1GKCA

Mmp9-inhibitor complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 92 KDA TYPE IV COLLAGENASE
publication title Crystal Structure of Mmp9 in Complex with a Reverse Hydroxamate Inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2001-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1gkcA00
1I1IP 3Q2HA 1JKYA 1MMRA 4AUOA 1PWPA 2SRTA 1EUBA 2USNA 2JIHA 1OS9A 2OXZA 1HTDA 1RMZA 4J4MA 1QJIA 4GQLA 1G9KA 1SATA 3L0TA 1UTTA 3I7GA 1R1IA 1R1HA 2Y6DA 1OS2A 5BPAA 1EAKA 1KUGA 1ZXVA 3TSKA 2DW2A 3EDZA 5CZMA 2E2DA 2K9CA 1JIZA 1Z3JA 4WKEA 1BKCA 4JIJA 1JAPA 3ZXHA 2TCLA 1UEAA 4H76A 1CQRA 3B2ZA 1JAQA 1IAGA 4AXQA 1BQOA 2D1NA 3I7IA 1I76A 4EFSA 4JQGA 3L0VA 1GKDA 2W15A 1BM6A 1KUIA 4G9LA 1K7GA 2L0RA 4ON1A 1CGEA 1KUFA 2AIGP 4XCTA 3USNA 1BZSA 2OY4A 1JIWP 2JT6A 1A85A 2W14A 1USNA 4DF9A 2OY2A 3ELMA 2W0DA 3LIRA 3LUMA 4H49A 3Q2GA 4Q1LA 4PKUA 2N8RA 1J7NA 1K7QA 3G5CA 2OXUA 1SLMA 4GR3A 1FM1A 1AF0A 1AYKA 3VI1A 1RM8A 1BSWA 1QIBA 3EHXA 3GBOA 2V4BA 4PKSA 1Y93A 4H3XA 2OW2A 4HMAA 3DPEA 5I0LA 2CKIA 1MNCA 3EHYA 4PKRA 2CLTA 3LILA 1B8YA 1GO7P 2DDFA 1D8MA 4DV8A 2W12A 1XFWA 2JNPA 1ZS0A 4IUWA 4IJOA 5JMYA 3LK8A 3DWBA 4WZVA 2ERQA 1OM6A 2XS3A 1IACA 2OXWA 2X7MA 3LEAA 1K7IA 4XM8A 4GR8A 3N2UA 3KEJA 1OMJA 2POJA 4GWMA 3AYKA 3EDHA 1DTHA 1CIZA 2RJQA 1HV5A 3LGPA 3LJTA 3LKAA 4A7BA 1CGFA 4AYKA 5CXAA 1QIAA 4H30A 3K7NA 1ZVXA 1IADA 3EWJA 3KMCA 5I12A 1YOUA 1HFCA 3F17A 4DPEA 1G4KA 1G49A 1D5JA 5BOTA 1XFYA 1BIWA 2KRJA 5D1TA 4GWNA 4PKWA 3HY9A 2WOAA 4ZR5A 1WNIA 2PJTA 3HBVP 1JANA 4A3WA 3F16A 4I03A 3SHIA 2OI0A 3TT4A 1Y0VA 2OW1A 3DL1A 4GR0A 1XUCA 3G42A 4PKVA 1GE5A 3OHLA 4L6TA 1CXVA 830CA 1KBCA 5BOYA 2MZIA 3O64A 3LQBA 4AIGA 5B5PA 4R3VA 2J0TA 3F15A 3E8RA 1L6JA 2EROA 3UVCA 4XM7A 1ZTQA 1C8TA 1C7KA 1D7XA 1YCMA 1IABA 1R54A 1QJJA 1JAOA 1KAPP 2MLSA 1PWWA 1BUVM 1AKLA 1UMTA 1MMBA 1GE6A 5D2BA 4H1QA 4JA1A 1SLNA 4GUYA 1QUAA 3ZUKA 1JK3A 2OVZA 1G12A 2J83A 5I3MA 1PWVA 2Z2DA 1XFXA 1YQYA 5D1UA 3KMEA 1KUHA 2MZEA 1MMPA 1O0TA 3KEKA 3WV3A 1DMTA 3HDAP 3KWVC 4WKIA 4FVLA 4PKQA 5D3CA 1XFZA 4IN9A 1FLSA 1HOVA 1ROSA 2X3AA 1BKCI 3KHIA 3HY7A 1D8FA 1GO8P 1HY7A 4DD8A 3EDIA 5H8XA 3LE9A 1XFVA 5L79A 1XURA 1ASTA 1Q3AA 1SMPA 3KECA 3VTGA 1PWQA 2DW0A 2QPJA 2YB9A 4G0DA 2X3BA 3NX7A 2YIGA 2WO8A 456CA 2OW0A 2OZRA 5I4OA 4WF6A 3LQ0A 4PKTA 3K7LA 3TS4A 1UMSA 1OM8A 3O2XA 1SRPA 3LJZA 1HFSA 3AYUA 4FXYP 1SU3A 1XFUA 4I35A 5LABA 3HBUP 1Y8JA 2MLRA 5B5OA 3LJGA 1O0QA 5L7FA 3RTSA 4H82A 1OM7A 1XUDA 3B92A 3MA2A 1MMQA 2JT5A 1R55A 1GE7A 5I43A 2K2GA 2O36A 3BA0A 4JP4A 3KRYA 2O3EA 4XM6A 3OHOA 2RJPA 3CKIA 5D7WA 2FV9A 3DSLA 1QICA 2DDYA 1ATLA 2FV5A 2HU6A 4GF1A 1C3IA 2ERPA 3DPFA 2W13A 1I73A 4CTHA 5D1SA 1GXDA 2WO9A 1H71P 1BUDA 1ZP5A 2JSDA 2DW1A 3P24A 3HDBA 1EB6A 3RTTA 1G05A 2I47A 1JJ9A 1ND1A 966CA 2Y6CA 4ILWD 1UTZA 1ZXCA 3N2VA 1BQQM 1KUKA 3V96B 4XBHA 5I2ZA 1IAAA 2E3XA 4H84A 1YP1A 2OVXA 3F1AA 3HYGA 3WV2A 1CK7A 3P1VA 1JH1A 1FBLA 1B3DA 3F19A 2X3CA 1R1JA 3EDGA 3DNGA 4JPAA 3HB2P 2MZHA 4FU4A 4L19A 3B8ZA 3AIGA 3LMCA 1IAEA 4FXQA 4H2EA 3TVCA 1A86A 2XS4A 1S4BP 1CGLA 3F18A 3LUNA 4HX3A 3U1RA 2A8HA 3WV1A 1CAQA 1OO9A 2AYKA 2D1OA 4WK7A 3LIKA 1PWUA 4L63A 1GKCA 5CUHA 4QKZA 1BKCE 2OW9A 3ZVSA
