1GKCA

Mmp9-inhibitor complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
b'FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 92 KDA TYPE IV COLLAGENASE
publication title Crystal Structure of Mmp9 in Complex with a Reverse Hydroxamate Inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2001-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1gkcA00
1MMRA 1BM6A 1FBLA 1D7XA 1CK7A 5D1TA 2OW0A 2OVZA 4H84A 2J0TA 1O0QA 1XUCA 1G05A 4Q1LA 1BKCI 1SRPA 2MZHA 3Q2HA 2MZEA 1BKCA 4EFSA 2X7MA 1XURA 3F16A 3LUNA 5CUHA 3ZVSA 4IUWA 2J83A 3DWBA 1ZS0A 1KAPP 1JIWP 4JA1A 2E3XA 1SATA 1Y0VA 1JJ9A 5JMYA 3KWVC 3L0TA 2JNPA 5LABA 3KRYA 2D1OA 966CA 1ND1A 1YQYA 4WZVA 1K7IA 1I1IP 3EHXA 3O2XA 4PKQA 3WV2A 3LJZA 1G49A 1Y8JA 3HYGA 3KEKA 3TSKA 3TS4A 3HDBA 3WV3A 3DNGA 1D8FA 1MMQA 1CQRA 1CGEA 2JT6A 3B2ZA 1DMTA 3LE9A 4H1QA 5D2BA 5BPAA 5BOTA 4JP4A 2Y6CA 4DV8A 1BIWA 2FV5A 2W15A 4GR8A 4H30A 5L79A 1YOUA 1KUIA 1HTDA 3B8ZA 4FU4A 2WO8A 2RJQA 3OHLA 4GUYA 3LILA 3EWJA 1G12A 1R1IA 2WO9A 4JPAA 1HV5A 2O3EA 1SMPA 1IAAA 4FXQA 2MLSA 2KRJA 3DL1A 1GO7P 3VI1A 1IABA 3LIKA 2E2DA 1L6JA 1BKCE 1OS9A 1USNA 3EDHA 1XFYA 1FM1A 2ERPA 3KECA 5BOYA 4XM7A 1B8YA 4JQGA 2K2GA 4HX3A 4I35A 2JIHA 3CKIA 1IAEA 1ZXCA 4H76A 4PKRA 4AIGA 2YB9A 4DF9A 5I43A 3HY9A 5CZMA 1UMSA 2YIGA 1A86A 1UMTA 1GKDA 1S4BP 4WF6A 1IACA 456CA 1MMBA 1B3DA 5D7WA 3F1AA 3HBVP 5L7FA 4JIJA 1XFWA 1AF0A 2N8RA 5D3CA 5I2ZA 1EUBA 2A8HA 2MZIA 2Z2DA 1EAKA 2SRTA 1BZSA 1R54A 3L0VA 4GQLA 2DDFA 1BQQM 1XUDA 3LIRA 1WNIA 1RM8A 3F15A 1HY7A 3LKAA 2OW9A 1OS2A 1QJJA 3U1RA 3WV1A 3ZUKA 3KMEA 2V4BA 1G4KA 3N2VA 4PKVA 1QICA 1D5JA 1UEAA 4PKWA 3K7LA 1OM7A 4ZR5A 1HFSA 1HFCA 1JAQA 1DTHA 4WKIA 3G5CA 5H8XA 1I73A 5D1SA 1ZXVA 4H49A 3AYUA 2OY2A 3F19A 4IN9A 4AXQA 2WOAA 3EHYA 1PWPA 1ZP5A 3ZXHA 1G9KA 5I3MA 3NX7A 1AYKA 2ERQA 4AUOA 4AYKA 5B5OA 3OHOA 3AYKA 4GF1A 5D1UA 2JSDA 1RMZA 1R55A 4J4MA 4L19A 1CGFA 4WKEA 3DPFA 1XFZA 3TT4A 2POJA 1ZVXA 3P24A 1C7KA 1QUAA 2OXUA 3USNA 830CA 1SU3A 4GWMA 5I4OA 2DW0A 2W14A 1PWUA 2OY4A 3O64A 1ASTA 3BA0A 1D8MA 4CTHA 2OXZA 2W0DA 4GR0A 4IJOA 1AKLA 2X3AA 4H2EA 1C8TA 2I47A 2AYKA 1SLNA 2EROA 3GBOA 1QJIA 3LQ0A 3SHIA 1R1HA 2XS3A 1EB6A 3MA2A 2DW1A 3LUMA 2W12A 1JANA 1GXDA 1I76A 1OMJA 1ATLA 4PKTA 3I7IA 2X3CA 4GR3A 4XM6A 2QPJA 3KEJA 2X3BA 1XFXA 3E8RA 1PWWA 1GE7A 4DPEA 2OVXA 1A85A 5CXAA 1K7GA 5B5PA 3LEAA 3VTGA 1BSWA 3B92A 3RTTA 2CKIA 3DPEA 5I0LA 4GWNA 1QIBA 1KUKA 1Q3AA 3EDGA 3Q2GA 3EDIA 4FXYP 1CIZA 4A7BA 1QIAA 2Y6DA 4H3XA 3KHIA 3F17A 1IAGA 2OW1A 1O0TA 2HU6A 3HY7A 1KBCA 1PWQA 1CGLA 1JK3A 1CAQA 3RTSA 1Y93A 2MLRA 4XBHA 2DDYA 1SLMA 1UTTA 1YCMA 4ON1A 2D1NA 1BQOA 4L6TA 4PKUA 1R1JA 4XM8A 2DW2A 4QKZA 2JT5A 3LJTA 3UVCA 1BUDA 3ELMA 4DD8A 1GKCA 2CLTA 1GO8P 2OXWA 2W13A 3HBUP 1KUGA 3HDAP 1OM6A 3K7NA 1JKYA 2O36A 1OM8A 