0TA 2RJPA 1XFXA 1AF0A 1SATA 1UTTA 3LEAA 2W15A 456CA 1ZXVA 4H84A 4H49A 1HFSA 4EFSA 1J7NA 3AIGA 2WO9A 1DMTA 2W0DA 4H82A 5LABA 1OZ9A 3DTKA 1ASTA 2I47A 3DTEA 1TVIA 4GF1A 1RMZA 1KUFA 3N2UA 3ZXHA 4PKTA 1Z3JA 1QIAA 2OY4A 1S4BP 1IAAA 1G4KA 1MMBA 1I1IP 2XS3A 3USNA 3LILA 1ZS0A 3KECA 1HV5A 5I4OA 3WV3A 2MLSA 966CA 2DW0A 1IABA 3AYUA 1CAQA 1I73A 2E3XA 1GE7A 2D1OA 1JAQA 4ON1A 5D1SA 1K7QA 1OMJA 3EHYA 1OO9A 2OXZA 1G9KA 1Q3AA 3WV1A 3F1AA 2W14A 3LIKA 3EDHA 2W12A 2MZHA 2JT6A 4Q1LA 4G0DA 2OW1A 4L7AA 1FBLA 1K7IA 2WO8A 4JIJA 1ND1A 3LMCA 1SRPA 4XM6A 2OI0A 2PJTA 1GKCA 3OHOA 4WKEA 3ZUKA 1L6JA 1MMQA 2D1NA 1OS2A 2X7MA 3KEKA 5H8XA 1BQOA 4XCTA 2OVZA 3G5CA 4R3VA 5D3CA 1JKYA 3L0VA 1JIWP 3LKAA 1XAXA 4PKUA 3LJTA 1USNA 4L63A 1KUIA 4GQLA 1AYKA 4GR8A 1KUHA 1OS9A 1GO8P 4FU4A 2FV9A 1HTDA 3DPEA 4GWNA 5L7FA 2OW9A 1IAEA 1GE6A 1R54A 1JH1A 4WK7A 2O3EA 4JQGA 5B5PA 3Q2HA 3O64A 3LK8A 4GR3A 1FLSA 1UMSA 3DWBA 1PWWA 3BA0A 1GXDA 1MMPA 1ZTQA 2OZRA 4PKWA 3K7NA 4XM8A 2WOAA 3I7GA 3AYKA 3F17A 2MLRA 1BUDA 1IADA 3KHIA 2DW2A 3ZVSA 4H3XA 4H76A 1PWVA 2RJQA 4ZR5A 1SLMA 4GWMA 4QKZA 1B3DA 4WKIA 4AIGA 2J0TA 3F18A 4A3WA 1UMTA 1CQRA 1IAGA 1A85A 1JJ9A 5CZMA 4PKVA 1FM1A 1YCMA 5BOYA 2OY2A 1BUVM 1YQYA 1QUAA 1SU3A 4I35A 2CLTA 1YOUA 1PWQA 2TCLA 2JT5A 1BSWA 1Y93A 4G9LA 3LIRA 1OM6A 1SMPA 3F15A 1R1JA 4PKSA 3HDAP 2X3BA 1ZVXA 2HU6A 5D7WA 1R1IA 4WF6A 1BZSA 5B5OA 3NX7A 4ILWD 1O0QA 1G12A 3TVCA 4DD8A 3HDBA 4FXYP 4IUWA 3U1RA 2OXUA 2DW1A 3HYGA 1ATLA 2YIGA 1ZXCA 4AUOA 3TT4A 2OXWA 2X3AA 2MZIA 4H30A 3KWVC 1AKLA 1SLNA 1HFCA 1HOVA 3EDZA 1D7XA 1BKCE 3Q2GA 2W13A 1BQQM 1PWUA 5CXAA 1EAKA 5I3MA 4GR0A 3B92A 3DTIA 1D8FA 3CKIA 3LJZA 1CGLA 3HBUP 1XM5A 2KRJA 3ELMA 4DV8A 2J83A 3LE9A 1EB6A 3TS4A 1HY7A 3LQ0A 2OW0A 1KUGA 3KRYA 3DPFA 2DDYA 3LJGA 2A8HA 1JK3A 1A86A 2MZEA 5I0LA 5D1UA 3P1VA 1D5JA 2O36A 3HY9A 4PKQA 3SHIA 3LUMA 4IN9A 2CKIA 4PKRA 1Y8JA 1KUKA 3HY7A 2POJA 1JAOA 1C3IA 3I7IA 2FV5A 1XFYA 2K9CA 3VI1A 3K7LA 1I76A 3KMCA 4AXQA 4WZVA 2YUFA 1UTZA 2JIHA 2QPJA 1MMRA 3EDGA 1ROSA 3P24A 2ERPA 2ERQA 2AIGP 2Z2DA 5I12A 3F16A 1C8TA 4H2EA 4DF9A 4I03A 4L19A 4HMAA 5L79A 3G42A 3KMEA 1GKDA 4XBHA 1XFWA 2L0RA 1IACA 3DL1A 1BIWA 2AYKA 3LGPA 1XFUA 3OHLA 1QJIA 3MA2A 1OM7A 2JNPA 3UVCA 1JANA 2OVXA 1C7KA 3LUNA 1G49A 4JPAA 4FVLA 1XURA 1EUBA 2SRTA 2XS4A 1CIZA 2EROA