chains in the Genus database with same CATH superfamily
1I1IP 3Q2HA 1JKYA 1MMRA 4AUOA 1PWPA 2SRTA 1EUBA 2USNA 2JIHA 1OS9A 2OXZA 1HTDA 1RMZA 4J4MA 1QJIA 4GQLA 1G9KA 1SATA 3L0TA 1UTTA 3I7GA 1R1IA 1R1HA 2Y6DA 1OS2A 5BPAA 1EAKA 1KUGA 1ZXVA 3TSKA 2DW2A 3EDZA 5CZMA 2E2DA 2K9CA 1JIZA 1Z3JA 4WKEA 1BKCA 4JIJA 1JAPA 3ZXHA 2TCLA 1UEAA 4H76A 1CQRA 3B2ZA 1JAQA 1IAGA 4AXQA 1BQOA 2D1NA 3I7IA 1I76A 4EFSA 4JQGA 3L0VA 1GKDA 2W15A 1BM6A 1KUIA 4G9LA 1K7GA 2L0RA 4ON1A 1CGEA 1KUFA 2AIGP 4XCTA 3USNA 1BZSA 2OY4A 1JIWP 2JT6A 1A85A 2W14A 1USNA 4DF9A 2OY2A 3ELMA 2W0DA 3LIRA 3LUMA 4H49A 3Q2GA 4Q1LA 4PKUA 2N8RA 1J7NA 1K7QA 3G5CA 2OXUA 1SLMA 4GR3A 1FM1A 1AF0A 1AYKA 3VI1A 1RM8A 1BSWA 1QIBA 3EHXA 3GBOA 2V4BA 4PKSA 1Y93A 4H3XA 2OW2A 1OZ9A 4HMAA 3DPEA 5I0LA 2CKIA 1MNCA 3EHYA 4PKRA 2CLTA 3LILA 1B8YA 1GO7P 2DDFA 1D8MA 4DV8A 2W12A 1XFWA 2JNPA 1ZS0A 4IUWA 4IJOA 5JMYA 3LK8A 3DWBA 4WZVA 2ERQA 1OM6A 2XS3A 1IACA 2OXWA 3DTIA 2X7MA 3LEAA 1K7IA 4XM8A 4GR8A 3N2UA 3KEJA 1OMJA 1TVIA 2POJA 4GWMA 3AYKA 3EDHA 1DTHA 1CIZA 2RJQA 1HV5A 3LGPA 3LJTA 1XM5A 3LKAA 4A7BA 1CGFA 4AYKA 5CXAA 1QIAA 4H30A 3K7NA 1ZVXA 1IADA 3EWJA 3KMCA 5I12A 1YOUA 2YUFA 1HFCA 3F17A 4DPEA 1G4KA 1G49A 1D5JA 5BOTA 1XFYA 1BIWA 2KRJA 5D1TA 4GWNA 4PKWA 3HY9A 2WOAA 4ZR5A 1WNIA 2PJTA 3HBVP 1JANA 4A3WA 3F16A 4I03A 3SHIA 2OI0A 3TT4A 1Y0VA 2OW1A 3DL1A 4GR0A 1XUCA 3G42A 4PKVA 1GE5A 3OHLA 4L6TA 3DTKA 1CXVA 830CA 1KBCA 5BOYA 2MZIA 3O64A 3LQBA 4AIGA 5B5PA 4R3VA 2J0TA 3F15A 3E8RA 1L6JA 2EROA 3UVCA 4XM7A 1ZTQA 1C8TA 1C7KA 1D7XA 1YCMA 1IABA 1R54A 1QJJA 1JAOA 1KAPP 2MLSA 1PWWA 1BUVM 1AKLA 1UMTA 1MMBA 1GE6A 5D2BA 4H1QA 4JA1A 1SLNA 4GUYA 1QUAA 3ZUKA 1JK3A 2OVZA 1G12A 2J83A 5I3MA 1PWVA 2Z2DA 1XFXA 1YQYA 5D1UA 3KMEA 1KUHA 2MZEA 3DTEA 1MMPA 1O0TA 4L7AA 3KEKA 3WV3A 1DMTA 3HDAP 3KWVC 4WKIA 4FVLA 4PKQA 5D3CA 1XFZA 4IN9A 1FLSA 1HOVA 1ROSA 2X3AA 1BKCI 3KHIA 3HY7A 1D8FA 1GO8P 1HY7A 4DD8A 3EDIA 5H8XA 3LE9A 1XFVA 5L79A 1XURA 1ASTA 1Q3AA 1SMPA 3KECA 3VTGA 1PWQA 2DW0A 2QPJA 2YB9A 4G0DA 2X3BA 3NX7A 2YIGA 2WO8A 456CA 2OW0A 2OZRA 5I4OA 4WF6A 3LQ0A 4PKTA 3K7LA 3TS4A 1UMSA 1OM8A 3O2XA 1SRPA 3LJZA 1HFSA 3AYUA 4FXYP 1SU3A 1XFUA 4I35A 5LABA 3HBUP 1Y8JA 2MLRA 5B5OA 3LJGA 1O0QA 5L7FA 3RTSA 4H82A 1OM7A 1XUDA 3B92A 3MA2A 1MMQA 2JT5A 1R55A 1GE7A 5I43A 2K2GA 2O36A 3BA0A 4JP4A 3KRYA 2O3EA 4XM6A 3OHOA 2RJPA 3CKIA 5D7WA 2FV9A 3DSLA 1QICA 2DDYA 1ATLA 