1JAPA

Complex of pro-leu-gly-hydroxylamine with the catalytic domain of matrix metallo proteinase-8 (met80 form)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
PKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (metalloprotease/inhibitor)
molecule keywords MATRIX METALLO PROTEINASE-8 (MET80 FORM)
publication title The X-ray crystal structure of the catalytic domain of human neutrophil collagenase inhibited by a substrate analogue reveals the essentials for catalysis and specificity.
pubmed rcsb
source organism Homo sapiens
total genus 48
structure length 157
sequence length 157
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1996-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1japA00
2I47A 1I76A 4I35A 3AYUA 3KEKA 1UEAA 5B5PA 4H1QA 1OS9A 1PWPA 5D1TA 2QPJA 4DF9A 3DWBA 3O2XA 3LUMA 3P24A 3HB2P 2FV9A 3AIGA 4FVLA 1UMSA 4FXQA 1BQOA 3KHIA 5I12A 2K9CA 1Y93A 1G4KA 4PKTA 1FLSA 3RTTA 1BQQM 1CIZA 3AYKA 4XM6A 4PKUA 2Z2DA 2X3AA 3OHOA 3DL1A 3TT4A 1MMQA 2OXZA 1CGLA 3OHLA 2EROA 2Y6DA 4PKWA 4GWNA 3LEAA 1QIBA 4L63A 1O0TA 1FBLA 4FU4A 4H30A 4H49A 4DPEA 2O3EA 3Q2GA 1R1IA 4GR8A 1AYKA 4AUOA 1AF0A 4JP4A 1CK7A 4GR0A 2RJPA 2OW1A 3HDAP 2POJA 3ZXHA 3HBUP 5D2BA 3F15A 4G9LA 4G0DA 4AXQA 1G12A 2SRTA 3EHYA 2OY4A 4GWMA 1XURA 3G5CA 3EDIA 1G49A 1KUIA 3LGPA 4DD8A 1IAEA 1YOUA 2MZEA 5D1SA 4H3XA 3LQ0A 2CLTA 1CGFA 1GE6A 5B5OA 1GE7A 966CA 3HY7A 4PKRA 1ASTA 4A3WA 1Y0VA 1IAGA 3LJGA 3V96B 3ZUKA 2DDYA 5H8XA 2J83A 4L19A 4ZR5A 2W15A 1ZXCA 3F18A 1OO9A 3DSLA 1EB6A 1JK3A 3B92A 1AKLA 1BUVM 3WV2A 3KECA 4GQLA 1JIWP 2L0RA 4PKSA 1IADA 1IABA 1ATLA 1B8YA 4GUYA 1YQYA 1JJ9A 1EAKA 4H82A 1XFYA 1BUDA 4WKIA 4WF6A 1R1JA 2E3XA 1KUGA 2XS3A 1HOVA 2K2GA 5D7WA 2RJQA 1JAOA 1SRPA 3F1AA 2WO9A 2CKIA 4ILWD 3USNA 2DW0A 3HBVP 3KEJA 1HFSA 1G05A 1KUFA 1BKCA 1I73A 1QICA 3F19A 1ZTQA 2WOAA 1GKCA 3DPFA 3DNGA 5I4OA 5LABA 1PWVA 3MA2A 1IAAA 4XCTA 1I1IP 3TVCA 2OW2A 3K7LA 1MNCA 1JAPA 3EDHA 1MMRA 5I2ZA 2N8RA 2OXUA 4HX3A 5I3MA 1OMJA 4XBHA 3L0VA 4H84A 5CZMA 2JSDA 3F16A 1QUAA 3P1VA 1K7GA 456CA 5BOTA 3G42A 4EFSA 1B3DA 1ZP5A 2MZIA 5I43A 3WV1A 4CTHA 1UTZA 1RM8A 2OVXA 4AYKA 1PWWA 1Y8JA 1D8MA 2A8HA 1GKDA 1H71P 4A7BA 4L6TA 3N2VA 2MLRA 3LKAA 1JAQA 1SMPA 1JIZA 4AIGA 1GO7P 1GO8P 4FXYP 1R1HA 4IUWA 2HU6A 1O0QA 1YCMA 3E8RA 1KAPP 4QKZA 1MMPA 1JKYA 2W12A 1SLNA 3O64A 1RMZA 1BKCI 1QIAA 1XFXA 3CKIA 1BSWA 2OI0A 1OS2A 2MZHA 3K7NA 2KRJA 1USNA 3VTGA 3TS4A 3SHIA 1XUDA 2D1NA 2W14A 1IACA 3B8ZA 3GBOA 3LK8A 5BPAA 4I03A 1C8TA 830CA 1R54A 2X3BA 1ZXVA 2D1OA 1CAQA 1CQRA 2TCLA 1ROSA 1OM7A 2JNPA 1ZVXA 1HFCA 1D7XA 2O36A 2YB9A 4J4MA 2X3CA 3ZVSA 2AYKA 3RTSA 1S4BP 1SU3A 3DPEA 1HTDA 3B2ZA 4JQGA 3Q2HA 4R3VA 5L79A 3U1RA 1XFZA 2WO8A 1J7NA 1Z3JA 1HV5A 3UVCA 1UMTA 3LJZA 5CXAA 4JA1A 2ERQA 4Q1LA 4XM7A 2JT5A 5BOYA 5CUHA 2MLSA 3N2UA 1SATA 2X7MA 2E2DA 