chains in the Genus database with same CATH topology
1XUCA 3B2ZA 1K7GA 2USNA 1QIBA 3B8ZA 1DTHA 4AYKA 1QICA 1CGEA 1RM8A 3KEJA 2YB9A 1CXVA 4DPEA 3VTGA 1BKCI 3EDIA 3EWJA 5D1TA 3TSKA 1ZP5A 5JMYA 1GO7P 830CA 1XFZA 1B8YA 5BOTA 2N8RA 2OW2A 1XFVA 1KAPP 3DSLA 3WV2A 2DDFA 4L6TA 2Y6CA 5CUHA 4J4MA 1R1HA 5BPAA 1CK7A 2X3CA 3DNGA 1CGFA 3F19A 1OM8A 3HBVP 1XUDA 3O2XA 5D2BA 3L0TA 3HB2P 2JSDA 3RTSA 3N2VA 1MNCA 4IJOA 3V96B 2E2DA 1H71P 4JP4A 1JAPA 1Y0VA 1R55A 4GUYA 2K2GA 4A7BA 2Y6DA 1WNIA 1UEAA 1QJJA 4FXQA 3LQBA 3GBOA 4H1QA 4JA1A 1KBCA 1BKCA 1YP1A 4XM7A 3E8RA 3EHXA 5I43A 1D8MA 5I2ZA 1GE5A 1G05A 3RTTA 4CTHA 1JIZA 1PWPA 2V4BA 4HX3A 1BM6A 1O0TA 2RJPA 1XFXA 1AF0A 1SATA 1UTTA 3LEAA 2W15A 456CA 1ZXVA 4H84A 4H49A 1HFSA 4EFSA 1J7NA 3AIGA 2WO9A 1DMTA 2W0DA 4H82A 5LABA 3DTKA 1ASTA 2I47A 3DTEA 4GF1A 1RMZA 1KUFA 3N2UA 3ZXHA 4PKTA 1Z3JA 1QIAA 2OY4A 1S4BP 1IAAA 1G4KA 1MMBA 1I1IP 2XS3A 3USNA 3LILA 1ZS0A 3KECA 1HV5A 5I4OA 3WV3A 2MLSA 966CA 2DW0A 1IABA 3AYUA 1CAQA 1I73A 2E3XA 1GE7A 2D1OA 1JAQA 4ON1A 5D1SA 1K7QA 1OMJA 3EHYA 1OO9A 2OXZA 1G9KA 1Q3AA 3WV1A 3F1AA 2W14A 3LIKA 3EDHA 2W12A 2MZHA 2JT6A 4Q1LA 4G0DA 2OW1A 4L7AA 1FBLA 1K7IA 2WO8A 4JIJA 1ND1A 3LMCA 1SRPA 4XM6A 2OI0A 2PJTA 1GKCA 3OHOA 4WKEA 3ZUKA 1L6JA 1MMQA 2D1NA 1OS2A 2X7MA 3KEKA 5H8XA 1BQOA 4XCTA 2OVZA 3G5CA 4R3VA 5D3CA 1JKYA 3L0VA 1JIWP 3LKAA 4PKUA 3LJTA 1USNA 4L63A 1KUIA 4GQLA 1AYKA 4GR8A 1KUHA 1OS9A 1GO8P 4FU4A 2FV9A 1HTDA 3DPEA 4GWNA 5L7FA 2OW9A 1IAEA 1GE6A 1R54A 1JH1A 4WK7A 2O3EA 4JQGA 5B5PA 3Q2HA 3O64A 3LK8A 4GR3A 1FLSA 1UMSA 3DWBA 1PWWA 3BA0A 1GXDA 1MMPA 1ZTQA 2OZRA 4PKWA 3K7NA 4XM8A 2WOAA 3I7GA 3AYKA 3F17A 2MLRA 1BUDA 1IADA 3KHIA 2DW2A 3ZVSA 4H3XA 4H76A 1PWVA 2RJQA 4ZR5A 1SLMA 4GWMA 4QKZA 1B3DA 4WKIA 4AIGA 2J0TA 3F18A 4A3WA 1UMTA 1CQRA 1IAGA 1A85A 1JJ9A 5CZMA 4PKVA 1FM1A 1YCMA 5BOYA 2OY2A 1BUVM 1YQYA 1QUAA 1SU3A 4I35A 2CLTA 1YOUA 1PWQA 2TCLA 2JT5A 1BSWA 1Y93A 4G9LA 3LIRA 1OM6A 1SMPA 3F15A 1R1JA 4PKSA 3HDAP 2X3BA 1ZVXA 2HU6A 5D7WA 1R1IA 4WF6A 1BZSA 5B5OA 3NX7A 4ILWD 1O0QA 1G12A 3TVCA 4DD8A 3HDBA 4FXYP 4IUWA 3U1RA 2OXUA 2DW1A 3HYGA 1ATLA 2YIGA 1ZXCA 4AUOA 3TT4A 2OXWA 2X3AA 2MZIA 4H30A 3KWVC 1AKLA 1SLNA 1HFCA 1HOVA 3EDZA 1D7XA 1BKCE 3Q2GA 2W13A 1BQQM 1PWUA 5CXAA 1EAKA 5I3MA 4GR0A 3B92A 3DTIA 1D8FA 3CKIA 3LJZA 1CGLA 