2FV5A 2HU6A 4GF1A 1C3IA 2ERPA 3DPFA 2W13A 1I73A 4CTHA 5D1SA 1GXDA 2WO9A 1H71P 1BUDA 1ZP5A 2JSDA 2DW1A 3P24A 3HDBA 1EB6A 3RTTA 1G05A 2I47A 1JJ9A 1ND1A 966CA 2Y6CA 4ILWD 1UTZA 1ZXCA 3N2VA 1BQQM 1KUKA 3V96B 4XBHA 5I2ZA 1IAAA 2E3XA 4H84A 1YP1A 2OVXA 3F1AA 3HYGA 3WV2A 1CK7A 3P1VA 1JH1A 1FBLA 1B3DA 3F19A 2X3CA 1R1JA 3EDGA 3DNGA 4JPAA 3HB2P 2MZHA 4FU4A 4L19A 3B8ZA 3AIGA 3LMCA 1IAEA 4FXQA 4H2EA 3TVCA 1A86A 2XS4A 1S4BP 1CGLA 3F18A 3LUNA 4HX3A 1XAXA 3U1RA 2A8HA 3WV1A 1CAQA 1OO9A 2AYKA 2D1OA 4WK7A 3LIKA 1PWUA 4L63A 1GKCA 5CUHA 4QKZA 1BKCE 2OW9A 3ZVSA
chains in the Genus database with same CATH topology
1I1IP 3Q2HA 1JKYA 1MMRA 4AUOA 1PWPA 2SRTA 1EUBA 2USNA 2JIHA 1OS9A 2OXZA 1HTDA 1RMZA 4J4MA 1QJIA 4GQLA 1G9KA 1SATA 3L0TA 1UTTA 3I7GA 1R1IA 1R1HA 2Y6DA 1OS2A 5BPAA 1EAKA 1KUGA 1ZXVA 3TSKA 2DW2A 3EDZA 5CZMA 2E2DA 2K9CA 1JIZA 1Z3JA 4WKEA 1BKCA 4JIJA 1JAPA 3ZXHA 2TCLA 1UEAA 4H76A 1CQRA 3B2ZA 1JAQA 1IAGA 4AXQA 1BQOA 2D1NA 3I7IA 1I76A 4EFSA 4JQGA 3L0VA 1GKDA 2W15A 1BM6A 1KUIA 4G9LA 1K7GA 2L0RA 4ON1A 1CGEA 1KUFA 2AIGP 4XCTA 3USNA 1BZSA 2OY4A 1JIWP 2JT6A 1A85A 2W14A 1USNA 4DF9A 2OY2A 3ELMA 2W0DA 3LIRA 3LUMA 4H49A 3Q2GA 4Q1LA 4PKUA 2N8RA 1J7NA 1K7QA 3G5CA 2OXUA 1SLMA 4GR3A 1FM1A 1AF0A 1AYKA 3VI1A 1RM8A 1BSWA 1QIBA 3EHXA 3GBOA 2V4BA 4PKSA 1Y93A 4H3XA 2OW2A 4HMAA 3DPEA 5I0LA 2CKIA 1MNCA 3EHYA 4PKRA 2CLTA 3LILA 1B8YA 1GO7P 2DDFA 1D8MA 4DV8A 2W12A 1XFWA 2JNPA 1ZS0A 4IUWA 4IJOA 5JMYA 3LK8A 3DWBA 4WZVA 2ERQA 1OM6A 2XS3A 1IACA 2OXWA 3DTIA 2X7MA 3LEAA 1K7IA 4XM8A 4GR8A 3N2UA 3KEJA 1OMJA 2POJA 4GWMA 3AYKA 3EDHA 1DTHA 1CIZA 2RJQA 1HV5A 3LGPA 3LJTA 3LKAA 4A7BA 1CGFA 4AYKA 5CXAA 1QIAA 4H30A 3K7NA 1ZVXA 1IADA 3EWJA 3KMCA 5I12A 1YOUA 2YUFA 1HFCA 3F17A 4DPEA 1G4KA 1G49A 1D5JA 5BOTA 1XFYA 1BIWA 2KRJA 5D1TA 4GWNA 4PKWA 3HY9A 2WOAA 4ZR5A 1WNIA 2PJTA 3HBVP 1JANA 4A3WA 3F16A 4I03A 3SHIA 2OI0A 3TT4A 1Y0VA 2OW1A 3DL1A 4GR0A 1XUCA 3G42A 4PKVA 1GE5A 3OHLA 4L6TA 3DTKA 1CXVA 830CA 1KBCA 5BOYA 2MZIA 3O64A 3LQBA 4AIGA 5B5PA 4R3VA 2J0TA 3F15A 3E8RA 1L6JA 2EROA 3UVCA 4XM7A 1ZTQA 1C8TA 1C7KA 1D7XA 1YCMA 1IABA 1R54A 1QJJA 1JAOA 1KAPP 2MLSA 1PWWA 1BUVM 1AKLA 1UMTA 1MMBA 1GE6A 5D2BA 4H1QA 4JA1A 1SLNA 4GUYA 1QUAA 3ZUKA 1JK3A 2OVZA 1G12A 2J83A 5I3MA 1PWVA 2Z2DA 1XFXA 1YQYA 5D1UA 3KMEA 1KUHA 2MZEA 3DTEA 1MMPA 1O0TA 4L7AA 3KEKA 3WV3A 1DMTA 3HDAP 3KWVC 4WKIA 4FVLA 4PKQA 5D3CA 1XFZA 4IN9A 1FLSA 1HOVA 1ROSA 2X3AA 1BKCI 3KHIA 3HY7A 1D8FA 1GO8P 1HY7A 4DD8A 3EDIA 5H8XA 3LE9A 1XFVA 5L79A 1XURA 1ASTA 1Q3AA 1SMPA 3KECA 3VTGA 1PWQA 2DW0A 2QPJA 2YB9A 4G0DA 2X3BA 3NX7A 2YIGA 2WO8A 456CA 2OW0A 2OZRA 5I4OA 4WF6A 3LQ0A 4PKTA 3K7LA 3TS4A 1UMSA 1OM8A 3O2XA 1SRPA 3LJZA 1HFSA 3AYUA 4FXYP 1SU3A 1XFUA 4I35A 5LABA 3HBUP 1Y8JA 2MLRA 5B5OA 3LJGA 1O0QA 5L7FA 3RTSA 