1PWQA 4JIJA 4WZVA 2JT6A 3HYGA 2YIGA 1QJJA 3KMEA 3TSKA 4IJOA 2OVZA 3EWJA 3LIRA 4H2EA 1BZSA 1SLMA 1GE5A 4PKVA 2OW0A 1HY7A 1BM6A 1D5JA 1G9KA 4GF1A 1D8FA 1ZS0A 3EHXA 4XM8A 3LUNA 2ERPA 3KMCA 1C7KA 1CGEA 2DDFA 3BA0A 1ND1A 3LMCA 2V4BA 5I0LA 2OZRA 1L6JA 2XS4A 1MMBA 1GXDA 1UTTA 2W0DA 4WK7A 1A85A 4GR3A 1BIWA 1K7QA 1OM6A 1QJIA 3VI1A 4WKEA 1YP1A 1EUBA 1JANA 2DW2A 4ON1A 1JH1A 1DTHA 2J0TA 1DMTA 4PKQA 3LE9A 4JPAA 4DV8A 1XFUA 3HY9A 1Q3AA 3EDZA 3KWVC 1R55A 2FV5A 1CXVA 1WNIA 2OXWA 1K7IA 1XFVA 3LQBA 3LJTA 1PWUA 1XFWA 5D1UA 2Y6CA 1BKCE 3F17A 1OM8A 1A86A 3NX7A 1FM1A 3WV3A 2W13A 5D3CA 2OY2A 4IN9A 1KUHA 4H76A 5L7FA 1KUKA 1XUCA 4HMAA 3KRYA 3ELMA 2JIHA 2DW1A 1C3IA 3LILA 3L0TA 2USNA 3HDBA 1KBCA 5JMYA 2AIGP 3I7IA 2OW9A 3LIKA 3EDGA 2PJTA 3I7GA
chains in the Genus database with same CATH superfamily
2I47A 1I76A 4I35A 3AYUA 3KEKA 3DTIA 1UEAA 5B5PA 4H1QA 1OS9A 1PWPA 5D1TA 2QPJA 4DF9A 3DWBA 3O2XA 3LUMA 3P24A 3HB2P 2FV9A 3AIGA 4FVLA 1UMSA 4FXQA 1BQOA 3KHIA 5I12A 2K9CA 1Y93A 1G4KA 4PKTA 1FLSA 3RTTA 1BQQM 1CIZA 3AYKA 4XM6A 4PKUA 2Z2DA 2X3AA 3OHOA 3DL1A 3TT4A 1MMQA 2OXZA 1CGLA 3OHLA 2EROA 2Y6DA 4PKWA 4GWNA 3LEAA 1QIBA 4L63A 1O0TA 1FBLA 4FU4A 4H30A 4H49A 4DPEA 2O3EA 3DTKA 3Q2GA 1R1IA 4GR8A 1AYKA 4AUOA 1AF0A 4JP4A 1CK7A 4GR0A 2RJPA 2OW1A 3HDAP 2POJA 3ZXHA 3HBUP 5D2BA 3F15A 4G9LA 4G0DA 4AXQA 1G12A 2SRTA 3EHYA 2OY4A 4GWMA 1XURA 3G5CA 3EDIA 1G49A 1KUIA 3LGPA 4DD8A 1IAEA 1YOUA 2MZEA 5D1SA 4H3XA 3LQ0A 2CLTA 1CGFA 1GE6A 5B5OA 1GE7A 966CA 3HY7A 4PKRA 1XM5A 1ASTA 4A3WA 1Y0VA 1IAGA 3LJGA 3V96B 3ZUKA 2DDYA 5H8XA 2J83A 4L19A 4ZR5A 2W15A 1ZXCA 3F18A 1OO9A 3DSLA 1EB6A 1JK3A 3B92A 1AKLA 1BUVM 3WV2A 3KECA 4GQLA 1JIWP 2L0RA 4PKSA 1IADA 1IABA 1ATLA 1B8YA 4GUYA 1YQYA 1JJ9A 1EAKA 4H82A 1XFYA 1BUDA 4WKIA 4WF6A 1R1JA 1OZ9A 2E3XA 1KUGA 2XS3A 1HOVA 2K2GA 5D7WA 2RJQA 1JAOA 1SRPA 3F1AA 2WO9A 2CKIA 4ILWD 3USNA 2DW0A 3HBVP 3KEJA 1HFSA 1G05A 1KUFA 1BKCA 1I73A 1QICA 3F19A 1ZTQA 2WOAA 1GKCA 3DPFA 3DNGA 5I4OA 5LABA 1PWVA 3MA2A 1IAAA 4XCTA 1I1IP 3TVCA 2OW2A 3K7LA 1MNCA 1JAPA 3EDHA 1MMRA 5I2ZA 2N8RA 2OXUA 4HX3A 5I3MA 1OMJA 4XBHA 3L0VA 4H84A 5CZMA 2JSDA 3DTEA 3F16A 1QUAA 3P1VA 1K7GA 456CA 5BOTA 3G42A 4EFSA 1B3DA 1ZP5A 2MZIA 5I43A 3WV1A 4CTHA 1UTZA 1RM8A 2OVXA 2YUFA 4AYKA 1PWWA 1Y8JA 1D8MA 2A8HA 1GKDA 1H71P 4A7BA 4L6TA 3N2VA 2MLRA 3LKAA 1JAQA 1SMPA 1JIZA 4AIGA 1GO7P 1GO8P 4FXYP 1R1HA 4IUWA 2HU6A 1O0QA 1YCMA 3E8RA 1KAPP 4QKZA 1MMPA 1JKYA 2W12A 1SLNA 3O64A 1RMZA 1BKCI 1QIAA 1XFXA 3CKIA 1BSWA 2OI0A 1OS2A 2MZHA 3K7NA 2KRJA 1USNA 3VTGA 3TS4A 3SHIA 1XUDA 2D1NA 2W14A 1IACA 3B8ZA 3GBOA 3LK8A 5BPAA 4I03A 1C8TA 830CA 1R54A 2X3BA 1ZXVA 2D1OA 1CAQA 1CQRA 2TCLA 1ROSA 1OM7A 2JNPA 1XAXA 1ZVXA 1HFCA 1D7XA 2O36A 2YB9A 4J4MA 2X3CA 3ZVSA 2AYKA 3RTSA 1S4BP 1SU3A 3DPEA 1HTDA 3B2ZA 4JQGA 3Q2HA 4R3VA 5L79A 3U1RA 1XFZA 2WO8A 