3HBUP 2KRJA 3ELMA 4DV8A 2J83A 3LE9A 1EB6A 3TS4A 1HY7A 3LQ0A 2OW0A 1KUGA 3KRYA 3DPFA 2DDYA 3LJGA 2A8HA 1JK3A 1A86A 2MZEA 5I0LA 5D1UA 3P1VA 1D5JA 2O36A 3HY9A 4PKQA 3SHIA 3LUMA 4IN9A 2CKIA 4PKRA 1Y8JA 1KUKA 3HY7A 2POJA 1JAOA 1C3IA 3I7IA 2FV5A 1XFYA 2K9CA 3VI1A 3K7LA 1I76A 3KMCA 4AXQA 4WZVA 2YUFA 1UTZA 2JIHA 2QPJA 1MMRA 3EDGA 1ROSA 3P24A 2ERPA 2ERQA 2AIGP 2Z2DA 5I12A 3F16A 1C8TA 4H2EA 4DF9A 4I03A 4L19A 4HMAA 5L79A 3G42A 3KMEA 1GKDA 4XBHA 1XFWA 2L0RA 1IACA 3DL1A 1BIWA 2AYKA 3LGPA 1XFUA 3OHLA 1QJIA 3MA2A 1OM7A 2JNPA 3UVCA 1JANA 2OVXA 1C7KA 3LUNA 1G49A 4JPAA 4FVLA 1XURA 1EUBA 2SRTA 2XS4A 1CIZA 2EROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUC A;  3B2Z A;  1K7G A;  2USN A;  1QIB A;  3B8Z A;  1DTH A;  4AYK A;  1QIC A;  1CGE A;  1RM8 A;  3KEJ A;  2YB9 A;  1CXV A;  4DPE A;  3VTG A;  1BKC I;  3EDI A;  3EWJ A;  5D1T A;  3TSK A;  1ZP5 A;  5JMY A;  1GO7 P;  830C A;  1XFZ A;  1B8Y A;  5BOT A;  2N8R A;  2OW2 A;  1XFV A;  1KAP P;  3DSL A;  3WV2 A;  2DDF A;  4L6T A;  2Y6C A;  5CUH A;  4J4M A;  1R1H A;  5BPA A;  1CK7 A;  2X3C A;  3DNG A;  1CGF A;  3F19 A;  1OM8 A;  3HBV P;  1XUD A;  3O2X A;  5D2B A;  3L0T A;  3HB2 P;  2JSD A;  3RTS A;  3N2V A;  1MNC A;  4IJO A;  3V96 B;  2E2D A;  1H71 P;  4JP4 A;  1JAP A;  1Y0V A;  1R55 A;  4GUY A;  2K2G A;  4A7B A;  2Y6D A;  1WNI A;  1UEA A;  1QJJ A;  4FXQ A;  3LQB A;  3GBO A;  4H1Q A;  4JA1 A;  1KBC A;  1BKC A;  1YP1 A;  4XM7 A;  3E8R A;  3EHX A;  5I43 A;  1D8M A;  5I2Z A;  1GE5 A;  1G05 A;  3RTT A;  4CTH A;  1JIZ A;  1PWP A;  2V4B A;  4HX3 A;  1BM6 A;  1O0T A;  2RJP A;  1XFX A;  1AF0 A;  1SAT A;  1UTT A;  3LEA A;  2W15 A;  456C A;  1ZXV A;  4H84 A;  4H49 A;  1HFS A;  4EFS A;  1J7N A;  3AIG A;  2WO9 A;  1DMT A;  2W0D A;  4H82 A;  5LAB A;  1AST A;  2I47 A;  4GF1 A;  1RMZ A;  1KUF A;  3N2U A;  3ZXH A;  4PKT A;  1Z3J A;  1QIA A;  2OY4 A;  1S4B P;  1IAA A;  1G4K A;  1MMB A;  1I1I P;  2XS3 A;  3USN A;  3LIL A;  1ZS0 A;  3KEC A;  1HV5 A;  5I4O A;  3WV3 A;  2MLS A;  966C A;  2DW0 A;  1IAB A;  3AYU A;  1CAQ A;  1I73 A;  2E3X A;  1GE7 A;  2D1O A;  1JAQ A;  4ON1 A;  5D1S A;  1K7Q A;  1OMJ A;  3EHY A;  1OO9 A;  2OXZ A;  1G9K A;  1Q3A A;  3WV1 A;  3F1A A;  2W14 A;  3LIK A;  3EDH A;  2W12 A;  2MZH A;  2JT6 A;  4Q1L A;  4G0D