4A3WA 1JIZA 1J7NA 4H82A 4WK7A 3LMCA 1OO9A 1ROSA 1GE5A 1BUVM 3AIGA 3F18A 1XFUA 2AIGP 4PKSA 2K9CA 1MMPA 2OI0A 4HMAA 1PWVA 1ZTQA 3I7GA 5I12A 2PJTA 4ILWD 2TCLA 3G42A 4G0DA 2RJPA 1GE6A 1K7QA 1IADA 2L0RA 2XS4A 3P1VA 1HOVA 3LJGA 2FV9A 1H71P 3LK8A 3EDZA 2OZRA 1UTZA 3LQBA 1C3IA 4I03A 3HB2P 1FLSA 1MNCA 1KUHA 3N2UA 1XFVA 2OW2A 4FVLA 1JAOA 1JH1A 3DSLA 1YP1A 4G9LA 1CXVA 4R3VA 1KUFA 3V96B 2USNA 3KMCA 1Z3JA 3LGPA 4XCTA 4L63A 3TVCA 1JAPA
chains in the Genus database with same CATH superfamily
1MMRA 1BM6A 1FBLA 1D7XA 1CK7A 5D1TA 2OW0A 2OVZA 4H84A 2J0TA 1O0QA 1XUCA 1G05A 4Q1LA 1BKCI 1SRPA 2MZHA 3Q2HA 2MZEA 1BKCA 4EFSA 2X7MA 1XURA 3F16A 3LUNA 5CUHA 3ZVSA 4IUWA 2J83A 3DWBA 1ZS0A 1KAPP 1JIWP 4JA1A 2E3XA 1SATA 1Y0VA 2YUFA 1JJ9A 5JMYA 3KWVC 3L0TA 2JNPA 5LABA 3KRYA 2D1OA 966CA 1ND1A 1YQYA 4WZVA 1K7IA 1I1IP 3EHXA 3O2XA 4PKQA 3WV2A 3LJZA 1G49A 1Y8JA 3HYGA 3KEKA 3TSKA 3TS4A 3HDBA 3WV3A 3DNGA 1D8FA 1MMQA 1CQRA 1CGEA 2JT6A 3B2ZA 1DMTA 3LE9A 4H1QA 5D2BA 5BPAA 5BOTA 4JP4A 2Y6CA 4DV8A 1BIWA 2FV5A 2W15A 4GR8A 4H30A 5L79A 1YOUA 1KUIA 1HTDA 3B8ZA 4FU4A 2WO8A 2RJQA 3OHLA 4GUYA 3LILA 3EWJA 1G12A 1R1IA 2WO9A 4JPAA 1HV5A 2O3EA 1SMPA 1IAAA 4FXQA 2MLSA 2KRJA 3DL1A 1GO7P 3VI1A 1IABA 3LIKA 2E2DA 1L6JA 1BKCE 1OS9A 1USNA 3EDHA 1XFYA 3DTIA 1FM1A 2ERPA 3KECA 5BOYA 4XM7A 1B8YA 4JQGA 2K2GA 1XM5A 4HX3A 4I35A 2JIHA 3CKIA 1IAEA 1ZXCA 4H76A 4PKRA 4AIGA 2YB9A 4DF9A 5I43A 3HY9A 5CZMA 1UMSA 2YIGA 1A86A 1UMTA 1GKDA 1S4BP 4WF6A 1IACA 456CA 1MMBA 1B3DA 5D7WA 3F1AA 3HBVP 5L7FA 4JIJA 1XFWA 1AF0A 2N8RA 5D3CA 5I2ZA 1EUBA 2A8HA 2MZIA 2Z2DA 1EAKA 2SRTA 1BZSA 1R54A 1TVIA 3L0VA 4GQLA 2DDFA 1BQQM 1XUDA 3LIRA 1WNIA 1RM8A 3F15A 1HY7A 3LKAA 2OW9A 1OS2A 1QJJA 3U1RA 3WV1A 3ZUKA 3KMEA 2V4BA 1G4KA 3N2VA 4PKVA 1QICA 1D5JA 1UEAA 4PKWA 3K7LA 1OM7A 4ZR5A 1HFSA 1HFCA 1JAQA 1DTHA 4WKIA 3G5CA 5H8XA 1I73A 5D1SA 1ZXVA 4H49A 3AYUA 3F19A 2OY2A 4IN9A 4AXQA 2WOAA 3EHYA 1PWPA 1ZP5A 3ZXHA 1G9KA 5I3MA 3NX7A 1AYKA 2ERQA 4AUOA 4AYKA 5B5OA 3OHOA 3AYKA 4GF1A 5D1UA 2JSDA 1RMZA 1R55A 4J4MA 4L19A 1CGFA 4WKEA 3DPFA 1XFZA 3TT4A 2POJA 1ZVXA 3P24A 1C7KA 1QUAA 2OXUA 3USNA 830CA 1SU3A 4GWMA 5I4OA 2DW0A 2W14A 1PWUA 1OZ9A 2OY4A 3O64A 1ASTA 3BA0A 1D8MA 4CTHA 2OXZA 2W0DA 4GR0A 4IJOA 1AKLA 2X3AA 4H2EA 1C8TA 2I47A 2AYKA 1XAXA 1SLNA 2EROA 3GBOA 1QJIA 3LQ0A 3SHIA 1R1HA 2XS3A 1EB6A 3MA2A 4L7AA 2DW1A 3LUMA 2W12A 1JANA 1GXDA 1I76A 1OMJA 1ATLA 4PKTA 3I7IA 2X3CA 4GR3A 4XM6A 2QPJA 3KEJA 2X3BA 1XFXA 3E8RA 1PWWA 1GE7A 4DPEA 2OVXA 1A85A 5CXAA 1K7GA 5B5PA 3LEAA 3VTGA 1BSWA 3B92A 3RTTA 2CKIA 3DPEA 5I0LA 4GWNA 1QIBA 1KUKA 1Q3AA 3EDGA 3Q2GA 3EDIA 4FXYP 1CIZA 4A7BA 1QIAA 2Y6DA 4H3XA 3KHIA 3F17A 1IAGA 2OW1A 1O0TA 2HU6A 3HY7A 1KBCA 1PWQA 1CGLA 1JK3A 1CAQA 3RTSA 1Y93A 2MLRA 4XBHA 2DDYA 1SLMA 1UTTA 1YCMA 4ON1A 2D1NA 