1J7NA 1Z3JA 1HV5A 3UVCA 1UMTA 3LJZA 5CXAA 4JA1A 2ERQA 4Q1LA 4XM7A 2JT5A 5BOYA 5CUHA 2MLSA 3N2UA 1SATA 2X7MA 2E2DA 1PWQA 4JIJA 4WZVA 2JT6A 3HYGA 2YIGA 1QJJA 3KMEA 3TSKA 4IJOA 2OVZA 3EWJA 3LIRA 4H2EA 1BZSA 1SLMA 1GE5A 4PKVA 2OW0A 1HY7A 1BM6A 1D5JA 1G9KA 4GF1A 1D8FA 1ZS0A 3EHXA 4XM8A 3LUNA 2ERPA 3KMCA 1C7KA 1CGEA 2DDFA 3BA0A 1ND1A 3LMCA 2V4BA 5I0LA 2OZRA 1L6JA 2XS4A 1MMBA 1GXDA 1UTTA 2W0DA 4WK7A 1A85A 4GR3A 1BIWA 1K7QA 1OM6A 1QJIA 3VI1A 4WKEA 1YP1A 4L7AA 1EUBA 1JANA 2DW2A 4ON1A 1JH1A 1DTHA 2J0TA 1DMTA 4PKQA 3LE9A 4JPAA 4DV8A 1XFUA 3HY9A 1Q3AA 3EDZA 3KWVC 1R55A 2FV5A 1CXVA 1WNIA 2OXWA 1K7IA 1XFVA 3LQBA 3LJTA 1PWUA 1XFWA 5D1UA 2Y6CA 1BKCE 3F17A 1OM8A 1A86A 3NX7A 1FM1A 3WV3A 2W13A 5D3CA 2OY2A 4IN9A 1KUHA 4H76A 5L7FA 1KUKA 1XUCA 1TVIA 4HMAA 3KRYA 3ELMA 2JIHA 2DW1A 1C3IA 3LILA 3L0TA 2USNA 3HDBA 1KBCA 5JMYA 2AIGP 3I7IA 2OW9A 3LIKA 3EDGA 2PJTA 3I7GA
chains in the Genus database with same CATH topology
2I47A 1I76A 4I35A 3AYUA 3KEKA 3DTIA 1UEAA 5B5PA 4H1QA 1OS9A 1PWPA 5D1TA 2QPJA 4DF9A 3DWBA 3O2XA 3LUMA 3P24A 3HB2P 2FV9A 3AIGA 4FVLA 1UMSA 4FXQA 1BQOA 3KHIA 5I12A 2K9CA 1Y93A 1G4KA 4PKTA 1FLSA 3RTTA 1BQQM 1CIZA 3AYKA 4XM6A 4PKUA 2Z2DA 2X3AA 3OHOA 3DL1A 3TT4A 1MMQA 2OXZA 1CGLA 3OHLA 2EROA 2Y6DA 4PKWA 4GWNA 3LEAA 1QIBA 4L63A 1O0TA 1FBLA 4FU4A 4H30A 4H49A 4DPEA 2O3EA 3DTKA 3Q2GA 1R1IA 4GR8A 1AYKA 4AUOA 1AF0A 4JP4A 1CK7A 4GR0A 2RJPA 2OW1A 3HDAP 2POJA 3ZXHA 3HBUP 5D2BA 3F15A 4G9LA 4G0DA 4AXQA 1G12A 2SRTA 3EHYA 2OY4A 4GWMA 1XURA 3G5CA 3EDIA 1G49A 1KUIA 3LGPA 4DD8A 1IAEA 1YOUA 2MZEA 5D1SA 4H3XA 3LQ0A 2CLTA 1CGFA 1GE6A 5B5OA 1GE7A 966CA 3HY7A 4PKRA 1ASTA 4A3WA 1Y0VA 1IAGA 3LJGA 3V96B 3ZUKA 2DDYA 5H8XA 2J83A 4L19A 4ZR5A 2W15A 1ZXCA 3F18A 1OO9A 3DSLA 1EB6A 1JK3A 3B92A 1AKLA 1BUVM 3WV2A 3KECA 4GQLA 1JIWP 2L0RA 4PKSA 1IADA 1IABA 1ATLA 1B8YA 4GUYA 1YQYA 1JJ9A 1EAKA 4H82A 1XFYA 1BUDA 4WKIA 4WF6A 1R1JA 2E3XA 1KUGA 2XS3A 1HOVA 2K2GA 5D7WA 2RJQA 1JAOA 1SRPA 3F1AA 2WO9A 2CKIA 4ILWD 3USNA 2DW0A 3HBVP 3KEJA 1HFSA 1G05A 1KUFA 1BKCA 1I73A 1QICA 3F19A 1ZTQA 2WOAA 1GKCA 3DPFA 3DNGA 5I4OA 5LABA 1PWVA 3MA2A 1IAAA 4XCTA 1I1IP 3TVCA 2OW2A 3K7LA 1MNCA 1JAPA 3EDHA 1MMRA 5I2ZA 2N8RA 2OXUA 4HX3A 5I3MA 1OMJA 4XBHA 3L0VA 4H84A 5CZMA 2JSDA 3DTEA 3F16A 1QUAA 3P1VA 1K7GA 456CA 5BOTA 3G42A 4EFSA 1B3DA 1ZP5A 2MZIA 5I43A 3WV1A 4CTHA 1UTZA 1RM8A 2OVXA 2YUFA 4AYKA 1PWWA 1Y8JA 1D8MA 2A8HA 1GKDA 1H71P 4A7BA 4L6TA 3N2VA 2MLRA 3LKAA 1JAQA 1SMPA 1JIZA 4AIGA 1GO7P 1GO8P 4FXYP 1R1HA 4IUWA 2HU6A 1O0QA 1YCMA 3E8RA 1KAPP 4QKZA 1MMPA 1JKYA 2W12A 1SLNA 3O64A 1RMZA 1BKCI 1QIAA 1XFXA 3CKIA 1BSWA 2OI0A 1OS2A 2MZHA 3K7NA 2KRJA 1USNA 3VTGA 3TS4A 3SHIA 1XUDA 2D1NA 2W14A 1IACA 3B8ZA 3GBOA 3LK8A 5BPAA 4I03A 1C8TA 830CA 1R54A 2X3BA 1ZXVA 2D1OA 1CAQA 1CQRA 2TCLA 1ROSA 1OM7A 2JNPA 1ZVXA 1HFCA 1D7XA 2O36A 2YB9A 