A;  2OW1 A;  1FBL A;  1K7I A;  2WO8 A;  4JIJ A;  1ND1 A;  3LMC A;  1SRP A;  4XM6 A;  2OI0 A;  2PJT A;  1GKC A;  3OHO A;  4WKE A;  3ZUK A;  1L6J A;  1MMQ A;  2D1N A;  1OS2 A;  2X7M A;  3KEK A;  5H8X A;  1BQO A;  4XCT A;  2OVZ A;  3G5C A;  4R3V A;  5D3C A;  1JKY A;  3L0V A;  1JIW P;  3LKA A;  4PKU A;  3LJT A;  1USN A;  4L63 A;  1KUI A;  4GQL A;  1AYK A;  4GR8 A;  1KUH A;  1OS9 A;  1GO8 P;  4FU4 A;  2FV9 A;  1HTD A;  3DPE A;  4GWN A;  5L7F A;  2OW9 A;  1IAE A;  1GE6 A;  1R54 A;  1JH1 A;  4WK7 A;  2O3E A;  4JQG A;  5B5P A;  3Q2H A;  3O64 A;  3LK8 A;  4GR3 A;  1FLS A;  1UMS A;  3DWB A;  1PWW A;  3BA0 A;  1GXD A;  1MMP A;  1ZTQ A;  2OZR A;  4PKW A;  3K7N A;  4XM8 A;  2WOA A;  3I7G A;  3AYK A;  3F17 A;  2MLR A;  1BUD A;  1IAD A;  3KHI A;  2DW2 A;  3ZVS A;  4H3X A;  4H76 A;  1PWV A;  2RJQ A;  4ZR5 A;  1SLM A;  4GWM A;  4QKZ A;  1B3D A;  4WKI A;  4AIG A;  2J0T A;  3F18 A;  4A3W A;  1UMT A;  1CQR A;  1IAG A;  1A85 A;  1JJ9 A;  5CZM A;  4PKV A;  1FM1 A;  1YCM A;  5BOY A;  2OY2 A;  1BUV M;  1YQY A;  1QUA A;  1SU3 A;  4I35 A;  2CLT A;  1YOU A;  1PWQ A;  2TCL A;  2JT5 A;  1BSW A;  1Y93 A;  4G9L A;  3LIR A;  1OM6 A;  1SMP A;  3F15 A;  1R1J A;  4PKS A;  3HDA P;  2X3B A;  1ZVX A;  2HU6 A;  5D7W A;  1R1I A;  4WF6 A;  1BZS A;  5B5O A;  3NX7 A;  4ILW D;  1O0Q A;  1G12 A;  3TVC A;  4DD8 A;  3HDB A;  4FXY P;  4IUW A;  3U1R A;  2OXU A;  2DW1 A;  3HYG A;  1ATL A;  2YIG A;  1ZXC A;  4AUO A;  3TT4 A;  2OXW A;  2X3A A;  2MZI A;  4H30 A;  3KWV C;  1AKL A;  1SLN A;  1HFC A;  1HOV A;  3EDZ A;  1D7X A;  1BKC E;  3Q2G A;  2W13 A;  1BQQ M;  1PWU A;  5CXA A;  1EAK A;  5I3M A;  4GR0 A;  3B92 A;  1D8F A;  3CKI A;  3LJZ A;  1CGL A;  3HBU P;  2KRJ A;  3ELM A;  4DV8 A;  2J83 A;  3LE9 A;  1EB6 A;  3TS4 A;  1HY7 A;  3LQ0 A;  2OW0 A;  1KUG A;  3KRY A;  3DPF A;  2DDY A;  3LJG A;  2A8H A;  1JK3 A;  1A86 A;  2MZE A;  5I0L A;  5D1U A;  3P1V A;  1D5J A;  2O36 A;  3HY9 A;  4PKQ A;  3SHI A;  3LUM A;  4IN9 A;  2CKI A;  4PKR A;  1Y8J A;  1KUK A;  3HY7 A;  2POJ A;  1JAO A;  1C3I A;  3I7I A;  2FV5 A;  1XFY A;  2K9C A;  3VI1 A;  3K7L A;  1I76 A;  3KMC A;  4AXQ A;  4WZV A;  1UTZ A;  2JIH A;  2QPJ A;  1MMR A;  3EDG A;  1ROS A;  3P24 A;  2ERP A;  2ERQ A;  2AIG P;  2Z2D A;  5I12 A;  3F16 A;  1C8T