1BQOA 4L6TA 4PKUA 1R1JA 4XM8A 2DW2A 4QKZA 2JT5A 3LJTA 3UVCA 1BUDA 3ELMA 4DD8A 1GKCA 2CLTA 1GO8P 2OXWA 2W13A 3HBUP 1KUGA 3HDAP 1OM6A 3K7NA 1JKYA 2O36A 1OM8A 4A3WA 1JIZA 1J7NA 4H82A 4WK7A 3LMCA 1OO9A 1ROSA 3DTEA 1GE5A 1BUVM 3AIGA 3F18A 1XFUA 2AIGP 4PKSA 2K9CA 1MMPA 2OI0A 4HMAA 1PWVA 1ZTQA 3I7GA 5I12A 2PJTA 4ILWD 2TCLA 3G42A 4G0DA 2RJPA 1GE6A 1K7QA 1IADA 2L0RA 2XS4A 3P1VA 1HOVA 3LJGA 2FV9A 1H71P 3LK8A 3EDZA 2OZRA 1UTZA 3LQBA 1C3IA 4I03A 3HB2P 1FLSA 1MNCA 3DTKA 1KUHA 3N2UA 1XFVA 2OW2A 4FVLA 1JAOA 1JH1A 3DSLA 1YP1A 4G9LA 1CXVA 4R3VA 1KUFA 3V96B 2USNA 3KMCA 1Z3JA 3LGPA 4XCTA 4L63A 3TVCA 1JAPA
chains in the Genus database with same CATH topology
1MMRA 1BM6A 1FBLA 1D7XA 1CK7A 5D1TA 2OW0A 2OVZA 4H84A 2J0TA 1O0QA 1XUCA 1G05A 4Q1LA 1BKCI 1SRPA 2MZHA 3Q2HA 2MZEA 1BKCA 4EFSA 2X7MA 1XURA 3F16A 3LUNA 5CUHA 3ZVSA 4IUWA 2J83A 3DWBA 1ZS0A 1KAPP 1JIWP 4JA1A 2E3XA 1SATA 1Y0VA 2YUFA 1JJ9A 5JMYA 3KWVC 3L0TA 2JNPA 5LABA 3KRYA 2D1OA 966CA 1ND1A 1YQYA 4WZVA 1K7IA 1I1IP 3EHXA 3O2XA 4PKQA 3WV2A 3LJZA 1G49A 1Y8JA 3HYGA 3KEKA 3TSKA 3TS4A 3HDBA 3WV3A 3DNGA 1D8FA 1MMQA 1CQRA 1CGEA 2JT6A 3B2ZA 1DMTA 3LE9A 4H1QA 5D2BA 5BPAA 5BOTA 4JP4A 2Y6CA 4DV8A 1BIWA 2FV5A 2W15A 4GR8A 4H30A 5L79A 1YOUA 1KUIA 1HTDA 3B8ZA 4FU4A 2WO8A 2RJQA 3OHLA 4GUYA 3LILA 3EWJA 1G12A 1R1IA 2WO9A 4JPAA 1HV5A 2O3EA 1SMPA 1IAAA 4FXQA 2MLSA 2KRJA 3DL1A 1GO7P 3VI1A 1IABA 3LIKA 2E2DA 1L6JA 1BKCE 1OS9A 1USNA 3EDHA 1XFYA 3DTIA 1FM1A 2ERPA 3KECA 5BOYA 4XM7A 1B8YA 4JQGA 2K2GA 4HX3A 4I35A 2JIHA 3CKIA 1IAEA 1ZXCA 4H76A 4PKRA 4AIGA 2YB9A 4DF9A 5I43A 3HY9A 5CZMA 1UMSA 2YIGA 1A86A 1UMTA 1GKDA 1S4BP 4WF6A 1IACA 456CA 1MMBA 1B3DA 5D7WA 3F1AA 3HBVP 5L7FA 4JIJA 1XFWA 1AF0A 2N8RA 5D3CA 5I2ZA 1EUBA 2A8HA 2MZIA 2Z2DA 1EAKA 2SRTA 1BZSA 1R54A 3L0VA 4GQLA 2DDFA 1BQQM 1XUDA 3LIRA 1WNIA 1RM8A 3F15A 1HY7A 3LKAA 2OW9A 1OS2A 1QJJA 3U1RA 3WV1A 3ZUKA 3KMEA 2V4BA 1G4KA 3N2VA 4PKVA 1QICA 1D5JA 1UEAA 4PKWA 3K7LA 1OM7A 4ZR5A 1HFSA 1HFCA 1JAQA 1DTHA 4WKIA 3G5CA 5H8XA 1I73A 5D1SA 1ZXVA 4H49A 3AYUA 3F19A 2OY2A 4IN9A 4AXQA 2WOAA 3EHYA 1PWPA 1ZP5A 3ZXHA 1G9KA 5I3MA 3NX7A 1AYKA 2ERQA 4AUOA 4AYKA 5B5OA 3OHOA 3AYKA 4GF1A 5D1UA 2JSDA 1RMZA 1R55A 4J4MA 4L19A 1CGFA 4WKEA 3DPFA 1XFZA 3TT4A 2POJA 1ZVXA 3P24A 1C7KA 1QUAA 2OXUA 3USNA 830CA 1SU3A 4GWMA 5I4OA 2DW0A 2W14A 1PWUA 2OY4A 3O64A 1ASTA 3BA0A 1D8MA 4CTHA 2OXZA 2W0DA 4GR0A 4IJOA 1AKLA 2X3AA 4H2EA 1C8TA 2I47A 2AYKA 1SLNA 2EROA 3GBOA 1QJIA 3LQ0A 3SHIA 1R1HA 2XS3A 1EB6A 3MA2A 4L7AA 2DW1A 3LUMA 2W12A 1JANA 1GXDA 1I76A 1OMJA 1ATLA 4PKTA 3I7IA 2X3CA 4GR3A 4XM6A 2QPJA 3KEJA 2X3BA 1XFXA 3E8RA 1PWWA 1GE7A 4DPEA 2OVXA 1A85A 5CXAA 1K7GA 5B5PA 3LEAA 3VTGA 1BSWA 3B92A 3RTTA 2CKIA 3DPEA 5I0LA 4GWNA 1QIBA 1KUKA 1Q3AA 3EDGA 3Q2GA 3EDIA 4FXYP 1CIZA 4A7BA 1QIAA 2Y6DA 