4H82A 1OM7A 1XUDA 3B92A 3MA2A 1MMQA 2JT5A 1R55A 1GE7A 5I43A 2K2GA 2O36A 3BA0A 4JP4A 3KRYA 2O3EA 4XM6A 3OHOA 2RJPA 3CKIA 5D7WA 2FV9A 3DSLA 1QICA 2DDYA 1ATLA 2FV5A 2HU6A 4GF1A 1C3IA 2ERPA 3DPFA 2W13A 1I73A 4CTHA 5D1SA 1GXDA 2WO9A 1H71P 1BUDA 1ZP5A 2JSDA 2DW1A 3P24A 3HDBA 1EB6A 3RTTA 1G05A 2I47A 1JJ9A 1ND1A 966CA 2Y6CA 4ILWD 1UTZA 1ZXCA 3N2VA 1BQQM 1KUKA 3V96B 4XBHA 5I2ZA 1IAAA 2E3XA 4H84A 1YP1A 2OVXA 3F1AA 3HYGA 3WV2A 1CK7A 3P1VA 1JH1A 1FBLA 1B3DA 3F19A 2X3CA 1R1JA 3EDGA 3DNGA 4JPAA 3HB2P 2MZHA 4FU4A 4L19A 3B8ZA 3AIGA 3LMCA 1IAEA 4FXQA 4H2EA 3TVCA 1A86A 2XS4A 1S4BP 1CGLA 3F18A 3LUNA 4HX3A 3U1RA 2A8HA 3WV1A 1CAQA 1OO9A 2AYKA 2D1OA 4WK7A 3LIKA 1PWUA 4L63A 1GKCA 5CUHA 4QKZA 1BKCE 2OW9A 3ZVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1I P;  3Q2H A;  1JKY A;  1MMR A;  4AUO A;  1PWP A;  2SRT A;  1EUB A;  2USN A;  2JIH A;  1OS9 A;  2OXZ A;  1HTD A;  1RMZ A;  4J4M A;  1QJI A;  4GQL A;  1G9K A;  1SAT A;  3L0T A;  1UTT A;  3I7G A;  1R1I A;  1R1H A;  2Y6D A;  1OS2 A;  5BPA A;  1EAK A;  1KUG A;  1ZXV A;  3TSK A;  2DW2 A;  3EDZ A;  5CZM A;  2E2D A;  2K9C A;  1JIZ A;  1Z3J A;  4WKE A;  1BKC A;  4JIJ A;  1JAP A;  3ZXH A;  2TCL A;  1UEA A;  4H76 A;  1CQR A;  3B2Z A;  1JAQ A;  1IAG A;  4AXQ A;  1BQO A;  2D1N A;  3I7I A;  1I76 A;  4EFS A;  4JQG A;  3L0V A;  1GKD A;  2W15 A;  1BM6 A;  1KUI A;  4G9L A;  1K7G A;  2L0R A;  4ON1 A;  1CGE A;  1KUF A;  2AIG P;  4XCT A;  3USN A;  1BZS A;  2OY4 A;  1JIW P;  2JT6 A;  1A85 A;  2W14 A;  1USN A;  4DF9 A;  2OY2 A;  3ELM A;  2W0D A;  3LIR A;  3LUM A;  4H49 A;  3Q2G A;  4Q1L A;  4PKU A;  2N8R A;  1J7N A;  1K7Q A;  3G5C A;  2OXU A;  1SLM A;  4GR3 A;  1FM1 A;  1AF0 A;  1AYK A;  3VI1 A;  1RM8 A;  1BSW A;  1QIB A;  3EHX A;  3GBO A;  2V4B A;  4PKS A;  1Y93 A;  4H3X A;  2OW2 A;  4HMA A;  3DPE A;  5I0L A;  2CKI A;  1MNC A;  3EHY A;  4PKR A;  2CLT A;  3LIL A;  1B8Y A;  1GO7 P;  2DDF A;  1D8M A;  4DV8 A;  2W12 A;  1XFW A;  2JNP A;  1ZS0 A;  4IUW A;  4IJO A;  5JMY A;  3LK8 A;  3DWB A;  4WZV A;  2ERQ A;  1OM6 A;  2XS3 A;  1IAC A;  2OXW A;  2X7M A;  3LEA A;  1K7I A;  4XM8 A;  4GR8 A;  3N2U A;  3KEJ A;  1OMJ A;  2POJ A;  4GWM A;  3AYK A;  3EDH A;  1DTH A;  1CIZ A;  2RJQ A;  1HV5 A;  3LGP A;  3LJT A;  3LKA A;  4A7B A;  1CGF A;  4AYK A;  5CXA A;  1QIA A;  4H30 A;  3K7N A;  1ZVX A;  1IAD A;  3EWJ A;  3KMC A;  5I12 A;  1YOU A;  1HFC A;  3F17 A;  4DPE A;  1G4K A;  1G49 A;  1D5J A;  5BOT A;  1XFY A;  1BIW A;  2KRJ A;  5D1T A;  4GWN A;  4PKW A;  3HY9 A;  2WOA A;  4ZR5 A;  1WNI A;  2PJT A;  3HBV P;  1JAN A;  4A3W A;  3F16 A;  4I03 A;  3SHI A;  2OI0 A;  3TT4 A;  1Y0V A;  2OW1 A;  3DL1 A;  4GR0 A;  1XUC A;  3G42 A;  4PKV A;  1GE5 A;  3OHL A;  4L6T A;  1CXV A;  830C A;  1KBC A;  5BOY