A;  4H2E A;  4DF9 A;  4I03 A;  4L19 A;  4HMA A;  5L79 A;  3G42 A;  3KME A;  1GKD A;  4XBH A;  1XFW A;  2L0R A;  1IAC A;  3DL1 A;  1BIW A;  2AYK A;  3LGP A;  1XFU A;  3OHL A;  1QJI A;  3MA2 A;  1OM7 A;  2JNP A;  3UVC A;  1JAN A;  2OVX A;  1C7K A;  3LUN A;  1G49 A;  4JPA A;  4FVL A;  1XUR A;  1EUB A;  2SRT A;  2XS4 A;  1CIZ A;  2ERO A; 
#chains in the Genus database with same CATH topology
 1XUC A;  3B2Z A;  1K7G A;  2USN A;  1QIB A;  3B8Z A;  1DTH A;  4AYK A;  1QIC A;  1CGE A;  1RM8 A;  3KEJ A;  2YB9 A;  1CXV A;  4DPE A;  3VTG A;  1BKC I;  3EDI A;  3EWJ A;  5D1T A;  3TSK A;  1ZP5 A;  5JMY A;  1GO7 P;  830C A;  1XFZ A;  1B8Y A;  5BOT A;  2N8R A;  2OW2 A;  1XFV A;  1KAP P;  3DSL A;  3WV2 A;  2DDF A;  4L6T A;  2Y6C A;  5CUH A;  4J4M A;  1R1H A;  5BPA A;  1CK7 A;  2X3C A;  3DNG A;  1CGF A;  3F19 A;  1OM8 A;  3HBV P;  1XUD A;  3O2X A;  5D2B A;  3L0T A;  3HB2 P;  2JSD A;  3RTS A;  3N2V A;  1MNC A;  4IJO A;  3V96 B;  2E2D A;  1H71 P;  4JP4 A;  1JAP A;  1Y0V A;  1R55 A;  4GUY A;  2K2G A;  4A7B A;  2Y6D A;  1WNI A;  1UEA A;  1QJJ A;  4FXQ A;  3LQB A;  3GBO A;  4H1Q A;  4JA1 A;  1KBC A;  1BKC A;  1YP1 A;  4XM7 A;  3E8R A;  3EHX A;  5I43 A;  1D8M A;  5I2Z A;  1GE5 A;  1G05 A;  3RTT A;  4CTH A;  1JIZ A;  1PWP A;  2V4B A;  4HX3 A;  1BM6 A;  1O0T A;  2RJP A;  1XFX A;  1AF0 A;  1SAT A;  1UTT A;  3LEA A;  2W15 A;  456C A;  1ZXV A;  4H84 A;  4H49 A;  1HFS A;  4EFS A;  1J7N A;  3AIG A;  2WO9 A;  1DMT A;  2W0D A;  4H82 A;  5LAB A;  1OZ9 A;  3DTK A;  1AST A;  2I47 A;  3DTE A;  1TVI A;  4GF1 A;  1RMZ A;  1KUF A;  3N2U A;  3ZXH A;  4PKT A;  1Z3J A;  1QIA A;  2OY4 A;  1S4B P;  1IAA A;  1G4K A;  1MMB A;  1I1I P;  2XS3 A;  3USN A;  3LIL A;  1ZS0 A;  3KEC A;  1HV5 A;  5I4O A;  3WV3 A;  2MLS A;  966C A;  2DW0 A;  1IAB A;  3AYU A;  1CAQ A;  1I73 A;  2E3X A;  1GE7 A;  2D1O A;  1JAQ A;  4ON1 A;  5D1S A;  1K7Q A;  1OMJ A;  3EHY A;  1OO9 A;  2OXZ A;  1G9K A;  1Q3A A;  3WV1 A;  3F1A A;  2W14 A;  3LIK A;  3EDH A;  2W12 A;  2MZH A;  2JT6 A;  4Q1L A;  4G0D A;  2OW1 A;  4L7A A;  1FBL A;  1K7I A;  2WO8 A;  4JIJ A;  1ND1 A;  3LMC A;  1SRP A;  4XM6 A;  2OI0 A;  2PJT A;  1GKC A;  3OHO A;  4WKE A;  3ZUK A;  1L6J A;  1MMQ A;  2D1N A;  1OS2 A;  2X7M A;  3KEK A;  5H8X A;  1BQO A;  