4H3XA 3KHIA 3F17A 1IAGA 2OW1A 1O0TA 2HU6A 3HY7A 1KBCA 1PWQA 1CGLA 1JK3A 1CAQA 3RTSA 1Y93A 2MLRA 4XBHA 2DDYA 1SLMA 1UTTA 1YCMA 4ON1A 2D1NA 1BQOA 4L6TA 4PKUA 1R1JA 4XM8A 2DW2A 4QKZA 2JT5A 3LJTA 3UVCA 1BUDA 3ELMA 4DD8A 1GKCA 2CLTA 1GO8P 2OXWA 2W13A 3HBUP 1KUGA 3HDAP 1OM6A 3K7NA 1JKYA 2O36A 1OM8A 4A3WA 1JIZA 1J7NA 4H82A 4WK7A 3LMCA 1OO9A 1ROSA 3DTEA 1GE5A 1BUVM 3AIGA 3F18A 1XFUA 2AIGP 4PKSA 2K9CA 1MMPA 2OI0A 4HMAA 1PWVA 1ZTQA 3I7GA 5I12A 2PJTA 4ILWD 2TCLA 3G42A 4G0DA 2RJPA 1GE6A 1K7QA 1IADA 2L0RA 2XS4A 3P1VA 1HOVA 3LJGA 2FV9A 1H71P 3LK8A 3EDZA 2OZRA 1UTZA 3LQBA 1C3IA 4I03A 3HB2P 1FLSA 1MNCA 3DTKA 1KUHA 3N2UA 1XFVA 2OW2A 4FVLA 1JAOA 1JH1A 3DSLA 1YP1A 4G9LA 1CXVA 4R3VA 1KUFA 3V96B 2USNA 3KMCA 1Z3JA 3LGPA 4XCTA 4L63A 3TVCA 1JAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMR A;  1BM6 A;  1FBL A;  1D7X A;  1CK7 A;  5D1T A;  2OW0 A;  2OVZ A;  4H84 A;  2J0T A;  1O0Q A;  1XUC A;  1G05 A;  4Q1L A;  1BKC I;  1SRP A;  2MZH A;  3Q2H A;  2MZE A;  1BKC A;  4EFS A;  2X7M A;  1XUR A;  3F16 A;  3LUN A;  5CUH A;  3ZVS A;  4IUW A;  2J83 A;  3DWB A;  1ZS0 A;  1KAP P;  1JIW P;  4JA1 A;  2E3X A;  1SAT A;  1Y0V A;  1JJ9 A;  5JMY A;  3KWV C;  3L0T A;  2JNP A;  5LAB A;  3KRY A;  2D1O A;  966C A;  1ND1 A;  1YQY A;  4WZV A;  1K7I A;  1I1I P;  3EHX A;  3O2X A;  4PKQ A;  3WV2 A;  3LJZ A;  1G49 A;  1Y8J A;  3HYG A;  3KEK A;  3TSK A;  3TS4 A;  3HDB A;  3WV3 A;  3DNG A;  1D8F A;  1MMQ A;  1CQR A;  1CGE A;  2JT6 A;  3B2Z A;  1DMT A;  3LE9 A;  4H1Q A;  5D2B A;  5BPA A;  5BOT A;  4JP4 A;  2Y6C A;  4DV8 A;  1BIW A;  2FV5 A;  2W15 A;  4GR8 A;  4H30 A;  5L79 A;  1YOU A;  1KUI A;  1HTD A;  3B8Z A;  4FU4 A;  2WO8 A;  2RJQ A;  3OHL A;  4GUY A;  3LIL A;  3EWJ A;  1G12 A;  1R1I A;  2WO9 A;  4JPA A;  1HV5 A;  2O3E A;  1SMP A;  1IAA A;  4FXQ A;  2MLS A;  2KRJ A;  3DL1 A;  1GO7 P;  3VI1 A;  1IAB A;  3LIK A;  2E2D A;  1L6J A;  1BKC E;  1OS9 A;  1USN A;  3EDH A;  1XFY A;  1FM1 A;  2ERP A;  3KEC A;  5BOY A;  4XM7 A;  1B8Y A;  4JQG A;  2K2G A;  4HX3 A;  4I35 A;  2JIH A;  3CKI A;  1IAE A;  1ZXC A;  4H76 A;  4PKR A;  4AIG A;  2YB9 A;  4DF9 A;  5I43 A;  3HY9 A;  5CZM A;  1UMS A;  2YIG A;  1A86 A;  1UMT A;  1GKD A;  1S4B P;  4WF6 A;  1IAC A;  456C A;  1MMB A;  1B3D A;  5D7W A;  3F1A A;  3HBV P;  5L7F A;  4JIJ A;  1XFW A;  1AF0 A;  2N8R A;  5D3C A;  5I2Z A;  1EUB A;  2A8H A;  2MZI A;  2Z2D A;  1EAK A;  2SRT A;  1BZS A;  1R54 A;  3L0V A;  4GQL A;  2DDF A;  1BQQ M;  1XUD A;  3LIR A;  1WNI A;  1RM8 A;  3F15 A;  1HY7 A;  3LKA A;  2OW9 A;  1OS2 A;  1QJJ A;  3U1R A;  3WV1 A;  3ZUK A;  3KME A;  2V4B A;  1G4K A;  3N2V A;  4PKV A;  1QIC A;  1D5J A;  1UEA A;  4PKW A;  3K7L A;  1OM7 A;  4ZR5 A;  1HFS A;  1HFC A;  1JAQ A;  1DTH A;  4WKI A;  3G5C A;  5H8X