3USNA

Structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the thiadiazole inhibitor ipnu-107859, nmr, 1 structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
168
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STROMELYSIN-1
publication title Solution structures of stromelysin complexed to thiadiazole inhibitors.
pubmed rcsb
source organism Homo sapiens
total genus 35
structure length 168
sequence length 168
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1998-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3usnA00
3LJTA 1I73A 1K7QA 1MMPA 3KECA 3DPFA 3O64A 3KWVC 4L19A 1GE6A 1R1JA 3LE9A 2ERPA 2D1NA 5I43A 4DPEA 1MMBA 4R3VA 3USNA 4PKQA 3AIGA 2OVZA 1PWPA 4JQGA 1B3DA 3LQBA 3AYKA 4DV8A 3DPEA 3EDIA 1XFYA 1SLNA 2OXUA 5B5OA 5BPAA 1HY7A 3LMCA 5L7FA 2OXWA 4PKTA 5BOYA 1BUVM 1D8FA 3DWBA 3F16A 3P1VA 4JIJA 3F1AA 1MNCA 2OW9A 4FU4A 4G9LA 1HTDA 4PKUA 4Q1LA 1ZS0A 4H30A 2RJPA 1GO7P 1BKCA 1DMTA 3AYUA 1XURA 1KUKA 2K9CA 3OHLA 4ILWD 1KUHA 4GR8A 4WK7A 5I2ZA 1UMSA 3LJZA 1ZXVA 3LILA 1GKCA 1Q3AA 1YCMA 1UTTA 3N2UA 1QUAA 1SU3A 3HDBA 1BM6A 1CK7A 5JMYA 2MLSA 1RM8A 4PKSA 1BQOA 4EFSA 2OI0A 1JK3A 456CA 4I35A 3ELMA 1BSWA 4FXYP 4H1QA 2V4BA 3L0TA 3WV2A 1D7XA 2AYKA 3LJGA 5LABA 2OW0A 1CGEA 3K7LA 966CA 3F17A 4FVLA 1ATLA 4HMAA 3B8ZA 3KRYA 2ERQA 4HX3A 1GKDA 5D3CA 1ZXCA 5B5PA 2K2GA 3KMEA 3V96B 2PJTA 2N8RA 4L63A 1BUDA 3I7IA 2HU6A 1HOVA 2RJQA 1MMQA 3LQ0A 3LGPA 3ZUKA 1G12A 2X3BA 1QJJA 1BKCI 2W14A 4WZVA 4CTHA 4JP4A 1O0TA 1XFZA 1CAQA 1R1HA 5I3MA 5I12A 3WV1A 1AKLA 4JA1A 3O2XA 3HBUP 1IAEA 3LIKA 3EDGA 4ON1A 1SMPA 1CGLA 3DNGA 5BOTA 1JIWP 2CLTA 1C7KA 1J7NA 1UTZA 2XS3A 5I0LA 1ND1A 4WKEA 1MMRA 4GR3A 2L0RA 1BZSA 1OM7A 2POJA 1PWWA 1I76A 4JPAA 2W15A 2OVXA 5D1UA 3G5CA 2MLRA 2TCLA 1YQYA 1R54A 3TT4A 5D7WA 2WO9A 1KUGA 3KEJA 1D8MA 1XUCA 2DDYA 3TVCA 2WO8A 3HB2P 1R55A 1GE7A 1SRPA 3N2VA 1DTHA 4L6TA 1BKCE 1QIBA 1C8TA 4H76A 3B2ZA 2W12A 830CA 2YB9A 3EDZA 4PKRA 1USNA 1QICA 2MZHA 2Z2DA 1ZTQA 1Y0VA 3K7NA 1ZP5A 5D1SA 3KMCA 4AIGA 2J0TA 4GUYA 4QKZA 4IUWA 3LK8A 2FV5A 3EHXA 3ZXHA 1FM1A 1OO9A 4J4MA 4IJOA 1IADA 3U1RA 1Y8JA 3LUMA 1FBLA 3TSKA 3VTGA 1QIAA 3EHYA 4DD8A 1OMJA 4DF9A 2O36A 1B8YA 2W13A 4XM7A 3MA2A 1BIWA 1JAOA 4XM6A 5H8XA 3Q2GA 2EROA 1IAAA 1YP1A 1FLSA 1KBCA 2JT6A 1IACA 1XFWA 3HY9A 3LEAA 4A7BA 1ROSA 3DL1A 4G0DA 4A3WA 1CXVA 2X3AA 1G9KA 3LUNA 1C3IA 4GF1A 1G05A 4GR0A 4H49A 5CUHA 2MZIA 1JH1A 1I1IP 2X3CA 5D2BA 3KEKA 1JANA 2SRTA 3KHIA 2E3XA 1AF0A 2FV9A 3EDHA 4XCTA 2A8HA 1A86A 1UEAA 3DSLA 2JT5A 1IAGA 3HBVP 1KUIA 1JIZA 1SATA 3UVCA 2OW1A 2E2DA 2I47A 2USNA 1H71P 1JAPA 1OS9A 2XS4A 3NX7A 4H2EA 3TS4A 2O3EA 1ASTA 1R1IA 3HY7A 5D1TA 4AXQA 1OM8A 1D5JA 3Q2HA 4GWMA 1GE5A 2DDFA 1OM6A 1GXDA 4GQLA 2DW0A 1WNIA 1JAQA 3BA0A 4H82A 1SLMA 4I03A 2W0DA 1S4BP 1XFXA 1XFVA 1GO8P 2Y6DA 2MZEA 