4J4MA 2X3CA 3ZVSA 2AYKA 3RTSA 1S4BP 1SU3A 3DPEA 1HTDA 3B2ZA 4JQGA 3Q2HA 4R3VA 5L79A 3U1RA 1XFZA 2WO8A 1J7NA 1Z3JA 1HV5A 3UVCA 1UMTA 3LJZA 5CXAA 4JA1A 2ERQA 4Q1LA 4XM7A 2JT5A 5BOYA 5CUHA 2MLSA 3N2UA 1SATA 2X7MA 2E2DA 1PWQA 4JIJA 4WZVA 2JT6A 3HYGA 2YIGA 1QJJA 3KMEA 3TSKA 4IJOA 2OVZA 3EWJA 3LIRA 4H2EA 1BZSA 1SLMA 1GE5A 4PKVA 2OW0A 1HY7A 1BM6A 1D5JA 1G9KA 4GF1A 1D8FA 1ZS0A 3EHXA 4XM8A 3LUNA 2ERPA 3KMCA 1C7KA 1CGEA 2DDFA 3BA0A 1ND1A 3LMCA 2V4BA 5I0LA 2OZRA 1L6JA 2XS4A 1MMBA 1GXDA 1UTTA 2W0DA 4WK7A 1A85A 4GR3A 1BIWA 1K7QA 1OM6A 1QJIA 3VI1A 4WKEA 1YP1A 4L7AA 1EUBA 1JANA 2DW2A 4ON1A 1JH1A 1DTHA 2J0TA 1DMTA 4PKQA 3LE9A 4JPAA 4DV8A 1XFUA 3HY9A 1Q3AA 3EDZA 3KWVC 1R55A 2FV5A 1CXVA 1WNIA 2OXWA 1K7IA 1XFVA 3LQBA 3LJTA 1PWUA 1XFWA 5D1UA 2Y6CA 1BKCE 3F17A 1OM8A 1A86A 3NX7A 1FM1A 3WV3A 2W13A 5D3CA 2OY2A 4IN9A 1KUHA 4H76A 5L7FA 1KUKA 1XUCA 4HMAA 3KRYA 3ELMA 2JIHA 2DW1A 1C3IA 3LILA 3L0TA 2USNA 3HDBA 1KBCA 5JMYA 2AIGP 3I7IA 2OW9A 3LIKA 3EDGA 2PJTA 3I7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I47 A;  1I76 A;  4I35 A;  3AYU A;  3KEK A;  1UEA A;  5B5P A;  4H1Q A;  1OS9 A;  1PWP A;  5D1T A;  2QPJ A;  4DF9 A;  3DWB A;  3O2X A;  3LUM A;  3P24 A;  3HB2 P;  2FV9 A;  3AIG A;  4FVL A;  1UMS A;  4FXQ A;  1BQO A;  3KHI A;  5I12 A;  2K9C A;  1Y93 A;  1G4K A;  4PKT A;  1FLS A;  3RTT A;  1BQQ M;  1CIZ A;  3AYK A;  4XM6 A;  4PKU A;  2Z2D A;  2X3A A;  3OHO A;  3DL1 A;  3TT4 A;  1MMQ A;  2OXZ A;  1CGL A;  3OHL A;  2ERO A;  2Y6D A;  4PKW A;  4GWN A;  3LEA A;  1QIB A;  4L63 A;  1O0T A;  1FBL A;  4FU4 A;  4H30 A;  4H49 A;  4DPE A;  2O3E A;  3Q2G A;  1R1I A;  4GR8 A;  1AYK A;  4AUO A;  1AF0 A;  4JP4 A;  1CK7 A;  4GR0 A;  2RJP A;  2OW1 A;  3HDA P;  2POJ A;  3ZXH A;  3HBU P;  5D2B A;  3F15 A;  4G9L A;  4G0D A;  4AXQ A;  1G12 A;  2SRT A;  3EHY A;  2OY4 A;  4GWM A;  1XUR A;  3G5C A;  3EDI A;  1G49 A;  1KUI A;  3LGP A;  4DD8 A;  1IAE A;  1YOU A;  2MZE A;  5D1S A;  4H3X A;  3LQ0 A;  2CLT A;  1CGF A;  1GE6 A;  5B5O A;  1GE7 A;  966C A;  3HY7 A;  4PKR A;  1AST A;  4A3W A;  1Y0V A;  1IAG A;  3LJG A;  3V96 B;  3ZUK A;  2DDY A;  5H8X A;  2J83 A;  4L19 A;  4ZR5 A;  2W15 A;  1ZXC A;  3F18 A;  1OO9 A;  3DSL A;  1EB6 A;  1JK3 A;  3B92 A;  1AKL A;  1BUV M;  3WV2 A;  3KEC A;  4GQL A;  1JIW P;  2L0R A;  4PKS A;  1IAD A;  1IAB A;  1ATL A;  1B8Y A;  4GUY A;  1YQY A;  1JJ9 A;  1EAK A;  4H82 A;  1XFY A;  1BUD A;  4WKI A;  4WF6 A;  1R1J A;  2E3X A;  1KUG A;  2XS3 A;  1HOV A;  2K2G A;  5D7W A;  2RJQ A;  1JAO A;  1SRP A;  3F1A A;  2WO9 A;  2CKI A;  4ILW D;  3USN A;  2DW0 A;  3HBV P;  3KEJ A;  1HFS A;  1G05 A;  1KUF A;  1BKC A;  1I73 A;  1QIC A;  3F19 A;  1ZTQ A;  2WOA A;  1GKC A;  3DPF A;  3DNG A;  5I4O A;  5LAB A;  1PWV A;  3MA2 A;  1IAA A;  4XCT A;  1I1I P;  3TVC A;  2OW2 A;  3K7L A;  