A;  2MZI A;  3O64 A;  3LQB A;  4AIG A;  5B5P A;  4R3V A;  2J0T A;  3F15 A;  3E8R A;  1L6J A;  2ERO A;  3UVC A;  4XM7 A;  1ZTQ A;  1C8T A;  1C7K A;  1D7X A;  1YCM A;  1IAB A;  1R54 A;  1QJJ A;  1JAO A;  1KAP P;  2MLS A;  1PWW A;  1BUV M;  1AKL A;  1UMT A;  1MMB A;  1GE6 A;  5D2B A;  4H1Q A;  4JA1 A;  1SLN A;  4GUY A;  1QUA A;  3ZUK A;  1JK3 A;  2OVZ A;  1G12 A;  2J83 A;  5I3M A;  1PWV A;  2Z2D A;  1XFX A;  1YQY A;  5D1U A;  3KME A;  1KUH A;  2MZE A;  1MMP A;  1O0T A;  3KEK A;  3WV3 A;  1DMT A;  3HDA P;  3KWV C;  4WKI A;  4FVL A;  4PKQ A;  5D3C A;  1XFZ A;  4IN9 A;  1FLS A;  1HOV A;  1ROS A;  2X3A A;  1BKC I;  3KHI A;  3HY7 A;  1D8F A;  1GO8 P;  1HY7 A;  4DD8 A;  3EDI A;  5H8X A;  3LE9 A;  1XFV A;  5L79 A;  1XUR A;  1AST A;  1Q3A A;  1SMP A;  3KEC A;  3VTG A;  1PWQ A;  2DW0 A;  2QPJ A;  2YB9 A;  4G0D A;  2X3B A;  3NX7 A;  2YIG A;  2WO8 A;  456C A;  2OW0 A;  2OZR A;  5I4O A;  4WF6 A;  3LQ0 A;  4PKT A;  3K7L A;  3TS4 A;  1UMS A;  1OM8 A;  3O2X A;  1SRP A;  3LJZ A;  1HFS A;  3AYU A;  4FXY P;  1SU3 A;  1XFU A;  4I35 A;  5LAB A;  3HBU P;  1Y8J A;  2MLR A;  5B5O A;  3LJG A;  1O0Q A;  5L7F A;  3RTS A;  4H82 A;  1OM7 A;  1XUD A;  3B92 A;  3MA2 A;  1MMQ A;  2JT5 A;  1R55 A;  1GE7 A;  5I43 A;  2K2G A;  2O36 A;  3BA0 A;  4JP4 A;  3KRY A;  2O3E A;  4XM6 A;  3OHO A;  2RJP A;  3CKI A;  5D7W A;  2FV9 A;  3DSL A;  1QIC A;  2DDY A;  1ATL A;  2FV5 A;  2HU6 A;  4GF1 A;  1C3I A;  2ERP A;  3DPF A;  2W13 A;  1I73 A;  4CTH A;  5D1S A;  1GXD A;  2WO9 A;  1H71 P;  1BUD A;  1ZP5 A;  2JSD A;  2DW1 A;  3P24 A;  3HDB A;  1EB6 A;  3RTT A;  1G05 A;  2I47 A;  1JJ9 A;  1ND1 A;  966C A;  2Y6C A;  4ILW D;  1UTZ A;  1ZXC A;  3N2V A;  1BQQ M;  1KUK A;  3V96 B;  4XBH A;  5I2Z A;  1IAA A;  2E3X A;  4H84 A;  1YP1 A;  2OVX A;  3F1A A;  3HYG A;  3WV2 A;  1CK7 A;  3P1V A;  1JH1 A;  1FBL A;  1B3D A;  3F19 A;  2X3C A;  1R1J A;  3EDG A;  3DNG A;  4JPA A;  3HB2 P;  2MZH A;  4FU4 A;  4L19 A;  3B8Z A;  3AIG A;  3LMC A;  1IAE A;  4FXQ A;  4H2E A;  3TVC A;  1A86 A;  2XS4 A;  1S4B P;  1CGL A;  3F18 A;  3LUN A;  4HX3 A;  3U1R A;  2A8H A;  3WV1 A;  1CAQ A;  1OO9 A;  2AYK A;  2D1O A;  4WK7 A;  3LIK A;  1PWU A;  4L63 A;  1GKC A;  5CUH A;  4QKZ A;  1BKC E;  2OW9 A;  3ZVS A; 
#chains in the Genus database with same CATH topology
 1I1I P;  3Q2H A;  1JKY A;  1MMR A;  4AUO A;  1PWP A;  2SRT A;  1EUB A;  2USN A;  2JIH A;  1OS9 A;  2OXZ A;  1HTD A;  1RMZ A;  4J4M A;  1QJI A;  4GQL A;  1G9K A;  1SAT A;  3L0T A;  1UTT A;  3I7G A;  1R1I A;  1R1H A;  2Y6D A;  1OS2 A;  5BPA A;  1EAK A;  1KUG A;  1ZXV A;  3TSK A;  2DW2 A;  3EDZ A;  5CZM A;  2E2D A;  2K9C A;  1JIZ A;  1Z3J A;  4WKE A;  1BKC A;  4JIJ A;  1JAP A;  3ZXH A;  2TCL A;  1UEA A;  4H76 A;  1CQR A;  