5I4OA 4H3XA 3VI1A 4GWNA 2Y6CA 1HV5A 1QJIA 1Y93A 1PWQA 3G42A 2AIGP 1HFCA 4ZR5A 3F19A 1XUDA 2CKIA 1G4KA 2OZRA 3E8RA 3I7GA 4AYKA 1PWVA 1BQQM 3LKAA 4WF6A 1K7GA 5CZMA 3L0VA 1UMTA 1HFSA 3HDAP 2QPJA 4FXQA 2JSDA 3HYGA 1EAKA 1IABA 3EWJA 2J83A 2DW1A 3RTTA 3P24A 1ZVXA 2WOAA 1KAPP 3OHOA 3F18A 3SHIA 3RTSA 1G49A 4XBHA 1O0QA 1RMZA 1CGFA 1CIZA 2JIHA 3WV3A 2OW2A 2JNPA 1Z3JA 1OS2A 1K7IA 2X7MA 1XFUA 1YOUA 1EB6A 3B92A 5L79A 1KUFA 1A85A 4PKWA 4H84A 5CXAA 4PKVA 3LIRA 4XM8A 4WKIA 1JKYA 2OY4A 2YIGA 2DW2A 2OY2A 1CQRA 3GBOA 2D1OA 2KRJA 2OXZA 1JJ9A 3CKIA 1L6JA 1EUBA 1AYKA 1PWUA 4AUOA 3ZVSA 3F15A 4IN9A
chains in the Genus database with same CATH superfamily
3LJTA 1I73A 1K7QA 1MMPA 3KECA 3DPFA 3O64A 3KWVC 4L19A 1GE6A 1R1JA 3LE9A 2ERPA 2D1NA 5I43A 4DPEA 1MMBA 1XM5A 4R3VA 3USNA 4PKQA 3AIGA 2OVZA 1PWPA 4JQGA 1B3DA 3LQBA 3AYKA 4DV8A 3DPEA 3EDIA 1XFYA 1SLNA 2OXUA 5B5OA 5BPAA 1HY7A 3LMCA 5L7FA 2OXWA 4PKTA 5BOYA 1BUVM 1D8FA 3DWBA 3F16A 3P1VA 4JIJA 3F1AA 1MNCA 2OW9A 4FU4A 4G9LA 1HTDA 4PKUA 4Q1LA 1ZS0A 4H30A 2RJPA 1GO7P 1BKCA 1DMTA 3AYUA 1XURA 1KUKA 2K9CA 3OHLA 4ILWD 1KUHA 4GR8A 4WK7A 5I2ZA 1UMSA 3LJZA 1ZXVA 3LILA 1GKCA 1Q3AA 1YCMA 1UTTA 3N2UA 1QUAA 1SU3A 3HDBA 1BM6A 1CK7A 5JMYA 2MLSA 1RM8A 4PKSA 1BQOA 4EFSA 2OI0A 1JK3A 456CA 4I35A 3ELMA 1BSWA 4FXYP 4H1QA 2V4BA 3L0TA 3WV2A 1D7XA 2AYKA 3LJGA 5LABA 2OW0A 1CGEA 3K7LA 966CA 3F17A 4FVLA 1ATLA 4HMAA 3B8ZA 3KRYA 2ERQA 4HX3A 1GKDA 5D3CA 1ZXCA 5B5PA 2K2GA 2YUFA 3KMEA 3V96B 2PJTA 2N8RA 4L7AA 4L63A 1BUDA 3I7IA 2HU6A 1HOVA 2RJQA 1MMQA 3LQ0A 3LGPA 3ZUKA 1G12A 2X3BA 1QJJA 1BKCI 2W14A 4WZVA 4CTHA 4JP4A 1O0TA 1XFZA 1CAQA 1R1HA 5I3MA 5I12A 3WV1A 1AKLA 4JA1A 3O2XA 3HBUP 1IAEA 3LIKA 3EDGA 4ON1A 1SMPA 1CGLA 3DNGA 5BOTA 1JIWP 2CLTA 1C7KA 1J7NA 1UTZA 1XAXA 2XS3A 5I0LA 1ND1A 4WKEA 1MMRA 4GR3A 2L0RA 1BZSA 1OM7A 2POJA 1PWWA 1I76A 4JPAA 2W15A 2OVXA 5D1UA 3G5CA 2MLRA 2TCLA 3DTEA 1YQYA 1R54A 3TT4A 5D7WA 2WO9A 1KUGA 3KEJA 1D8MA 1XUCA 2DDYA 3TVCA 2WO8A 3HB2P 1R55A 1GE7A 1SRPA 3N2VA 1DTHA 4L6TA 1BKCE 1QIBA 1C8TA 4H76A 3B2ZA 2W12A 830CA 2YB9A 3EDZA 4PKRA 1USNA 1QICA 2MZHA 2Z2DA 1ZTQA 1Y0VA 3K7NA 1ZP5A 5D1SA 3KMCA 4AIGA 2J0TA 4GUYA 4QKZA 4IUWA 3LK8A 2FV5A 3EHXA 3ZXHA 1FM1A 1OO9A 4J4MA 4IJOA 1IADA 3U1RA 1Y8JA 3LUMA 1FBLA 3TSKA 3VTGA 1QIAA 3EHYA 4DD8A 1OMJA 4DF9A 2O36A 1B8YA 2W13A 4XM7A 3MA2A 1BIWA 1TVIA 1JAOA 4XM6A 5H8XA 3Q2GA 2EROA 1IAAA 1YP1A 1FLSA 1KBCA 2JT6A 1IACA 1XFWA 3HY9A 3LEAA 4A7BA 1ROSA 3DL1A 4G0DA 4A3WA 3DTIA 1CXVA 2X3AA 1G9KA 3LUNA 1C3IA 4GF1A 1G05A 4GR0A 4H49A 5CUHA 2MZIA 1JH1A 1I1IP 2X3CA 5D2BA 3KEKA 1JANA 2SRTA 3KHIA 2E3XA 1AF0A 2FV9A 3EDHA 4XCTA 2A8HA 1A86A 1UEAA 3DSLA 2JT5A 1IAGA 3HBVP 1KUIA 1JIZA 1SATA 3UVCA 2OW1A 2E2DA 2I47A 2USNA 1H71P 1JAPA 1OS9A 2XS4A 3NX7A 4H2EA 3TS4A 2O3EA 1ASTA 1R1IA 3HY7A 5D1TA 4AXQA 1OM8A 