A;  1I73 A;  5D1S A;  1ZXV A;  4H49 A;  3AYU A;  2OY2 A;  3F19 A;  4IN9 A;  4AXQ A;  2WOA A;  3EHY A;  1PWP A;  1ZP5 A;  3ZXH A;  1G9K A;  5I3M A;  3NX7 A;  1AYK A;  2ERQ A;  4AUO A;  4AYK A;  5B5O A;  3OHO A;  3AYK A;  4GF1 A;  5D1U A;  2JSD A;  1RMZ A;  1R55 A;  4J4M A;  4L19 A;  1CGF A;  4WKE A;  3DPF A;  1XFZ A;  3TT4 A;  2POJ A;  1ZVX A;  3P24 A;  1C7K A;  1QUA A;  2OXU A;  3USN A;  830C A;  1SU3 A;  4GWM A;  5I4O A;  2DW0 A;  2W14 A;  1PWU A;  2OY4 A;  3O64 A;  1AST A;  3BA0 A;  1D8M A;  4CTH A;  2OXZ A;  2W0D A;  4GR0 A;  4IJO A;  1AKL A;  2X3A A;  4H2E A;  1C8T A;  2I47 A;  2AYK A;  1SLN A;  2ERO A;  3GBO A;  1QJI A;  3LQ0 A;  3SHI A;  1R1H A;  2XS3 A;  1EB6 A;  3MA2 A;  2DW1 A;  3LUM A;  2W12 A;  1JAN A;  1GXD A;  1I76 A;  1OMJ A;  1ATL A;  4PKT A;  3I7I A;  2X3C A;  4GR3 A;  4XM6 A;  2QPJ A;  3KEJ A;  2X3B A;  1XFX A;  3E8R A;  1PWW A;  1GE7 A;  4DPE A;  2OVX A;  1A85 A;  5CXA A;  1K7G A;  5B5P A;  3LEA A;  3VTG A;  1BSW A;  3B92 A;  3RTT A;  2CKI A;  3DPE A;  5I0L A;  4GWN A;  1QIB A;  1KUK A;  1Q3A A;  3EDG A;  3Q2G A;  3EDI A;  4FXY P;  1CIZ A;  4A7B A;  1QIA A;  2Y6D A;  4H3X A;  3KHI A;  3F17 A;  1IAG A;  2OW1 A;  1O0T A;  2HU6 A;  3HY7 A;  1KBC A;  1PWQ A;  1CGL A;  1JK3 A;  1CAQ A;  3RTS A;  1Y93 A;  2MLR A;  4XBH A;  2DDY A;  1SLM A;  1UTT A;  1YCM A;  4ON1 A;  2D1N A;  1BQO A;  4L6T A;  4PKU A;  1R1J A;  4XM8 A;  2DW2 A;  4QKZ A;  2JT5 A;  3LJT A;  3UVC A;  1BUD A;  3ELM A;  4DD8 A;  1GKC A;  2CLT A;  1GO8 P;  2OXW A;  2W13 A;  3HBU P;  1KUG A;  3HDA P;  1OM6 A;  3K7N A;  1JKY A;  2O36 A;  1OM8 A;  4A3W A;  1JIZ A;  1J7N A;  4H82 A;  4WK7 A;  3LMC A;  1OO9 A;  1ROS A;  1GE5 A;  1BUV M;  3AIG A;  3F18 A;  1XFU A;  2AIG P;  4PKS A;  2K9C A;  1MMP A;  2OI0 A;  4HMA A;  1PWV A;  1ZTQ A;  3I7G A;  5I12 A;  2PJT A;  4ILW D;  2TCL A;  3G42 A;  4G0D A;  2RJP A;  1GE6 A;  1K7Q A;  1IAD A;  2L0R A;  2XS4 A;  3P1V A;  1HOV A;  3LJG A;  2FV9 A;  1H71 P;  3LK8 A;  3EDZ A;  2OZR A;  1UTZ A;  3LQB A;  1C3I A;  4I03 A;  3HB2 P;  1FLS A;  1MNC A;  1KUH A;  3N2U A;  1XFV A;  2OW2 A;  4FVL A;  1JAO A;  1JH1 A;  3DSL A;  1YP1 A;  4G9L A;  1CXV A;  4R3V A;  1KUF A;  3V96 B;  2USN A;  3KMC A;  1Z3J A;  3LGP A;  4XCT A;  4L63 A;  3TVC A;  1JAP A; 
#chains in the Genus database with same CATH topology
 1MMR A;  1BM6 A;  1FBL A;  1D7X A;  1CK7 A;  5D1T A;  2OW0 A;  2OVZ A;  4H84 A;  2J0T A;  1O0Q A;  1XUC A;  1G05 A;  4Q1L A;  1BKC I;  1SRP A;  2MZH A;  3Q2H A;  2MZE A;  1BKC A;  4EFS A;  2X7M A;  1XUR A;  3F16 A;  3LUN A;  5CUH A;  3ZVS A;  4IUW A;  2J83 A;  3DWB A;  1ZS0 A;  1KAP P;  1JIW P;  4JA1 A;  2E3X A;  1SAT A;  1Y0V A;  2YUF A;  1JJ9 A;  5JMY A;  3KWV C;  3L0T A;  2JNP A;  5LAB A;  3KRY