4XCT A;  2OVZ A;  3G5C A;  4R3V A;  5D3C A;  1JKY A;  3L0V A;  1JIW P;  3LKA A;  1XAX A;  4PKU A;  3LJT A;  1USN A;  4L63 A;  1KUI A;  4GQL A;  1AYK A;  4GR8 A;  1KUH A;  1OS9 A;  1GO8 P;  4FU4 A;  2FV9 A;  1HTD A;  3DPE A;  4GWN A;  5L7F A;  2OW9 A;  1IAE A;  1GE6 A;  1R54 A;  1JH1 A;  4WK7 A;  2O3E A;  4JQG A;  5B5P A;  3Q2H A;  3O64 A;  3LK8 A;  4GR3 A;  1FLS A;  1UMS A;  3DWB A;  1PWW A;  3BA0 A;  1GXD A;  1MMP A;  1ZTQ A;  2OZR A;  4PKW A;  3K7N A;  4XM8 A;  2WOA A;  3I7G A;  3AYK A;  3F17 A;  2MLR A;  1BUD A;  1IAD A;  3KHI A;  2DW2 A;  3ZVS A;  4H3X A;  4H76 A;  1PWV A;  2RJQ A;  4ZR5 A;  1SLM A;  4GWM A;  4QKZ A;  1B3D A;  4WKI A;  4AIG A;  2J0T A;  3F18 A;  4A3W A;  1UMT A;  1CQR A;  1IAG A;  1A85 A;  1JJ9 A;  5CZM A;  4PKV A;  1FM1 A;  1YCM A;  5BOY A;  2OY2 A;  1BUV M;  1YQY A;  1QUA A;  1SU3 A;  4I35 A;  2CLT A;  1YOU A;  1PWQ A;  2TCL A;  2JT5 A;  1BSW A;  1Y93 A;  4G9L A;  3LIR A;  1OM6 A;  1SMP A;  3F15 A;  1R1J A;  4PKS A;  3HDA P;  2X3B A;  1ZVX A;  2HU6 A;  5D7W A;  1R1I A;  4WF6 A;  1BZS A;  5B5O A;  3NX7 A;  4ILW D;  1O0Q A;  1G12 A;  3TVC A;  4DD8 A;  3HDB A;  4FXY P;  4IUW A;  3U1R A;  2OXU A;  2DW1 A;  3HYG A;  1ATL A;  2YIG A;  1ZXC A;  4AUO A;  3TT4 A;  2OXW A;  2X3A A;  2MZI A;  4H30 A;  3KWV C;  1AKL A;  1SLN A;  1HFC A;  1HOV A;  3EDZ A;  1D7X A;  1BKC E;  3Q2G A;  2W13 A;  1BQQ M;  1PWU A;  5CXA A;  1EAK A;  5I3M A;  4GR0 A;  3B92 A;  3DTI A;  1D8F A;  3CKI A;  3LJZ A;  1CGL A;  3HBU P;  1XM5 A;  2KRJ A;  3ELM A;  4DV8 A;  2J83 A;  3LE9 A;  1EB6 A;  3TS4 A;  1HY7 A;  3LQ0 A;  2OW0 A;  1KUG A;  3KRY A;  3DPF A;  2DDY A;  3LJG A;  2A8H A;  1JK3 A;  1A86 A;  2MZE A;  5I0L A;  5D1U A;  3P1V A;  1D5J A;  2O36 A;  3HY9 A;  4PKQ A;  3SHI A;  3LUM A;  4IN9 A;  2CKI A;  4PKR A;  1Y8J A;  1KUK A;  3HY7 A;  2POJ A;  1JAO A;  1C3I A;  3I7I A;  2FV5 A;  1XFY A;  2K9C A;  3VI1 A;  3K7L A;  1I76 A;  3KMC A;  4AXQ A;  4WZV A;  2YUF A;  1UTZ A;  2JIH A;  2QPJ A;  1MMR A;  3EDG A;  1ROS A;  3P24 A;  2ERP A;  2ERQ A;  2AIG P;  2Z2D A;  5I12 A;  3F16 A;  1C8T A;  4H2E A;  4DF9 A;  4I03 A;  4L19 A;  4HMA A;  5L79 A;  3G42 A;  3KME A;  1GKD A;  4XBH A;  1XFW A;  2L0R A;  1IAC A;  3DL1 A;  1BIW A;  2AYK A;  3LGP A;  1XFU A;  3OHL A;  1QJI A;  3MA2 A;  1OM7 A;  2JNP A;  3UVC A;  1JAN A;  2OVX A;  1C7K A;  3LUN A;  1G49 A;  4JPA A;  4FVL A;  1XUR A;  1EUB A;  2SRT A;  2XS4 A;  1CIZ A;  2ERO A; 