1D5JA 3Q2HA 4GWMA 1GE5A 2DDFA 1OM6A 1GXDA 4GQLA 2DW0A 1WNIA 1JAQA 3BA0A 4H82A 1SLMA 4I03A 2W0DA 1S4BP 1XFXA 1XFVA 1GO8P 2Y6DA 2MZEA 5I4OA 4H3XA 3VI1A 4GWNA 2Y6CA 1HV5A 1QJIA 1Y93A 1PWQA 3G42A 2AIGP 1HFCA 4ZR5A 3F19A 1XUDA 2CKIA 1G4KA 2OZRA 3E8RA 3I7GA 4AYKA 1PWVA 1BQQM 3LKAA 4WF6A 1K7GA 5CZMA 3L0VA 1UMTA 1HFSA 3HDAP 2QPJA 4FXQA 2JSDA 3HYGA 1EAKA 1IABA 3EWJA 2J83A 2DW1A 3RTTA 3P24A 1ZVXA 2WOAA 1KAPP 3OHOA 3F18A 3SHIA 3RTSA 1G49A 4XBHA 1O0QA 1RMZA 1CGFA 1CIZA 2JIHA 3WV3A 2OW2A 2JNPA 1Z3JA 1OS2A 1K7IA 2X7MA 1XFUA 1YOUA 1EB6A 3B92A 5L79A 1OZ9A 1KUFA 1A85A 4PKWA 4H84A 5CXAA 4PKVA 3LIRA 4XM8A 4WKIA 1JKYA 2OY4A 2YIGA 2DW2A 2OY2A 1CQRA 3GBOA 2D1OA 2KRJA 2OXZA 3DTKA 1JJ9A 3CKIA 1L6JA 1EUBA 1AYKA 1PWUA 4AUOA 3ZVSA 3F15A 4IN9A
chains in the Genus database with same CATH topology
3LJTA 1I73A 1K7QA 1MMPA 3KECA 3DPFA 3O64A 3KWVC 4L19A 1GE6A 1R1JA 3LE9A 2ERPA 2D1NA 5I43A 4DPEA 1MMBA 4R3VA 3USNA 4PKQA 3AIGA 2OVZA 1PWPA 4JQGA 1B3DA 3LQBA 3AYKA 4DV8A 3DPEA 3EDIA 1XFYA 1SLNA 2OXUA 5B5OA 5BPAA 1HY7A 3LMCA 5L7FA 2OXWA 4PKTA 5BOYA 1BUVM 1D8FA 3DWBA 3F16A 3P1VA 4JIJA 3F1AA 1MNCA 2OW9A 4FU4A 4G9LA 1HTDA 4PKUA 4Q1LA 1ZS0A 4H30A 2RJPA 1GO7P 1BKCA 1DMTA 3AYUA 1XURA 1KUKA 2K9CA 3OHLA 4ILWD 1KUHA 4GR8A 4WK7A 5I2ZA 1UMSA 3LJZA 1ZXVA 3LILA 1GKCA 1Q3AA 1YCMA 1UTTA 3N2UA 1QUAA 1SU3A 3HDBA 1BM6A 1CK7A 5JMYA 2MLSA 1RM8A 4PKSA 1BQOA 4EFSA 2OI0A 1JK3A 456CA 4I35A 3ELMA 1BSWA 4FXYP 4H1QA 2V4BA 3L0TA 3WV2A 1D7XA 2AYKA 3LJGA 5LABA 2OW0A 1CGEA 3K7LA 966CA 3F17A 4FVLA 1ATLA 4HMAA 3B8ZA 3KRYA 2ERQA 4HX3A 1GKDA 5D3CA 1ZXCA 5B5PA 2K2GA 2YUFA 3KMEA 3V96B 2PJTA 2N8RA 4L7AA 4L63A 1BUDA 3I7IA 2HU6A 1HOVA 2RJQA 1MMQA 3LQ0A 3LGPA 3ZUKA 1G12A 2X3BA 1QJJA 1BKCI 2W14A 4WZVA 4CTHA 4JP4A 1O0TA 1XFZA 1CAQA 1R1HA 5I3MA 5I12A 3WV1A 1AKLA 4JA1A 3O2XA 3HBUP 1IAEA 3LIKA 3EDGA 4ON1A 1SMPA 1CGLA 3DNGA 5BOTA 1JIWP 2CLTA 1C7KA 1J7NA 1UTZA 2XS3A 5I0LA 1ND1A 4WKEA 1MMRA 4GR3A 2L0RA 1BZSA 1OM7A 2POJA 1PWWA 1I76A 4JPAA 2W15A 2OVXA 5D1UA 3G5CA 2MLRA 2TCLA 3DTEA 1YQYA 1R54A 3TT4A 5D7WA 2WO9A 1KUGA 3KEJA 1D8MA 1XUCA 2DDYA 3TVCA 2WO8A 3HB2P 1R55A 1GE7A 1SRPA 3N2VA 1DTHA 4L6TA 1BKCE 1QIBA 1C8TA 4H76A 3B2ZA 2W12A 830CA 2YB9A 3EDZA 4PKRA 1USNA 1QICA 2MZHA 2Z2DA 1ZTQA 1Y0VA 3K7NA 1ZP5A 5D1SA 3KMCA 4AIGA 2J0TA 4GUYA 4QKZA 4IUWA 3LK8A 2FV5A 3EHXA 3ZXHA 1FM1A 1OO9A 4J4MA 4IJOA 1IADA 3U1RA 1Y8JA 3LUMA 1FBLA 3TSKA 3VTGA 1QIAA 3EHYA 4DD8A 1OMJA 4DF9A 2O36A 1B8YA 2W13A 4XM7A 3MA2A 1BIWA 1JAOA 4XM6A 5H8XA 3Q2GA 2EROA 1IAAA 1YP1A 1FLSA 1KBCA 2JT6A 1IACA 1XFWA 3HY9A 3LEAA 4A7BA 1ROSA 3DL1A 4G0DA 4A3WA 3DTIA 1CXVA 2X3AA 1G9KA 3LUNA 1C3IA 4GF1A 1G05A 4GR0A 4H49A 5CUHA 2MZIA 1JH1A 1I1IP 2X3CA 5D2BA 3KEKA 1JANA 2SRTA 3KHIA 2E3XA 1AF0A 2FV9A 3EDHA 4XCTA 2A8HA 1A86A 1UEAA 3DSLA 2JT5A 1IAGA 3HBVP 1KUIA 