1MNC A;  1JAP A;  3EDH A;  1MMR A;  5I2Z A;  2N8R A;  2OXU A;  4HX3 A;  5I3M A;  1OMJ A;  4XBH A;  3L0V A;  4H84 A;  5CZM A;  2JSD A;  3F16 A;  1QUA A;  3P1V A;  1K7G A;  456C A;  5BOT A;  3G42 A;  4EFS A;  1B3D A;  1ZP5 A;  2MZI A;  5I43 A;  3WV1 A;  4CTH A;  1UTZ A;  1RM8 A;  2OVX A;  4AYK A;  1PWW A;  1Y8J A;  1D8M A;  2A8H A;  1GKD A;  1H71 P;  4A7B A;  4L6T A;  3N2V A;  2MLR A;  3LKA A;  1JAQ A;  1SMP A;  1JIZ A;  4AIG A;  1GO7 P;  1GO8 P;  4FXY P;  1R1H A;  4IUW A;  2HU6 A;  1O0Q A;  1YCM A;  3E8R A;  1KAP P;  4QKZ A;  1MMP A;  1JKY A;  2W12 A;  1SLN A;  3O64 A;  1RMZ A;  1BKC I;  1QIA A;  1XFX A;  3CKI A;  1BSW A;  2OI0 A;  1OS2 A;  2MZH A;  3K7N A;  2KRJ A;  1USN A;  3VTG A;  3TS4 A;  3SHI A;  1XUD A;  2D1N A;  2W14 A;  1IAC A;  3B8Z A;  3GBO A;  3LK8 A;  5BPA A;  4I03 A;  1C8T A;  830C A;  1R54 A;  2X3B A;  1ZXV A;  2D1O A;  1CAQ A;  1CQR A;  2TCL A;  1ROS A;  1OM7 A;  2JNP A;  1ZVX A;  1HFC A;  1D7X A;  2O36 A;  2YB9 A;  4J4M A;  2X3C A;  3ZVS A;  2AYK A;  3RTS A;  1S4B P;  1SU3 A;  3DPE A;  1HTD A;  3B2Z A;  4JQG A;  3Q2H A;  4R3V A;  5L79 A;  3U1R A;  1XFZ A;  2WO8 A;  1J7N A;  1Z3J A;  1HV5 A;  3UVC A;  1UMT A;  3LJZ A;  5CXA A;  4JA1 A;  2ERQ A;  4Q1L A;  4XM7 A;  2JT5 A;  5BOY A;  5CUH A;  2MLS A;  3N2U A;  1SAT A;  2X7M A;  2E2D A;  1PWQ A;  4JIJ A;  4WZV A;  2JT6 A;  3HYG A;  2YIG A;  1QJJ A;  3KME A;  3TSK A;  4IJO A;  2OVZ A;  3EWJ A;  3LIR A;  4H2E A;  1BZS A;  1SLM A;  1GE5 A;  4PKV A;  2OW0 A;  1HY7 A;  1BM6 A;  1D5J A;  1G9K A;  4GF1 A;  1D8F A;  1ZS0 A;  3EHX A;  4XM8 A;  3LUN A;  2ERP A;  3KMC A;  1C7K A;  1CGE A;  2DDF A;  3BA0 A;  1ND1 A;  3LMC A;  2V4B A;  5I0L A;  2OZR A;  1L6J A;  2XS4 A;  1MMB A;  1GXD A;  1UTT A;  2W0D A;  4WK7 A;  1A85 A;  4GR3 A;  1BIW A;  1K7Q A;  1OM6 A;  1QJI A;  3VI1 A;  4WKE A;  1YP1 A;  1EUB A;  1JAN A;  2DW2 A;  4ON1 A;  1JH1 A;  1DTH A;  2J0T A;  1DMT A;  4PKQ A;  3LE9 A;  4JPA A;  4DV8 A;  1XFU A;  3HY9 A;  1Q3A A;  3EDZ A;  3KWV C;  1R55 A;  2FV5 A;  1CXV A;  1WNI A;  2OXW A;  1K7I A;  1XFV A;  3LQB A;  3LJT A;  1PWU A;  1XFW A;  5D1U A;  2Y6C A;  1BKC E;  3F17 A;  1OM8 A;  1A86 A;  3NX7 A;  1FM1 A;  3WV3 A;  2W13 A;  5D3C A;  2OY2 A;  4IN9 A;  1KUH A;  4H76 A;  5L7F A;  1KUK A;  1XUC A;  4HMA A;  3KRY A;  3ELM A;  2JIH A;  2DW1 A;  1C3I A;  3LIL A;  3L0T A;  2USN A;  3HDB A;  1KBC A;  5JMY A;  2AIG P;  3I7I A;  2OW9 A;  3LIK A;  3EDG A;  2PJT A;  3I7G A; 
#chains in the Genus database with same CATH topology