3B2Z A;  1JAQ A;  1IAG A;  4AXQ A;  1BQO A;  2D1N A;  3I7I A;  1I76 A;  4EFS A;  4JQG A;  3L0V A;  1GKD A;  2W15 A;  1BM6 A;  1KUI A;  4G9L A;  1K7G A;  2L0R A;  4ON1 A;  1CGE A;  1KUF A;  2AIG P;  4XCT A;  3USN A;  1BZS A;  2OY4 A;  1JIW P;  2JT6 A;  1A85 A;  2W14 A;  1USN A;  4DF9 A;  2OY2 A;  3ELM A;  2W0D A;  3LIR A;  3LUM A;  4H49 A;  3Q2G A;  4Q1L A;  4PKU A;  2N8R A;  1J7N A;  1K7Q A;  3G5C A;  2OXU A;  1SLM A;  4GR3 A;  1FM1 A;  1AF0 A;  1AYK A;  3VI1 A;  1RM8 A;  1BSW A;  1QIB A;  3EHX A;  3GBO A;  2V4B A;  4PKS A;  1Y93 A;  4H3X A;  2OW2 A;  1OZ9 A;  4HMA A;  3DPE A;  5I0L A;  2CKI A;  1MNC A;  3EHY A;  4PKR A;  2CLT A;  3LIL A;  1B8Y A;  1GO7 P;  2DDF A;  1D8M A;  4DV8 A;  2W12 A;  1XFW A;  2JNP A;  1ZS0 A;  4IUW A;  4IJO A;  5JMY A;  3LK8 A;  3DWB A;  4WZV A;  2ERQ A;  1OM6 A;  2XS3 A;  1IAC A;  2OXW A;  3DTI A;  2X7M A;  3LEA A;  1K7I A;  4XM8 A;  4GR8 A;  3N2U A;  3KEJ A;  1OMJ A;  1TVI A;  2POJ A;  4GWM A;  3AYK A;  3EDH A;  1DTH A;  1CIZ A;  2RJQ A;  1HV5 A;  3LGP A;  3LJT A;  1XM5 A;  3LKA A;  4A7B A;  1CGF A;  4AYK A;  5CXA A;  1QIA A;  4H30 A;  3K7N A;  1ZVX A;  1IAD A;  3EWJ A;  3KMC A;  5I12 A;  1YOU A;  2YUF A;  1HFC A;  3F17 A;  4DPE A;  1G4K A;  1G49 A;  1D5J A;  5BOT A;  1XFY A;  1BIW A;  2KRJ A;  5D1T A;  4GWN A;  4PKW A;  3HY9 A;  2WOA A;  4ZR5 A;  1WNI A;  2PJT A;  3HBV P;  1JAN A;  4A3W A;  3F16 A;  4I03 A;  3SHI A;  2OI0 A;  3TT4 A;  1Y0V A;  2OW1 A;  3DL1 A;  4GR0 A;  1XUC A;  3G42 A;  4PKV A;  1GE5 A;  3OHL A;  4L6T A;  3DTK A;  1CXV A;  830C A;  1KBC A;  5BOY A;  2MZI A;  3O64 A;  3LQB A;  4AIG A;  5B5P A;  4R3V A;  2J0T A;  3F15 A;  3E8R A;  1L6J A;  2ERO A;  3UVC A;  4XM7 A;  1ZTQ A;  1C8T A;  1C7K A;  1D7X A;  1YCM A;  1IAB A;  1R54 A;  1QJJ A;  1JAO A;  1KAP P;  2MLS A;  1PWW A;  1BUV M;  1AKL A;  1UMT A;  1MMB A;  1GE6 A;  5D2B A;  4H1Q A;  4JA1 A;  1SLN A;  4GUY A;  1QUA A;  3ZUK A;  1JK3 A;  2OVZ A;  1G12 A;  2J83 A;  5I3M A;  1PWV A;  2Z2D A;  1XFX A;  1YQY A;  5D1U A;  3KME A;  1KUH A;  2MZE A;  3DTE A;  1MMP A;  1O0T A;  4L7A A;  3KEK A;  3WV3 A;  1DMT A;  3HDA P;  3KWV C;  4WKI A;  4FVL A;  4PKQ A;  5D3C A;  1XFZ A;  4IN9 A;  1FLS A;  1HOV A;  1ROS A;  2X3A A;  1BKC I;  3KHI A;  3HY7 A;  1D8F A;  1GO8 P;  1HY7 A;  4DD8 A;  3EDI A;  5H8X A;  3LE9 A;  1XFV A;  5L79 A;  1XUR A;  1AST A;  1Q3A A;  1SMP A;  3KEC A;  3VTG A;  1PWQ A;  2DW0 A;  2QPJ A;  2YB9 A;  4G0D A;  2X3B A;  3NX7 A;  2YIG A;  2WO8 A;  456C A;  2OW0 A;  2OZR A;  5I4O A;  4WF6 A;  3LQ0 A;  4PKT A;  3K7L A;  3TS4 A;  1UMS A;  1OM8 A;  3O2X A;  1SRP A;  3LJZ A;  1HFS A;  3AYU A;  4FXY P;  1SU3 A;  1XFU A;  4I35 A;  5LAB A;  3HBU P;  1Y8J A;  2MLR A;  5B5O A;  3LJG A;  1O0Q A;  