1JIZA 1SATA 3UVCA 2OW1A 2E2DA 2I47A 2USNA 1H71P 1JAPA 1OS9A 2XS4A 3NX7A 4H2EA 3TS4A 2O3EA 1ASTA 1R1IA 3HY7A 5D1TA 4AXQA 1OM8A 1D5JA 3Q2HA 4GWMA 1GE5A 2DDFA 1OM6A 1GXDA 4GQLA 2DW0A 1WNIA 1JAQA 3BA0A 4H82A 1SLMA 4I03A 2W0DA 1S4BP 1XFXA 1XFVA 1GO8P 2Y6DA 2MZEA 5I4OA 4H3XA 3VI1A 4GWNA 2Y6CA 1HV5A 1QJIA 1Y93A 1PWQA 3G42A 2AIGP 1HFCA 4ZR5A 3F19A 1XUDA 2CKIA 1G4KA 2OZRA 3E8RA 3I7GA 4AYKA 1PWVA 1BQQM 3LKAA 4WF6A 1K7GA 5CZMA 3L0VA 1UMTA 1HFSA 3HDAP 2QPJA 4FXQA 2JSDA 3HYGA 1EAKA 1IABA 3EWJA 2J83A 2DW1A 3RTTA 3P24A 1ZVXA 2WOAA 1KAPP 3OHOA 3F18A 3SHIA 3RTSA 1G49A 4XBHA 1O0QA 1RMZA 1CGFA 1CIZA 2JIHA 3WV3A 2OW2A 2JNPA 1Z3JA 1OS2A 1K7IA 2X7MA 1XFUA 1YOUA 1EB6A 3B92A 5L79A 1KUFA 1A85A 4PKWA 4H84A 5CXAA 4PKVA 3LIRA 4XM8A 4WKIA 1JKYA 2OY4A 2YIGA 2DW2A 2OY2A 1CQRA 3GBOA 2D1OA 2KRJA 2OXZA 3DTKA 1JJ9A 3CKIA 1L6JA 1EUBA 1AYKA 1PWUA 4AUOA 3ZVSA 3F15A 4IN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJT A;  1I73 A;  1K7Q A;  1MMP A;  3KEC A;  3DPF A;  3O64 A;  3KWV C;  4L19 A;  1GE6 A;  1R1J A;  3LE9 A;  2ERP A;  2D1N A;  5I43 A;  4DPE A;  1MMB A;  4R3V A;  3USN A;  4PKQ A;  3AIG A;  2OVZ A;  1PWP A;  4JQG A;  1B3D A;  3LQB A;  3AYK A;  4DV8 A;  3DPE A;  3EDI A;  1XFY A;  1SLN A;  2OXU A;  5B5O A;  5BPA A;  1HY7 A;  3LMC A;  5L7F A;  2OXW A;  4PKT A;  5BOY A;  1BUV M;  1D8F A;  3DWB A;  3F16 A;  3P1V A;  4JIJ A;  3F1A A;  1MNC A;  2OW9 A;  4FU4 A;  4G9L A;  1HTD A;  4PKU A;  4Q1L A;  1ZS0 A;  4H30 A;  2RJP A;  1GO7 P;  1BKC A;  1DMT A;  3AYU A;  1XUR A;  1KUK A;  2K9C A;  3OHL A;  4ILW D;  1KUH A;  4GR8 A;  4WK7 A;  5I2Z A;  1UMS A;  3LJZ A;  1ZXV A;  3LIL A;  1GKC A;  1Q3A A;  1YCM A;  1UTT A;  3N2U A;  1QUA A;  1SU3 A;  3HDB A;  1BM6 A;  1CK7 A;  5JMY A;  2MLS A;  1RM8 A;  4PKS A;  1BQO A;  4EFS A;  2OI0 A;  1JK3 A;  456C A;  4I35 A;  3ELM A;  1BSW A;  4FXY P;  4H1Q A;  2V4B A;  3L0T A;  3WV2 A;  1D7X A;  2AYK A;  3LJG A;  5LAB A;  2OW0 A;  1CGE A;  3K7L A;  966C A;  3F17 A;  4FVL A;  1ATL A;  4HMA A;  3B8Z A;  3KRY A;  2ERQ A;  4HX3 A;  1GKD A;  5D3C A;  1ZXC A;  5B5P A;  2K2G A;  3KME A;  3V96 B;  2PJT A;  2N8R A;  4L63 A;  1BUD A;  3I7I A;  2HU6 A;  1HOV A;  2RJQ A;  1MMQ A;  3LQ0 A;  3LGP A;  3ZUK A;  1G12 A;  2X3B A;  1QJJ A;  1BKC I;  2W14 A;  4WZV A;  4CTH A;  4JP4 A;  1O0T A;  1XFZ A;  1CAQ A;  1R1H A;  5I3M A;  5I12 A;  3WV1 A;  1AKL A;  4JA1 A;  3O2X A;  3HBU P;  1IAE A;  3LIK A;  3EDG A;  4ON1 A;  1SMP A;  1CGL A;  3DNG A;  5BOT A;  1JIW P;  2CLT A;  1C7K A;  1J7N A;  1UTZ A;  2XS3 A;  5I0L A;  1ND1 A;  4WKE A;  1MMR A;  4GR3 A;  2L0R A;  1BZS A;  1OM7 A;  2POJ A;  1PWW A;  1I76 A;  4JPA A;  2W15 A;  2OVX A;  5D1U A;  3G5C A;  2MLR A;  2TCL A;  1YQY A;  1R54 A;  3TT4 A;  5D7W A;  2WO9 A;  1KUG A;  3KEJ A;  1D8M A;  1XUC A;  2DDY A;  3TVC A;  2WO8 A;  3HB2 P;  1R55 A;  1GE7 A;  1SRP A;  3N2V A;  1DTH A;  4L6T A;  1BKC E;  1QIB A;  1C8T A;  4H76 A;  3B2Z A;  2W12 A;  830C A;  2YB9 A;  3EDZ A;  4PKR A;  1USN A;  1QIC A;  2MZH A;  2Z2D A;  1ZTQ A;  1Y0V A;  3K7N A;  1ZP5 A;  5D1S A;  3KMC A;  4AIG A;  2J0T A;  4GUY A;  4QKZ A;  4IUW A;  3LK8 A;  2FV5 A;  3EHX A;  3ZXH A;  1FM1 A;  1OO9 A;  4J4M A;  4IJO A;  1IAD A;  3U1R A;  1Y8J A;  3LUM A;  1FBL A;  3TSK A;  3VTG A;  1QIA A;  3EHY A;  4DD8 A;  1OMJ A;  4DF9 A;  2O36 A;  1B8Y A;  2W13 A;  4XM7 A;  3MA2 A;  1BIW A;  1JAO A;  4XM6 A;  5H8X A;  3Q2G A;  2ERO A;  1IAA A;  1YP1 A;  1FLS A;  1KBC A;  2JT6 A;  1IAC A;  1XFW A;  3HY9 A;  3LEA A;  4A7B A;  1ROS A;  3DL1 A;  4G0D A;  4A3W A;  1CXV A;  2X3A A;  1G9K A;  3LUN A;  1C3I A;  4GF1 A;  1G05 A;  4GR0 A;  4H49 A;  5CUH A;  2MZI A;  1JH1 A;  1I1I P;  2X3C A;  5D2B A;  3KEK A;  1JAN A;  2SRT A;  3KHI A;  2E3X A;  1AF0 A;  2FV9 A;  3EDH A;  4XCT A;  2A8H A;  1A86 A;  1UEA A;  3DSL A;  2JT5 A;  1IAG A;  3HBV P;  1KUI A;  1JIZ A;  1SAT A;  3UVC A;  2OW1 A;  2E2D A;  2I47 A;  2USN A;  1H71 P;  1JAP A;  1OS9 A;  2XS4 A;  3NX7 A;  4H2E A;  3TS4 A;  2O3E A;  1AST A;  1R1I A;  3HY7 A;  5D1T A;  4AXQ A;  1OM8 A;  1D5J A;  3Q2H A;  4GWM A;  1GE5 A;  2DDF A;  1OM6 A;  1GXD A;  4GQL A;  2DW0 A;  1WNI A;  1JAQ A;  3BA0 A;  4H82 A;  1SLM A;  4I03 A;  2W0D A;  1S4B P;  1XFX A;  1XFV A;  1GO8 P;  2Y6D A;  2MZE A;  5I4O A;  4H3X A;  3VI1 A;  4GWN A;  2Y6C A;  1HV5 A;  1QJI A;  1Y93 A;  1PWQ A;  3G42 A;  2AIG P;  1HFC A;  4ZR5 A;  3F19 A;  1XUD A;  2CKI A;  1G4K A;  2OZR A;  3E8R A;  3I7G A;  4AYK A;  1PWV A;  1BQQ M;  3LKA A;  4WF6 A;  1K7G A;  5CZM A;  3L0V A;  1UMT A;  1HFS A;  3HDA P;  2QPJ A;  4FXQ A;  2JSD A;  3HYG A;  1EAK A;  1IAB A;  3EWJ A;  2J83 A;  2DW1 A;  3RTT A;  3P24 A;  1ZVX A;  2WOA A;  1KAP P;  3OHO A;  3F18 A;  3SHI A;  3RTS A;  1G49 A;  4XBH A;  1O0Q A;  1RMZ A;  1CGF A;  1CIZ A;  2JIH A;  3WV3 A;  2OW2 A;  2JNP A;  1Z3J A;  1OS2 A;  1K7I A;  2X7M A;  1XFU A;  1YOU A;  1EB6 A;  3B92 A;  5L79 A;  1KUF A;  1A85 A;  4PKW A;  4H84 A;  5CXA A;  4PKV A;  3LIR A;  4XM8 A;  4WKI A;  1JKY A;  2OY4 A;  2YIG A;  2DW2 A;  2OY2 A;  1CQR A;  3GBO A;  2D1O A;  2KRJ A;  2OXZ A;  1JJ9 A;  3CKI A;  1L6J A;  1EUB A;  1AYK A;  1PWU A;  4AUO A;  3ZVS A;  3F15 A;  4IN9 A; 
#chains in the Genus database with same CATH topology