 2I47 A;  1I76 A;  4I35 A;  3AYU A;  3KEK A;  3DTI A;  1UEA A;  5B5P A;  4H1Q A;  1OS9 A;  1PWP A;  5D1T A;  2QPJ A;  4DF9 A;  3DWB A;  3O2X A;  3LUM A;  3P24 A;  3HB2 P;  2FV9 A;  3AIG A;  4FVL A;  1UMS A;  4FXQ A;  1BQO A;  3KHI A;  5I12 A;  2K9C A;  1Y93 A;  1G4K A;  4PKT A;  1FLS A;  3RTT A;  1BQQ M;  1CIZ A;  3AYK A;  4XM6 A;  4PKU A;  2Z2D A;  2X3A A;  3OHO A;  3DL1 A;  3TT4 A;  1MMQ A;  2OXZ A;  1CGL A;  3OHL A;  2ERO A;  2Y6D A;  4PKW A;  4GWN A;  3LEA A;  1QIB A;  4L63 A;  1O0T A;  1FBL A;  4FU4 A;  4H30 A;  4H49 A;  4DPE A;  2O3E A;  3DTK A;  3Q2G A;  1R1I A;  4GR8 A;  1AYK A;  4AUO A;  1AF0 A;  4JP4 A;  1CK7 A;  4GR0 A;  2RJP A;  2OW1 A;  3HDA P;  2POJ A;  3ZXH A;  3HBU P;  5D2B A;  3F15 A;  4G9L A;  4G0D A;  4AXQ A;  1G12 A;  2SRT A;  3EHY A;  2OY4 A;  4GWM A;  1XUR A;  3G5C A;  3EDI A;  1G49 A;  1KUI A;  3LGP A;  4DD8 A;  1IAE A;  1YOU A;  2MZE A;  5D1S A;  4H3X A;  3LQ0 A;  2CLT A;  1CGF A;  1GE6 A;  5B5O A;  1GE7 A;  966C A;  3HY7 A;  4PKR A;  1XM5 A;  1AST A;  4A3W A;  1Y0V A;  1IAG A;  3LJG A;  3V96 B;  3ZUK A;  2DDY A;  5H8X A;  2J83 A;  4L19 A;  4ZR5 A;  2W15 A;  1ZXC A;  3F18 A;  1OO9 A;  3DSL A;  1EB6 A;  1JK3 A;  3B92 A;  1AKL A;  1BUV M;  3WV2 A;  3KEC A;  4GQL A;  1JIW P;  2L0R A;  4PKS A;  1IAD A;  1IAB A;  1ATL A;  1B8Y A;  4GUY A;  1YQY A;  1JJ9 A;  1EAK A;  4H82 A;  1XFY A;  1BUD A;  4WKI A;  4WF6 A;  1R1J A;  1OZ9 A;  2E3X A;  1KUG A;  2XS3 A;  1HOV A;  2K2G A;  5D7W A;  2RJQ A;  1JAO A;  1SRP A;  3F1A A;  2WO9 A;  2CKI A;  4ILW D;  3USN A;  2DW0 A;  3HBV P;  3KEJ A;  1HFS A;  1G05 A;  1KUF A;  1BKC A;  1I73 A;  1QIC A;  3F19 A;  1ZTQ A;  2WOA A;  1GKC A;  3DPF A;  3DNG A;  5I4O A;  5LAB A;  1PWV A;  3MA2 A;  1IAA A;  4XCT A;  1I1I P;  3TVC A;  2OW2 A;  3K7L A;  1MNC A;  1JAP A;  3EDH A;  1MMR A;  5I2Z A;  2N8R A;  2OXU A;  4HX3 A;  5I3M A;  1OMJ A;  4XBH A;  3L0V A;  4H84 A;  5CZM A;  2JSD A;  3DTE A;  3F16 A;  1QUA A;  3P1V A;  1K7G A;  456C A;  5BOT A;  3G42 A;  4EFS A;  1B3D A;  1ZP5 A;  2MZI A;  5I43 A;  3WV1 A;  4CTH A;  1UTZ A;  1RM8 A;  2OVX A;  2YUF A;  4AYK A;  1PWW A;  1Y8J A;  1D8M A;  2A8H A;  1GKD A;  1H71 P;  4A7B A;  4L6T A;  3N2V A;  2MLR A;  3LKA A;  1JAQ A;  1SMP A;  1JIZ A;  4AIG A;  1GO7 P;  1GO8 P;  4FXY P;  1R1H A;  4IUW A;  2HU6 A;  1O0Q A;  1YCM A;  3E8R A;  1KAP P;  4QKZ A;  1MMP A;  1JKY A;  2W12 A;  1SLN A;  3O64 A;  1RMZ A;  1BKC I;  1QIA A;  1XFX A;  3CKI A;  1BSW A;  2OI0 A;  1OS2 A;  2MZH A;  3K7N A;  2KRJ A;  1USN A;  3VTG A;  3TS4 A;  3SHI A;  1XUD A;  2D1N A;  2W14 A;  1IAC A;  3B8Z A;  3GBO A;  3LK8 A;  5BPA A;  4I03 A;  1C8T A;  830C A;  1R54 A;  2X3B A;  1ZXV A;  2D1O A;  1CAQ A;  1CQR A;  2TCL A;  1ROS A;  1OM7 A;  2JNP A;  1XAX A;  1ZVX A;  1HFC A;  1D7X A;  2O36 A;  2YB9 A;  4J4M A;  2X3C A;  3ZVS A;  2AYK A;  3RTS A;  1S4B P;  1SU3 A;  3DPE A;  1HTD A;  3B2Z A;  4JQG A;  3Q2H A;  4R3V A;  5L79 A;  3U1R A;  1XFZ A;  2WO8 A;  1J7N A;  1Z3J A;  1HV5 A;  3UVC A;  1UMT A;  3LJZ A;  5CXA A;  4JA1 A;  2ERQ A;  4Q1L A;  4XM7 A;  2JT5 A;  