A;  2D1O A;  966C A;  1ND1 A;  1YQY A;  4WZV A;  1K7I A;  1I1I P;  3EHX A;  3O2X A;  4PKQ A;  3WV2 A;  3LJZ A;  1G49 A;  1Y8J A;  3HYG A;  3KEK A;  3TSK A;  3TS4 A;  3HDB A;  3WV3 A;  3DNG A;  1D8F A;  1MMQ A;  1CQR A;  1CGE A;  2JT6 A;  3B2Z A;  1DMT A;  3LE9 A;  4H1Q A;  5D2B A;  5BPA A;  5BOT A;  4JP4 A;  2Y6C A;  4DV8 A;  1BIW A;  2FV5 A;  2W15 A;  4GR8 A;  4H30 A;  5L79 A;  1YOU A;  1KUI A;  1HTD A;  3B8Z A;  4FU4 A;  2WO8 A;  2RJQ A;  3OHL A;  4GUY A;  3LIL A;  3EWJ A;  1G12 A;  1R1I A;  2WO9 A;  4JPA A;  1HV5 A;  2O3E A;  1SMP A;  1IAA A;  4FXQ A;  2MLS A;  2KRJ A;  3DL1 A;  1GO7 P;  3VI1 A;  1IAB A;  3LIK A;  2E2D A;  1L6J A;  1BKC E;  1OS9 A;  1USN A;  3EDH A;  1XFY A;  3DTI A;  1FM1 A;  2ERP A;  3KEC A;  5BOY A;  4XM7 A;  1B8Y A;  4JQG A;  2K2G A;  1XM5 A;  4HX3 A;  4I35 A;  2JIH A;  3CKI A;  1IAE A;  1ZXC A;  4H76 A;  4PKR A;  4AIG A;  2YB9 A;  4DF9 A;  5I43 A;  3HY9 A;  5CZM A;  1UMS A;  2YIG A;  1A86 A;  1UMT A;  1GKD A;  1S4B P;  4WF6 A;  1IAC A;  456C A;  1MMB A;  1B3D A;  5D7W A;  3F1A A;  3HBV P;  5L7F A;  4JIJ A;  1XFW A;  1AF0 A;  2N8R A;  5D3C A;  5I2Z A;  1EUB A;  2A8H A;  2MZI A;  2Z2D A;  1EAK A;  2SRT A;  1BZS A;  1R54 A;  1TVI A;  3L0V A;  4GQL A;  2DDF A;  1BQQ M;  1XUD A;  3LIR A;  1WNI A;  1RM8 A;  3F15 A;  1HY7 A;  3LKA A;  2OW9 A;  1OS2 A;  1QJJ A;  3U1R A;  3WV1 A;  3ZUK A;  3KME A;  2V4B A;  1G4K A;  3N2V A;  4PKV A;  1QIC A;  1D5J A;  1UEA A;  4PKW A;  3K7L A;  1OM7 A;  4ZR5 A;  1HFS A;  1HFC A;  1JAQ A;  1DTH A;  4WKI A;  3G5C A;  5H8X A;  1I73 A;  5D1S A;  1ZXV A;  4H49 A;  3AYU A;  3F19 A;  2OY2 A;  4IN9 A;  4AXQ A;  2WOA A;  3EHY A;  1PWP A;  1ZP5 A;  3ZXH A;  1G9K A;  5I3M A;  3NX7 A;  1AYK A;  2ERQ A;  4AUO A;  4AYK A;  5B5O A;  3OHO A;  3AYK A;  4GF1 A;  5D1U A;  2JSD A;  1RMZ A;  1R55 A;  4J4M A;  4L19 A;  1CGF A;  4WKE A;  3DPF A;  1XFZ A;  3TT4 A;  2POJ A;  1ZVX A;  3P24 A;  1C7K A;  1QUA A;  2OXU A;  3USN A;  830C A;  1SU3 A;  4GWM A;  5I4O A;  2DW0 A;  2W14 A;  1PWU A;  1OZ9 A;  2OY4 A;  3O64 A;  1AST A;  3BA0 A;  1D8M A;  4CTH A;  2OXZ A;  2W0D A;  4GR0 A;  4IJO A;  1AKL A;  2X3A A;  4H2E A;  1C8T A;  2I47 A;  2AYK A;  1XAX A;  1SLN A;  2ERO A;  3GBO A;  1QJI A;  3LQ0 A;  3SHI A;  1R1H A;  2XS3 A;  1EB6 A;  3MA2 A;  4L7A A;  2DW1 A;  3LUM A;  2W12 A;  1JAN A;  1GXD A;  1I76 A;  1OMJ A;  1ATL A;  4PKT A;  3I7I A;  2X3C A;  4GR3 A;  4XM6 A;  2QPJ A;  3KEJ A;  2X3B A;  1XFX A;  3E8R A;  1PWW A;  1GE7 A;  4DPE A;  2OVX A;  1A85 A;  5CXA A;  1K7G A;  5B5P A;  3LEA A;  3VTG A;  1BSW A;  3B92 A;  3RTT A;  2CKI A;  3DPE A;  5I0L A;  4GWN A;  1QIB A;  1KUK A;  1Q3A A;  3EDG A;  3Q2G A;  3EDI A;  4FXY P;  1CIZ A;  4A7B A;  1QIA A;  2Y6D A;  4H3X A;  3KHI