 3LJT A;  1I73 A;  1K7Q A;  1MMP A;  3KEC A;  3DPF A;  3O64 A;  3KWV C;  4L19 A;  1GE6 A;  1R1J A;  3LE9 A;  2ERP A;  2D1N A;  5I43 A;  4DPE A;  1MMB A;  1XM5 A;  4R3V A;  3USN A;  4PKQ A;  3AIG A;  2OVZ A;  1PWP A;  4JQG A;  1B3D A;  3LQB A;  3AYK A;  4DV8 A;  3DPE A;  3EDI A;  1XFY A;  1SLN A;  2OXU A;  5B5O A;  5BPA A;  1HY7 A;  3LMC A;  5L7F A;  2OXW A;  4PKT A;  5BOY A;  1BUV M;  1D8F A;  3DWB A;  3F16 A;  3P1V A;  4JIJ A;  3F1A A;  1MNC A;  2OW9 A;  4FU4 A;  4G9L A;  1HTD A;  4PKU A;  4Q1L A;  1ZS0 A;  4H30 A;  2RJP A;  1GO7 P;  1BKC A;  1DMT A;  3AYU A;  1XUR A;  1KUK A;  2K9C A;  3OHL A;  4ILW D;  1KUH A;  4GR8 A;  4WK7 A;  5I2Z A;  1UMS A;  3LJZ A;  1ZXV A;  3LIL A;  1GKC A;  1Q3A A;  1YCM A;  1UTT A;  3N2U A;  1QUA A;  1SU3 A;  3HDB A;  1BM6 A;  1CK7 A;  5JMY A;  2MLS A;  1RM8 A;  4PKS A;  1BQO A;  4EFS A;  2OI0 A;  1JK3 A;  456C A;  4I35 A;  3ELM A;  1BSW A;  4FXY P;  4H1Q A;  2V4B A;  3L0T A;  3WV2 A;  1D7X A;  2AYK A;  3LJG A;  5LAB A;  2OW0 A;  1CGE A;  3K7L A;  966C A;  3F17 A;  4FVL A;  1ATL A;  4HMA A;  3B8Z A;  3KRY A;  2ERQ A;  4HX3 A;  1GKD A;  5D3C A;  1ZXC A;  5B5P A;  2K2G A;  2YUF A;  3KME A;  3V96 B;  2PJT A;  2N8R A;  4L7A A;  4L63 A;  1BUD A;  3I7I A;  2HU6 A;  1HOV A;  2RJQ A;  1MMQ A;  3LQ0 A;  3LGP A;  3ZUK A;  1G12 A;  2X3B A;  1QJJ A;  1BKC I;  2W14 A;  4WZV A;  4CTH A;  4JP4 A;  1O0T A;  1XFZ A;  1CAQ A;  1R1H A;  5I3M A;  5I12 A;  3WV1 A;  1AKL A;  4JA1 A;  3O2X A;  3HBU P;  1IAE A;  3LIK A;  3EDG A;  4ON1 A;  1SMP A;  1CGL A;  3DNG A;  5BOT A;  1JIW P;  2CLT A;  1C7K A;  1J7N A;  1UTZ A;  1XAX A;  2XS3 A;  5I0L A;  1ND1 A;  4WKE A;  1MMR A;  4GR3 A;  2L0R A;  1BZS A;  1OM7 A;  2POJ A;  1PWW A;  1I76 A;  4JPA A;  2W15 A;  2OVX A;  5D1U A;  3G5C A;  2MLR A;  2TCL A;  3DTE A;  1YQY A;  1R54 A;  3TT4 A;  5D7W A;  2WO9 A;  1KUG A;  3KEJ A;  1D8M A;  1XUC A;  2DDY A;  3TVC A;  2WO8 A;  3HB2 P;  1R55 A;  1GE7 A;  1SRP A;  3N2V A;  1DTH A;  4L6T A;  1BKC E;  1QIB A;  1C8T A;  4H76 A;  3B2Z A;  2W12 A;  830C A;  2YB9 A;  3EDZ A;  4PKR A;  1USN A;  1QIC A;  2MZH A;  2Z2D A;  1ZTQ A;  1Y0V A;  3K7N A;  1ZP5 A;  5D1S A;  3KMC A;  4AIG A;  2J0T A;  4GUY A;  4QKZ A;  4IUW A;  3LK8 A;  2FV5 A;  3EHX A;  3ZXH A;  1FM1 A;  1OO9 A;  4J4M A;  4IJO A;  1IAD A;  3U1R A;  1Y8J A;  3LUM A;  1FBL A;  3TSK A;  3VTG A;  1QIA A;  3EHY A;  4DD8 A;  1OMJ A;  4DF9 A;  2O36 A;  1B8Y A;  2W13 A;  4XM7 A;  3MA2 A;  1BIW A;  1TVI A;  1JAO A;  4XM6 A;  5H8X A;  3Q2G A;  2ERO A;  1IAA A;  1YP1 A;  1FLS A;  1KBC A;  2JT6 A;  1IAC A;  1XFW A;  3HY9 A;  3LEA A;  4A7B A;  1ROS A;  3DL1 A;  4G0D A;  4A3W A;  3DTI A;  1CXV A;  2X3A A;  1G9K A;  3LUN A;  1C3I A;  4GF1 A;  1G05 A;  4GR0 A;  4H49 A;  5CUH A;  2MZI A;  1JH1 A;  1I1I P;  2X3C A;  5D2B A;  3KEK A;  1JAN A;  2SRT A;  3KHI A;  2E3X A;  1AF0 A;  2FV9 A;  3EDH A;  4XCT A;  2A8H A;  1A86 A;  1UEA A;  3DSL A;  2JT5 A;  1IAG A;  3HBV P;  1KUI A;  1JIZ A;  1SAT A;  3UVC A;  2OW1 A;  2E2D A;  2I47 A;  2USN A;  1H71 P;  1JAP A;  1OS9 A;  2XS4 A;  3NX7 A;  4H2E A;  3TS4 A;  2O3E A;  1AST A;  1R1I