5BOY A;  5CUH A;  2MLS A;  3N2U A;  1SAT A;  2X7M A;  2E2D A;  1PWQ A;  4JIJ A;  4WZV A;  2JT6 A;  3HYG A;  2YIG A;  1QJJ A;  3KME A;  3TSK A;  4IJO A;  2OVZ A;  3EWJ A;  3LIR A;  4H2E A;  1BZS A;  1SLM A;  1GE5 A;  4PKV A;  2OW0 A;  1HY7 A;  1BM6 A;  1D5J A;  1G9K A;  4GF1 A;  1D8F A;  1ZS0 A;  3EHX A;  4XM8 A;  3LUN A;  2ERP A;  3KMC A;  1C7K A;  1CGE A;  2DDF A;  3BA0 A;  1ND1 A;  3LMC A;  2V4B A;  5I0L A;  2OZR A;  1L6J A;  2XS4 A;  1MMB A;  1GXD A;  1UTT A;  2W0D A;  4WK7 A;  1A85 A;  4GR3 A;  1BIW A;  1K7Q A;  1OM6 A;  1QJI A;  3VI1 A;  4WKE A;  1YP1 A;  4L7A A;  1EUB A;  1JAN A;  2DW2 A;  4ON1 A;  1JH1 A;  1DTH A;  2J0T A;  1DMT A;  4PKQ A;  3LE9 A;  4JPA A;  4DV8 A;  1XFU A;  3HY9 A;  1Q3A A;  3EDZ A;  3KWV C;  1R55 A;  2FV5 A;  1CXV A;  1WNI A;  2OXW A;  1K7I A;  1XFV A;  3LQB A;  3LJT A;  1PWU A;  1XFW A;  5D1U A;  2Y6C A;  1BKC E;  3F17 A;  1OM8 A;  1A86 A;  3NX7 A;  1FM1 A;  3WV3 A;  2W13 A;  5D3C A;  2OY2 A;  4IN9 A;  1KUH A;  4H76 A;  5L7F A;  1KUK A;  1XUC A;  1TVI A;  4HMA A;  3KRY A;  3ELM A;  2JIH A;  2DW1 A;  1C3I A;  3LIL A;  3L0T A;  2USN A;  3HDB A;  1KBC A;  5JMY A;  2AIG P;  3I7I A;  2OW9 A;  3LIK A;  3EDG A;  2PJT A;  3I7G A; 
#chains in the Genus database with same CATH homology
 2I47 A;  1I76 A;  4I35 A;  3AYU A;  3KEK A;  3DTI A;  1UEA A;  5B5P A;  4H1Q A;  1OS9 A;  1PWP A;  5D1T A;  2QPJ A;  4DF9 A;  3DWB A;  3O2X A;  3LUM A;  3P24 A;  3HB2 P;  2FV9 A;  3AIG A;  4FVL A;  1UMS A;  4FXQ A;  1BQO A;  3KHI A;  5I12 A;  2K9C A;  1Y93 A;  1G4K A;  4PKT A;  1FLS A;  3RTT A;  1BQQ M;  1CIZ A;  3AYK A;  4XM6 A;  4PKU A;  2Z2D A;  2X3A A;  3OHO A;  3DL1 A;  3TT4 A;  1MMQ A;  2OXZ A;  1CGL A;  3OHL A;  2ERO A;  2Y6D A;  4PKW A;  4GWN A;  3LEA A;  1QIB A;  4L63 A;  1O0T A;  1FBL A;  4FU4 A;  4H30 A;  4H49 A;  4DPE A;  2O3E A;  3DTK A;  3Q2G A;  1R1I A;  4GR8 A;  1AYK A;  4AUO A;  1AF0 A;  4JP4 A;  1CK7 A;  4GR0 A;  2RJP A;  2OW1 A;  3HDA P;  2POJ A;  3ZXH A;  3HBU P;  5D2B A;  3F15 A;  4G9L A;  4G0D A;  4AXQ A;  1G12 A;  2SRT A;  3EHY A;  2OY4 A;  4GWM A;  1XUR A;  3G5C A;  3EDI A;  1G49 A;  1KUI A;  3LGP A;  4DD8 A;  1IAE A;  1YOU A;  2MZE A;  5D1S A;  4H3X A;  3LQ0 A;  2CLT A;  1CGF A;  1GE6 A;  5B5O A;  1GE7 A;  966C A;  3HY7 A;  4PKR A;  1AST A;  4A3W A;  1Y0V A;  1IAG A;  3LJG A;  3V96 B;  3ZUK A;  2DDY A;  5H8X A;  2J83 A;  4L19 A;  4ZR5 A;  2W15 A;  1ZXC A;  3F18 A;  1OO9 A;  3DSL A;  1EB6 A;  1JK3 A;  3B92 A;  1AKL A;  1BUV M;  3WV2 A;  3KEC A;  4GQL A;  1JIW P;  2L0R A;  4PKS A;  1IAD A;  1IAB A;  1ATL A;  1B8Y A;  4GUY A;  1YQY A;  1JJ9 A;  1EAK A;  4H82 A;  1XFY A;  1BUD A;  4WKI A;  4WF6 A;  1R1J A;  2E3X A;  1KUG A;  2XS3 A;  1HOV A;  2K2G A;  5D7W A;  2RJQ A;  1JAO A;  1SRP A;  3F1A A;  2WO9 A;  2CKI