#chains in the Genus database with same CATH homology
 1XUC A;  3B2Z A;  1K7G A;  2USN A;  1QIB A;  3B8Z A;  1DTH A;  4AYK A;  1QIC A;  1CGE A;  1RM8 A;  3KEJ A;  2YB9 A;  1CXV A;  4DPE A;  3VTG A;  1BKC I;  3EDI A;  3EWJ A;  5D1T A;  3TSK A;  1ZP5 A;  5JMY A;  1GO7 P;  830C A;  1XFZ A;  1B8Y A;  5BOT A;  2N8R A;  2OW2 A;  1XFV A;  1KAP P;  3DSL A;  3WV2 A;  2DDF A;  4L6T A;  2Y6C A;  5CUH A;  4J4M A;  1R1H A;  5BPA A;  1CK7 A;  2X3C A;  3DNG A;  1CGF A;  3F19 A;  1OM8 A;  3HBV P;  1XUD A;  3O2X A;  5D2B A;  3L0T A;  3HB2 P;  2JSD A;  3RTS A;  3N2V A;  1MNC A;  4IJO A;  3V96 B;  2E2D A;  1H71 P;  4JP4 A;  1JAP A;  1Y0V A;  1R55 A;  4GUY A;  2K2G A;  4A7B A;  2Y6D A;  1WNI A;  1UEA A;  1QJJ A;  4FXQ A;  3LQB A;  3GBO A;  4H1Q A;  4JA1 A;  1KBC A;  1BKC A;  1YP1 A;  4XM7 A;  3E8R A;  3EHX A;  5I43 A;  1D8M A;  5I2Z A;  1GE5 A;  1G05 A;  3RTT A;  4CTH A;  1JIZ A;  1PWP A;  2V4B A;  4HX3 A;  1BM6 A;  1O0T A;  2RJP A;  1XFX A;  1AF0 A;  1SAT A;  1UTT A;  3LEA A;  2W15 A;  456C A;  1ZXV A;  4H84 A;  4H49 A;  1HFS A;  4EFS A;  1J7N A;  3AIG A;  2WO9 A;  1DMT A;  2W0D A;  4H82 A;  5LAB A;  3DTK A;  1AST A;  2I47 A;  3DTE A;  4GF1 A;  1RMZ A;  1KUF A;  3N2U A;  3ZXH A;  4PKT A;  1Z3J A;  1QIA A;  2OY4 A;  1S4B P;  1IAA A;  1G4K A;  1MMB A;  1I1I P;  2XS3 A;  3USN A;  3LIL A;  1ZS0 A;  3KEC A;  1HV5 A;  5I4O A;  3WV3 A;  2MLS A;  966C A;  2DW0 A;  1IAB A;  3AYU A;  1CAQ A;  1I73 A;  2E3X A;  1GE7 A;  2D1O A;  1JAQ A;  4ON1 A;  5D1S A;  1K7Q A;  1OMJ A;  3EHY A;  1OO9 A;  2OXZ A;  1G9K A;  1Q3A A;  3WV1 A;  3F1A A;  2W14 A;  3LIK A;  3EDH A;  2W12 A;  2MZH A;  2JT6 A;  4Q1L A;  4G0D A;  2OW1 A;  4L7A A;  1FBL A;  1K7I A;  2WO8 A;  4JIJ A;  1ND1 A;  3LMC A;  1SRP A;  4XM6 A;  2OI0 A;  2PJT A;  1GKC A;  3OHO A;  4WKE A;  3ZUK A;  1L6J A;  1MMQ A;  2D1N A;  1OS2 A;  2X7M A;  3KEK A;  5H8X A;  1BQO A;  4XCT A;  2OVZ A;  3G5C A;  4R3V A;  5D3C A;  1JKY A;  3L0V A;  1JIW P;  3LKA A;  4PKU A;  3LJT A;  1USN A;  4L63 A;  1KUI A;  4GQL A;  1AYK A;  4GR8 A;  1KUH A;  1OS9 A;  1GO8 P;  4FU4 A;  2FV9 A;  