A;  3HY7 A;  5D1T A;  4AXQ A;  1OM8 A;  1D5J A;  3Q2H A;  4GWM A;  1GE5 A;  2DDF A;  1OM6 A;  1GXD A;  4GQL A;  2DW0 A;  1WNI A;  1JAQ A;  3BA0 A;  4H82 A;  1SLM A;  4I03 A;  2W0D A;  1S4B P;  1XFX A;  1XFV A;  1GO8 P;  2Y6D A;  2MZE A;  5I4O A;  4H3X A;  3VI1 A;  4GWN A;  2Y6C A;  1HV5 A;  1QJI A;  1Y93 A;  1PWQ A;  3G42 A;  2AIG P;  1HFC A;  4ZR5 A;  3F19 A;  1XUD A;  2CKI A;  1G4K A;  2OZR A;  3E8R A;  3I7G A;  4AYK A;  1PWV A;  1BQQ M;  3LKA A;  4WF6 A;  1K7G A;  5CZM A;  3L0V A;  1UMT A;  1HFS A;  3HDA P;  2QPJ A;  4FXQ A;  2JSD A;  3HYG A;  1EAK A;  1IAB A;  3EWJ A;  2J83 A;  2DW1 A;  3RTT A;  3P24 A;  1ZVX A;  2WOA A;  1KAP P;  3OHO A;  3F18 A;  3SHI A;  3RTS A;  1G49 A;  4XBH A;  1O0Q A;  1RMZ A;  1CGF A;  1CIZ A;  2JIH A;  3WV3 A;  2OW2 A;  2JNP A;  1Z3J A;  1OS2 A;  1K7I A;  2X7M A;  1XFU A;  1YOU A;  1EB6 A;  3B92 A;  5L79 A;  1OZ9 A;  1KUF A;  1A85 A;  4PKW A;  4H84 A;  5CXA A;  4PKV A;  3LIR A;  4XM8 A;  4WKI A;  1JKY A;  2OY4 A;  2YIG A;  2DW2 A;  2OY2 A;  1CQR A;  3GBO A;  2D1O A;  2KRJ A;  2OXZ A;  3DTK A;  1JJ9 A;  3CKI A;  1L6J A;  1EUB A;  1AYK A;  1PWU A;  4AUO A;  3ZVS A;  3F15 A;  4IN9 A; 
#chains in the Genus database with same CATH homology
 3LJT A;  1I73 A;  1K7Q A;  1MMP A;  3KEC A;  3DPF A;  3O64 A;  3KWV C;  4L19 A;  1GE6 A;  1R1J A;  3LE9 A;  2ERP A;  2D1N A;  5I43 A;  4DPE A;  1MMB A;  4R3V A;  3USN A;  4PKQ A;  3AIG A;  2OVZ A;  1PWP A;  4JQG A;  1B3D A;  3LQB A;  3AYK A;  4DV8 A;  3DPE A;  3EDI A;  1XFY A;  1SLN A;  2OXU A;  5B5O A;  5BPA A;  1HY7 A;  3LMC A;  5L7F A;  2OXW A;  4PKT A;  5BOY A;  1BUV M;  1D8F A;  3DWB A;  3F16 A;  3P1V A;  4JIJ A;  3F1A A;  1MNC A;  2OW9 A;  4FU4 A;  4G9L A;  1HTD A;  4PKU A;  4Q1L A;  1ZS0 A;  4H30 A;  2RJP A;  1GO7 P;  1BKC A;  1DMT A;  3AYU A;  1XUR A;  1KUK A;  2K9C A;  3OHL A;  4ILW D;  1KUH A;  4GR8 A;  4WK7 A;  5I2Z A;  1UMS A;  3LJZ A;  1ZXV A;  3LIL A;  1GKC A;  1Q3A A;  1YCM A;  1UTT A;  3N2U A;  1QUA A;  1SU3 A;  3HDB A;  1BM6 A;  1CK7 A;  5JMY A;  2MLS A;  1RM8 A;  4PKS A;  1BQO A;  4EFS A;  2OI0 A;  1JK3 A;  456C A;  4I35 A;  3ELM A;  1BSW A;  4FXY P;  4H1Q A;  2V4B A;  3L0T A;  3WV2 A;  1D7X A;  2AYK A;  3LJG A;  5LAB A;  2OW0 A;  1CGE A;  3K7L A;  966C A;  3F17 A;  4FVL A;  1ATL A;  4HMA A;  3B8Z A;  3KRY A;  2ERQ A;  4HX3 A;  1GKD A;  5D3C A;  1ZXC A;  5B5P A;  2K2G A;  2YUF A;  3KME A;  3V96 B;  2PJT A;  2N8R A;  4L7A A;  4L63 A;  1BUD A;  3I7I A;  2HU6 A;  1HOV A;  2RJQ A;  1MMQ A;  3LQ0 A;  3LGP A;  3ZUK A;  1G12 A;  2X3B A;  1QJJ A;  1BKC I;  2W14 A;  4WZV A;  4CTH A;  4JP4 A;  1O0T A;  1XFZ A;  1CAQ A;  1R1H A;  5I3M A;  5I12 A;  3WV1 A;  1AKL A;  4JA1 A;  3O2X A;  3HBU P;  1IAE A;  3LIK A;  3EDG A;  4ON1 A;  1SMP A;  1CGL A;  