A;  4ILW D;  3USN A;  2DW0 A;  3HBV P;  3KEJ A;  1HFS A;  1G05 A;  1KUF A;  1BKC A;  1I73 A;  1QIC A;  3F19 A;  1ZTQ A;  2WOA A;  1GKC A;  3DPF A;  3DNG A;  5I4O A;  5LAB A;  1PWV A;  3MA2 A;  1IAA A;  4XCT A;  1I1I P;  3TVC A;  2OW2 A;  3K7L A;  1MNC A;  1JAP A;  3EDH A;  1MMR A;  5I2Z A;  2N8R A;  2OXU A;  4HX3 A;  5I3M A;  1OMJ A;  4XBH A;  3L0V A;  4H84 A;  5CZM A;  2JSD A;  3DTE A;  3F16 A;  1QUA A;  3P1V A;  1K7G A;  456C A;  5BOT A;  3G42 A;  4EFS A;  1B3D A;  1ZP5 A;  2MZI A;  5I43 A;  3WV1 A;  4CTH A;  1UTZ A;  1RM8 A;  2OVX A;  2YUF A;  4AYK A;  1PWW A;  1Y8J A;  1D8M A;  2A8H A;  1GKD A;  1H71 P;  4A7B A;  4L6T A;  3N2V A;  2MLR A;  3LKA A;  1JAQ A;  1SMP A;  1JIZ A;  4AIG A;  1GO7 P;  1GO8 P;  4FXY P;  1R1H A;  4IUW A;  2HU6 A;  1O0Q A;  1YCM A;  3E8R A;  1KAP P;  4QKZ A;  1MMP A;  1JKY A;  2W12 A;  1SLN A;  3O64 A;  1RMZ A;  1BKC I;  1QIA A;  1XFX A;  3CKI A;  1BSW A;  2OI0 A;  1OS2 A;  2MZH A;  3K7N A;  2KRJ A;  1USN A;  3VTG A;  3TS4 A;  3SHI A;  1XUD A;  2D1N A;  2W14 A;  1IAC A;  3B8Z A;  3GBO A;  3LK8 A;  5BPA A;  4I03 A;  1C8T A;  830C A;  1R54 A;  2X3B A;  1ZXV A;  2D1O A;  1CAQ A;  1CQR A;  2TCL A;  1ROS A;  1OM7 A;  2JNP A;  1ZVX A;  1HFC A;  1D7X A;  2O36 A;  2YB9 A;  4J4M A;  2X3C A;  3ZVS A;  2AYK A;  3RTS A;  1S4B P;  1SU3 A;  3DPE A;  1HTD A;  3B2Z A;  4JQG A;  3Q2H A;  4R3V A;  5L79 A;  3U1R A;  1XFZ A;  2WO8 A;  1J7N A;  1Z3J A;  1HV5 A;  3UVC A;  1UMT A;  3LJZ A;  5CXA A;  4JA1 A;  2ERQ A;  4Q1L A;  4XM7 A;  2JT5 A;  5BOY A;  5CUH A;  2MLS A;  3N2U A;  1SAT A;  2X7M A;  2E2D A;  1PWQ A;  4JIJ A;  4WZV A;  2JT6 A;  3HYG A;  2YIG A;  1QJJ A;  3KME A;  3TSK A;  4IJO A;  2OVZ A;  3EWJ A;  3LIR A;  4H2E A;  1BZS A;  1SLM A;  1GE5 A;  4PKV A;  2OW0 A;  1HY7 A;  1BM6 A;  1D5J A;  1G9K A;  4GF1 A;  1D8F A;  1ZS0 A;  3EHX A;  4XM8 A;  3LUN A;  2ERP A;  3KMC A;  1C7K A;  1CGE A;  2DDF A;  3BA0 A;  1ND1 A;  3LMC A;  2V4B A;  5I0L A;  2OZR A;  1L6J A;  2XS4 A;  1MMB A;  1GXD A;  1UTT A;  2W0D A;  4WK7 A;  1A85 A;  4GR3 A;  1BIW A;  1K7Q A;  1OM6 A;  1QJI A;  3VI1 A;  4WKE A;  1YP1 A;  4L7A A;  1EUB A;  1JAN A;  2DW2 A;  4ON1 A;  1JH1 A;  1DTH A;  2J0T A;  1DMT A;  4PKQ A;  3LE9 A;  4JPA A;  4DV8 A;  1XFU A;  3HY9 A;  1Q3A A;  3EDZ A;  3KWV C;  1R55 A;  2FV5 A;  1CXV A;  1WNI A;  2OXW A;  1K7I A;  1XFV A;  3LQB A;  3LJT A;  1PWU A;  1XFW A;  5D1U A;  2Y6C A;  1BKC E;  3F17 A;  1OM8 A;  1A86 A;  3NX7 A;  1FM1 A;  3WV3 A;  2W13 A;  5D3C A;  2OY2 A;  4IN9 A;  1KUH A;  4H76 A;  5L7F A;  1KUK A;  1XUC A;  4HMA A;  3KRY A;  3ELM A;  2JIH A;  2DW1 A;  1C3I A;  3LIL A;  3L0T A;  2USN A;  3HDB A;  1KBC A;  5JMY A;  2AIG P;  3I7I A;  2OW9 A;  3LIK A;  3EDG A;  2PJT A;  3I7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...