5L7F A;  3RTS A;  4H82 A;  1OM7 A;  1XUD A;  3B92 A;  3MA2 A;  1MMQ A;  2JT5 A;  1R55 A;  1GE7 A;  5I43 A;  2K2G A;  2O36 A;  3BA0 A;  4JP4 A;  3KRY A;  2O3E A;  4XM6 A;  3OHO A;  2RJP A;  3CKI A;  5D7W A;  2FV9 A;  3DSL A;  1QIC A;  2DDY A;  1ATL A;  2FV5 A;  2HU6 A;  4GF1 A;  1C3I A;  2ERP A;  3DPF A;  2W13 A;  1I73 A;  4CTH A;  5D1S A;  1GXD A;  2WO9 A;  1H71 P;  1BUD A;  1ZP5 A;  2JSD A;  2DW1 A;  3P24 A;  3HDB A;  1EB6 A;  3RTT A;  1G05 A;  2I47 A;  1JJ9 A;  1ND1 A;  966C A;  2Y6C A;  4ILW D;  1UTZ A;  1ZXC A;  3N2V A;  1BQQ M;  1KUK A;  3V96 B;  4XBH A;  5I2Z A;  1IAA A;  2E3X A;  4H84 A;  1YP1 A;  2OVX A;  3F1A A;  3HYG A;  3WV2 A;  1CK7 A;  3P1V A;  1JH1 A;  1FBL A;  1B3D A;  3F19 A;  2X3C A;  1R1J A;  3EDG A;  3DNG A;  4JPA A;  3HB2 P;  2MZH A;  4FU4 A;  4L19 A;  3B8Z A;  3AIG A;  3LMC A;  1IAE A;  4FXQ A;  4H2E A;  3TVC A;  1A86 A;  2XS4 A;  1S4B P;  1CGL A;  3F18 A;  3LUN A;  4HX3 A;  1XAX A;  3U1R A;  2A8H A;  3WV1 A;  1CAQ A;  1OO9 A;  2AYK A;  2D1O A;  4WK7 A;  3LIK A;  1PWU A;  4L63 A;  1GKC A;  5CUH A;  4QKZ A;  1BKC E;  2OW9 A;  3ZVS A; 
#chains in the Genus database with same CATH homology
 1I1I P;  3Q2H A;  1JKY A;  1MMR A;  4AUO A;  1PWP A;  2SRT A;  1EUB A;  2USN A;  2JIH A;  1OS9 A;  2OXZ A;  1HTD A;  1RMZ A;  4J4M A;  1QJI A;  4GQL A;  1G9K A;  1SAT A;  3L0T A;  1UTT A;  3I7G A;  1R1I A;  1R1H A;  2Y6D A;  1OS2 A;  5BPA A;  1EAK A;  1KUG A;  1ZXV A;  3TSK A;  2DW2 A;  3EDZ A;  5CZM A;  2E2D A;  2K9C A;  1JIZ A;  1Z3J A;  4WKE A;  1BKC A;  4JIJ A;  1JAP A;  3ZXH A;  2TCL A;  1UEA A;  4H76 A;  1CQR A;  3B2Z A;  1JAQ A;  1IAG A;  4AXQ A;  1BQO A;  2D1N A;  3I7I A;  1I76 A;  4EFS A;  4JQG A;  3L0V A;  1GKD A;  2W15 A;  1BM6 A;  1KUI A;  4G9L A;  1K7G A;  2L0R A;  4ON1 A;  1CGE A;  1KUF A;  2AIG P;  4XCT A;  3USN A;  1BZS A;  2OY4 A;  1JIW P;  2JT6 A;  1A85 A;  2W14 A;  1USN A;  4DF9 A;  2OY2 A;  3ELM A;  2W0D A;  3LIR A;  3LUM A;  4H49 A;  3Q2G A;  4Q1L A;  4PKU A;  2N8R A;  1J7N A;  1K7Q A;  3G5C A;  2OXU A;  1SLM A;  4GR3 A;  1FM1 A;  1AF0 A;  1AYK A;  3VI1 A;  1RM8 A;  1BSW A;  1QIB A;  3EHX A;  3GBO A;  2V4B A;  4PKS A;  1Y93 A;  4H3X A;  2OW2 A;  4HMA A;  3DPE A;  5I0L A;  2CKI A;  1MNC A;  3EHY A;  4PKR A;  2CLT A;  3LIL A;  1B8Y A;  1GO7 P;  2DDF A;  1D8M A;  4DV8 A;  2W12 A;  1XFW A;  2JNP A;  1ZS0 A;  4IUW A;  4IJO A;  5JMY A;  3LK8 A;  3DWB A;  4WZV A;  2ERQ A;  1OM6 A;  2XS3 A;  1IAC A;  2OXW A;  3DTI A;  2X7M A;  3LEA A;  1K7I A;  4XM8 A;  4GR8 A;  3N2U A;  3KEJ A;  1OMJ A;  2POJ A;  4GWM A;  3AYK A;  3EDH A;  1DTH A;  1CIZ A;  2RJQ A;  1HV5 A;  3LGP A;  3LJT A;  3LKA A;  4A7B A;  1CGF A;  4AYK A;  5CXA A;  1QIA A;  4H30 A;  3K7N A;  1ZVX A;  1IAD A;  3EWJ A;  3KMC A;  5I12 A;  1YOU A;  2YUF A;  1HFC A;  3F17 A;  4DPE A;  1G4K A;  1G49 A;  1D5J A;  5BOT A;  1XFY A;  1BIW A;  2KRJ A;  5D1T A;  4GWN A;  4PKW A;  3HY9 A;  2WOA A;  4ZR5 A;  1WNI A;  2PJT A;  3HBV P;  1JAN A;  4A3W A;  3F16 A;  4I03 A;  3SHI A;  2OI0 A;  3TT4 A;  1Y0V A;  2OW1 A;  3DL1 A;  4GR0 A;  1XUC A;  3G42 A;  4PKV A;  1GE5 A;  3OHL A;  4L6T A;  3DTK A;  1CXV A;  830C A;  1KBC A;  5BOY A;  2MZI A;  3O64 A;  3LQB A;  4AIG A;  5B5P A;  4R3V A;  2J0T A;  3F15 A;  3E8R A;  1L6J A;  2ERO A;  3UVC A;  4XM7 A;  1ZTQ A;  1C8T A;  1C7K A;  1D7X A;  1YCM A;  1IAB A;  1R54 A;  1QJJ A;  1JAO A;  1KAP P;  2MLS A;  1PWW A;  1BUV M;  1AKL A;  1UMT A;  1MMB A;  1GE6 A;  5D2B A;  4H1Q A;  4JA1 A;  1SLN A;  4GUY A;  1QUA A;  3ZUK A;  1JK3 A;  2OVZ A;  1G12 A;  2J83 A;  5I3M A;  1PWV A;  2Z2D A;  1XFX A;  1YQY A;  5D1U A;  3KME A;  1KUH A;  2MZE A;  3DTE A;  1MMP A;  1O0T A;  4L7A A;  3KEK A;  3WV3 A;  1DMT A;  3HDA P;  3KWV C;  4WKI A;  4FVL A;  4PKQ A;  5D3C A;  1XFZ A;  4IN9 A;  1FLS A;  1HOV A;  1ROS A;  2X3A A;  1BKC I;  3KHI A;  3HY7 A;  1D8F A;  1GO8 P;  1HY7 A;  4DD8 A;  3EDI A;  5H8X A;  3LE9 A;  1XFV A;  5L79 A;  1XUR A;  1AST A;  1Q3A A;  1SMP A;  3KEC A;  3VTG A;  1PWQ A;  2DW0 A;  2QPJ A;  2YB9 A;  4G0D A;  2X3B A;  3NX7 A;  2YIG A;  2WO8 A;  456C A;  2OW0 A;  2OZR A;  5I4O A;  4WF6 A;  3LQ0 A;  4PKT A;  3K7L A;  3TS4 A;  1UMS A;  1OM8 A;  3O2X A;  1SRP A;  3LJZ A;  1HFS A;  3AYU A;  4FXY P;  1SU3 A;  1XFU A;  4I35 A;  5LAB A;  3HBU P;  1Y8J A;  2MLR A;  5B5O A;  3LJG A;  1O0Q A;  5L7F A;  3RTS A;  4H82 A;  1OM7 A;  1XUD A;  3B92 A;  3MA2 A;  1MMQ A;  2JT5 A;  1R55 A;  1GE7 A;  5I43 A;  2K2G A;  2O36 A;  3BA0 A;  4JP4 A;  3KRY A;  2O3E A;  4XM6 A;  3OHO A;  2RJP A;  3CKI A;  5D7W A;  2FV9 A;  3DSL A;  1QIC A;  2DDY A;  1ATL A;  2FV5 A;  2HU6 A;  4GF1 A;  1C3I A;  2ERP A;  3DPF A;  2W13 A;  1I73 A;  4CTH A;  5D1S A;  1GXD A;  2WO9 A;  1H71 P;  1BUD A;  1ZP5 A;  2JSD A;  2DW1 A;  3P24 A;  3HDB A;  1EB6 A;  3RTT A;  1G05 A;  2I47 A;  1JJ9 A;  1ND1 A;  966C A;  2Y6C A;  4ILW D;  1UTZ A;  1ZXC A;  3N2V A;  1BQQ M;  1KUK A;  3V96 B;  4XBH A;  5I2Z A;  1IAA A;  2E3X A;  4H84 A;  1YP1 A;  2OVX A;  3F1A A;  3HYG A;  3WV2 A;  1CK7 A;  3P1V A;  1JH1 A;  1FBL A;  1B3D A;  3F19 A;  2X3C A;  1R1J A;  3EDG A;  3DNG A;  4JPA A;  3HB2 P;  2MZH A;  4FU4 A;  4L19 A;  3B8Z A;  3AIG A;  3LMC A;  1IAE A;  4FXQ A;  4H2E A;  3TVC A;  1A86 A;  2XS4 A;  1S4B P;  1CGL A;  3F18 A;  3LUN A;  4HX3 A;  3U1R A;  2A8H A;  3WV1 A;  1CAQ A;  1OO9 A;  2AYK A;  2D1O A;  4WK7 A;  3LIK A;  1PWU A;  4L63 A;  1GKC A;  5CUH A;  4QKZ A;  1BKC E;  2OW9 A;  3ZVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...