3DNG A;  5BOT A;  1JIW P;  2CLT A;  1C7K A;  1J7N A;  1UTZ A;  2XS3 A;  5I0L A;  1ND1 A;  4WKE A;  1MMR A;  4GR3 A;  2L0R A;  1BZS A;  1OM7 A;  2POJ A;  1PWW A;  1I76 A;  4JPA A;  2W15 A;  2OVX A;  5D1U A;  3G5C A;  2MLR A;  2TCL A;  3DTE A;  1YQY A;  1R54 A;  3TT4 A;  5D7W A;  2WO9 A;  1KUG A;  3KEJ A;  1D8M A;  1XUC A;  2DDY A;  3TVC A;  2WO8 A;  3HB2 P;  1R55 A;  1GE7 A;  1SRP A;  3N2V A;  1DTH A;  4L6T A;  1BKC E;  1QIB A;  1C8T A;  4H76 A;  3B2Z A;  2W12 A;  830C A;  2YB9 A;  3EDZ A;  4PKR A;  1USN A;  1QIC A;  2MZH A;  2Z2D A;  1ZTQ A;  1Y0V A;  3K7N A;  1ZP5 A;  5D1S A;  3KMC A;  4AIG A;  2J0T A;  4GUY A;  4QKZ A;  4IUW A;  3LK8 A;  2FV5 A;  3EHX A;  3ZXH A;  1FM1 A;  1OO9 A;  4J4M A;  4IJO A;  1IAD A;  3U1R A;  1Y8J A;  3LUM A;  1FBL A;  3TSK A;  3VTG A;  1QIA A;  3EHY A;  4DD8 A;  1OMJ A;  4DF9 A;  2O36 A;  1B8Y A;  2W13 A;  4XM7 A;  3MA2 A;  1BIW A;  1JAO A;  4XM6 A;  5H8X A;  3Q2G A;  2ERO A;  1IAA A;  1YP1 A;  1FLS A;  1KBC A;  2JT6 A;  1IAC A;  1XFW A;  3HY9 A;  3LEA A;  4A7B A;  1ROS A;  3DL1 A;  4G0D A;  4A3W A;  3DTI A;  1CXV A;  2X3A A;  1G9K A;  3LUN A;  1C3I A;  4GF1 A;  1G05 A;  4GR0 A;  4H49 A;  5CUH A;  2MZI A;  1JH1 A;  1I1I P;  2X3C A;  5D2B A;  3KEK A;  1JAN A;  2SRT A;  3KHI A;  2E3X A;  1AF0 A;  2FV9 A;  3EDH A;  4XCT A;  2A8H A;  1A86 A;  1UEA A;  3DSL A;  2JT5 A;  1IAG A;  3HBV P;  1KUI A;  1JIZ A;  1SAT A;  3UVC A;  2OW1 A;  2E2D A;  2I47 A;  2USN A;  1H71 P;  1JAP A;  1OS9 A;  2XS4 A;  3NX7 A;  4H2E A;  3TS4 A;  2O3E A;  1AST A;  1R1I A;  3HY7 A;  5D1T A;  4AXQ A;  1OM8 A;  1D5J A;  3Q2H A;  4GWM A;  1GE5 A;  2DDF A;  1OM6 A;  1GXD A;  4GQL A;  2DW0 A;  1WNI A;  1JAQ A;  3BA0 A;  4H82 A;  1SLM A;  4I03 A;  2W0D A;  1S4B P;  1XFX A;  1XFV A;  1GO8 P;  2Y6D A;  2MZE A;  5I4O A;  4H3X A;  3VI1 A;  4GWN A;  2Y6C A;  1HV5 A;  1QJI A;  1Y93 A;  1PWQ A;  3G42 A;  2AIG P;  1HFC A;  4ZR5 A;  3F19 A;  1XUD A;  2CKI A;  1G4K A;  2OZR A;  3E8R A;  3I7G A;  4AYK A;  1PWV A;  1BQQ M;  3LKA A;  4WF6 A;  1K7G A;  5CZM A;  3L0V A;  1UMT A;  1HFS A;  3HDA P;  2QPJ A;  4FXQ A;  2JSD A;  3HYG A;  1EAK A;  1IAB A;  3EWJ A;  2J83 A;  2DW1 A;  3RTT A;  3P24 A;  1ZVX A;  2WOA A;  1KAP P;  3OHO A;  3F18 A;  3SHI A;  3RTS A;  1G49 A;  4XBH A;  1O0Q A;  1RMZ A;  1CGF A;  1CIZ A;  2JIH A;  3WV3 A;  2OW2 A;  2JNP A;  1Z3J A;  1OS2 A;  1K7I A;  2X7M A;  1XFU A;  1YOU A;  1EB6 A;  3B92 A;  5L79 A;  1KUF A;  1A85 A;  4PKW A;  4H84 A;  5CXA A;  4PKV A;  3LIR A;  4XM8 A;  4WKI A;  1JKY A;  2OY4 A;  2YIG A;  2DW2 A;  2OY2 A;  1CQR A;  3GBO A;  2D1O A;  2KRJ A;  2OXZ A;  3DTK A;  1JJ9 A;  3CKI A;  1L6J A;  1EUB A;  1AYK A;  1PWU A;  4AUO A;  3ZVS A;  3F15 A;  4IN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...