1HTD A;  3DPE A;  4GWN A;  5L7F A;  2OW9 A;  1IAE A;  1GE6 A;  1R54 A;  1JH1 A;  4WK7 A;  2O3E A;  4JQG A;  5B5P A;  3Q2H A;  3O64 A;  3LK8 A;  4GR3 A;  1FLS A;  1UMS A;  3DWB A;  1PWW A;  3BA0 A;  1GXD A;  1MMP A;  1ZTQ A;  2OZR A;  4PKW A;  3K7N A;  4XM8 A;  2WOA A;  3I7G A;  3AYK A;  3F17 A;  2MLR A;  1BUD A;  1IAD A;  3KHI A;  2DW2 A;  3ZVS A;  4H3X A;  4H76 A;  1PWV A;  2RJQ A;  4ZR5 A;  1SLM A;  4GWM A;  4QKZ A;  1B3D A;  4WKI A;  4AIG A;  2J0T A;  3F18 A;  4A3W A;  1UMT A;  1CQR A;  1IAG A;  1A85 A;  1JJ9 A;  5CZM A;  4PKV A;  1FM1 A;  1YCM A;  5BOY A;  2OY2 A;  1BUV M;  1YQY A;  1QUA A;  1SU3 A;  4I35 A;  2CLT A;  1YOU A;  1PWQ A;  2TCL A;  2JT5 A;  1BSW A;  1Y93 A;  4G9L A;  3LIR A;  1OM6 A;  1SMP A;  3F15 A;  1R1J A;  4PKS A;  3HDA P;  2X3B A;  1ZVX A;  2HU6 A;  5D7W A;  1R1I A;  4WF6 A;  1BZS A;  5B5O A;  3NX7 A;  4ILW D;  1O0Q A;  1G12 A;  3TVC A;  4DD8 A;  3HDB A;  4FXY P;  4IUW A;  3U1R A;  2OXU A;  2DW1 A;  3HYG A;  1ATL A;  2YIG A;  1ZXC A;  4AUO A;  3TT4 A;  2OXW A;  2X3A A;  2MZI A;  4H30 A;  3KWV C;  1AKL A;  1SLN A;  1HFC A;  1HOV A;  3EDZ A;  1D7X A;  1BKC E;  3Q2G A;  2W13 A;  1BQQ M;  1PWU A;  5CXA A;  1EAK A;  5I3M A;  4GR0 A;  3B92 A;  3DTI A;  1D8F A;  3CKI A;  3LJZ A;  1CGL A;  3HBU P;  2KRJ A;  3ELM A;  4DV8 A;  2J83 A;  3LE9 A;  1EB6 A;  3TS4 A;  1HY7 A;  3LQ0 A;  2OW0 A;  1KUG A;  3KRY A;  3DPF A;  2DDY A;  3LJG A;  2A8H A;  1JK3 A;  1A86 A;  2MZE A;  5I0L A;  5D1U A;  3P1V A;  1D5J A;  2O36 A;  3HY9 A;  4PKQ A;  3SHI A;  3LUM A;  4IN9 A;  2CKI A;  4PKR A;  1Y8J A;  1KUK A;  3HY7 A;  2POJ A;  1JAO A;  1C3I A;  3I7I A;  2FV5 A;  1XFY A;  2K9C A;  3VI1 A;  3K7L A;  1I76 A;  3KMC A;  4AXQ A;  4WZV A;  2YUF A;  1UTZ A;  2JIH A;  2QPJ A;  1MMR A;  3EDG A;  1ROS A;  3P24 A;  2ERP A;  2ERQ A;  2AIG P;  2Z2D A;  5I12 A;  3F16 A;  1C8T A;  4H2E A;  4DF9 A;  4I03 A;  4L19 A;  4HMA A;  5L79 A;  3G42 A;  3KME A;  1GKD A;  4XBH A;  1XFW A;  2L0R A;  1IAC A;  3DL1 A;  1BIW A;  2AYK A;  3LGP A;  1XFU A;  3OHL A;  1QJI A;  3MA2 A;  1OM7 A;  2JNP A;  3UVC A;  1JAN A;  2OVX A;  1C7K A;  3LUN A;  1G49 A;  4JPA A;  4FVL A;  1XUR A;  1EUB A;  2SRT A;  2XS4 A;  1CIZ A;  2ERO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...