A;  3F17 A;  1IAG A;  2OW1 A;  1O0T A;  2HU6 A;  3HY7 A;  1KBC A;  1PWQ A;  1CGL A;  1JK3 A;  1CAQ A;  3RTS A;  1Y93 A;  2MLR A;  4XBH A;  2DDY A;  1SLM A;  1UTT A;  1YCM A;  4ON1 A;  2D1N A;  1BQO A;  4L6T A;  4PKU A;  1R1J A;  4XM8 A;  2DW2 A;  4QKZ A;  2JT5 A;  3LJT A;  3UVC A;  1BUD A;  3ELM A;  4DD8 A;  1GKC A;  2CLT A;  1GO8 P;  2OXW A;  2W13 A;  3HBU P;  1KUG A;  3HDA P;  1OM6 A;  3K7N A;  1JKY A;  2O36 A;  1OM8 A;  4A3W A;  1JIZ A;  1J7N A;  4H82 A;  4WK7 A;  3LMC A;  1OO9 A;  1ROS A;  3DTE A;  1GE5 A;  1BUV M;  3AIG A;  3F18 A;  1XFU A;  2AIG P;  4PKS A;  2K9C A;  1MMP A;  2OI0 A;  4HMA A;  1PWV A;  1ZTQ A;  3I7G A;  5I12 A;  2PJT A;  4ILW D;  2TCL A;  3G42 A;  4G0D A;  2RJP A;  1GE6 A;  1K7Q A;  1IAD A;  2L0R A;  2XS4 A;  3P1V A;  1HOV A;  3LJG A;  2FV9 A;  1H71 P;  3LK8 A;  3EDZ A;  2OZR A;  1UTZ A;  3LQB A;  1C3I A;  4I03 A;  3HB2 P;  1FLS A;  1MNC A;  3DTK A;  1KUH A;  3N2U A;  1XFV A;  2OW2 A;  4FVL A;  1JAO A;  1JH1 A;  3DSL A;  1YP1 A;  4G9L A;  1CXV A;  4R3V A;  1KUF A;  3V96 B;  2USN A;  3KMC A;  1Z3J A;  3LGP A;  4XCT A;  4L63 A;  3TVC A;  1JAP A; 
#chains in the Genus database with same CATH homology
 1MMR A;  1BM6 A;  1FBL A;  1D7X A;  1CK7 A;  5D1T A;  2OW0 A;  2OVZ A;  4H84 A;  2J0T A;  1O0Q A;  1XUC A;  1G05 A;  4Q1L A;  1BKC I;  1SRP A;  2MZH A;  3Q2H A;  2MZE A;  1BKC A;  4EFS A;  2X7M A;  1XUR A;  3F16 A;  3LUN A;  5CUH A;  3ZVS A;  4IUW A;  2J83 A;  3DWB A;  1ZS0 A;  1KAP P;  1JIW P;  4JA1 A;  2E3X A;  1SAT A;  1Y0V A;  2YUF A;  1JJ9 A;  5JMY A;  3KWV C;  3L0T A;  2JNP A;  5LAB A;  3KRY A;  2D1O A;  966C A;  1ND1 A;  1YQY A;  4WZV A;  1K7I A;  1I1I P;  3EHX A;  3O2X A;  4PKQ A;  3WV2 A;  3LJZ A;  1G49 A;  1Y8J A;  3HYG A;  3KEK A;  3TSK A;  3TS4 A;  3HDB A;  3WV3 A;  3DNG A;  1D8F A;  1MMQ A;  1CQR A;  1CGE A;  2JT6 A;  3B2Z A;  1DMT A;  3LE9 A;  4H1Q A;  5D2B A;  5BPA A;  5BOT A;  4JP4 A;  2Y6C A;  4DV8 A;  1BIW A;  2FV5 A;  2W15 A;  4GR8 A;  4H30 A;  5L79 A;  1YOU A;  1KUI A;  1HTD A;  3B8Z A;  4FU4 A;  2WO8 A;  2RJQ A;  3OHL A;  4GUY A;  3LIL A;  3EWJ A;  1G12 A;  1R1I A;  2WO9 A;  4JPA A;  1HV5 A;  2O3E A;  1SMP A;  1IAA A;  4FXQ A;  2MLS A;  2KRJ A;  3DL1 A;  1GO7 P;  3VI1 A;  1IAB A;  3LIK A;  2E2D A;  1L6J A;  1BKC E;  1OS9 A;  1USN A;  3EDH A;  1XFY A;  3DTI A;  1FM1 A;  2ERP A;  3KEC A;  5BOY A;  4XM7 A;  1B8Y A;  4JQG A;  2K2G A;  4HX3 A;  4I35 A;  2JIH A;  3CKI A;  1IAE A;  1ZXC A;  4H76 A;  4PKR A;  4AIG A;  2YB9 A;  4DF9 A;  5I43 A;  3HY9 A;  5CZM A;  1UMS A;  2YIG A;  1A86 A;  1UMT A;  1GKD A;  1S4B P;  4WF6 A;  1IAC A;  456C A;  1MMB A;  1B3D A;  5D7W A;  3F1A A;  3HBV P;  5L7F A;  4JIJ A;  1XFW A;  1AF0 A;  2N8R A;  5D3C A;  5I2Z A;  1EUB A;  2A8H A;  2MZI A;  2Z2D A;  1EAK A;  2SRT A;  1BZS A;  1R54 A;  3L0V A;  4GQL A;  2DDF A;  1BQQ M;  1XUD A;  3LIR A;  1WNI A;  1RM8 A;  3F15 A;  1HY7 A;  3LKA A;  2OW9 A;  1OS2 A;  1QJJ A;  3U1R A;  3WV1 A;  3ZUK A;  3KME A;  2V4B A;  1G4K A;  3N2V A;  4PKV A;  1QIC A;  1D5J A;  1UEA A;  4PKW A;  3K7L A;  1OM7 A;  4ZR5 A;  1HFS A;  1HFC A;  1JAQ A;  1DTH A;  4WKI A;  3G5C A;  5H8X A;  1I73 A;  5D1S A;  1ZXV A;  4H49 A;  3AYU A;  3F19 A;  2OY2 A;  4IN9 A;  4AXQ A;  2WOA A;  3EHY A;  1PWP A;  1ZP5 A;  3ZXH A;  1G9K A;  5I3M A;  3NX7 A;  1AYK A;  2ERQ A;  4AUO A;  4AYK A;  5B5O A;  3OHO A;  3AYK A;  4GF1 A;  5D1U A;  2JSD A;  1RMZ A;  1R55 A;  4J4M A;  4L19 A;  1CGF A;  4WKE A;  3DPF A;  1XFZ A;  3TT4 A;  2POJ A;  1ZVX A;  3P24 A;  1C7K A;  1QUA A;  2OXU A;  3USN A;  830C A;  1SU3 A;  4GWM A;  5I4O A;  2DW0 A;  2W14 A;  1PWU A;  2OY4 A;  3O64 A;  1AST A;  3BA0 A;  1D8M A;  4CTH A;  2OXZ A;  2W0D A;  4GR0 A;  4IJO A;  1AKL A;  2X3A A;  4H2E A;  1C8T A;  2I47 A;  2AYK A;  1SLN A;  2ERO A;  3GBO A;  1QJI A;  3LQ0 A;  3SHI A;  1R1H A;  2XS3 A;  1EB6 A;  3MA2 A;  4L7A A;  2DW1 A;  3LUM A;  2W12 A;  1JAN A;  1GXD A;  1I76 A;  1OMJ A;  1ATL A;  4PKT A;  3I7I A;  2X3C A;  4GR3 A;  4XM6 A;  2QPJ A;  3KEJ A;  2X3B A;  1XFX A;  3E8R A;  1PWW A;  1GE7 A;  4DPE A;  2OVX A;  1A85 A;  5CXA A;  1K7G A;  5B5P A;  3LEA A;  3VTG A;  1BSW A;  3B92 A;  3RTT A;  2CKI A;  3DPE A;  5I0L A;  4GWN A;  1QIB A;  1KUK A;  1Q3A A;  3EDG A;  3Q2G A;  3EDI A;  4FXY P;  1CIZ A;  4A7B A;  1QIA A;  2Y6D A;  4H3X A;  3KHI A;  3F17 A;  1IAG A;  2OW1 A;  1O0T A;  2HU6 A;  3HY7 A;  1KBC A;  1PWQ A;  1CGL A;  1JK3 A;  1CAQ A;  3RTS A;  1Y93 A;  2MLR A;  4XBH A;  2DDY A;  1SLM A;  1UTT A;  1YCM A;  4ON1 A;  2D1N A;  1BQO A;  4L6T A;  4PKU A;  1R1J A;  4XM8 A;  2DW2 A;  4QKZ A;  2JT5 A;  3LJT A;  3UVC A;  1BUD A;  3ELM A;  4DD8 A;  1GKC A;  2CLT A;  1GO8 P;  2OXW A;  2W13 A;  3HBU P;  1KUG A;  3HDA P;  1OM6 A;  3K7N A;  1JKY A;  2O36 A;  1OM8 A;  4A3W A;  1JIZ A;  1J7N A;  4H82 A;  4WK7 A;  3LMC A;  1OO9 A;  1ROS A;  3DTE A;  1GE5 A;  1BUV M;  3AIG A;  3F18 A;  1XFU A;  2AIG P;  4PKS A;  2K9C A;  1MMP A;  2OI0 A;  4HMA A;  1PWV A;  1ZTQ A;  3I7G A;  5I12 A;  2PJT A;  4ILW D;  2TCL A;  3G42 A;  4G0D A;  2RJP A;  1GE6 A;  1K7Q A;  1IAD A;  2L0R A;  2XS4 A;  3P1V A;  1HOV A;  3LJG A;  2FV9 A;  1H71 P;  3LK8 A;  3EDZ A;  2OZR A;  1UTZ A;  3LQB A;  1C3I A;  4I03 A;  3HB2 P;  1FLS A;  1MNC A;  3DTK A;  1KUH A;  3N2U A;  1XFV A;  2OW2 A;  4FVL A;  1JAO A;  1JH1 A;  3DSL A;  1YP1 A;  4G9L A;  1CXV A;  4R3V A;  1KUF A;  3V96 B;  2USN A;  3KMC A;  1Z3J A;  3LGP A;  4XCT A;  4L63 A;  3TVC A;  1JAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...