2DDYA

Solution structure of matrilysin (mmp-7) complexed to constraint conformational sulfonamide inhibitor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
173
Chain Sequence
YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Matrilysin
publication title Solution Structure of Matrilysin (MMP-7) Complexed to Constraint Conformational Sulfonamide Inhibitor
rcsb
source organism Homo sapiens
total genus 38
structure length 173
sequence length 173
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2ddyA00
2E2DA 4FXQA 1BIWA 1RM8A 3F17A 5L7FA 2J0TA 3B8ZA 1UTTA 1JIWP 2K9CA 2POJA 3EDHA 4PKRA 1Q3AA 3DL1A 1MMBA 3KEKA 3OHOA 1JJ9A 3EDGA 4QKZA 1B3DA 4WKEA 2L0RA 2D1NA 1GE6A 2OI0A 4PKVA 4GUYA 4XM8A 2J83A 4A7BA 1JAPA 1EB6A 3AYKA 1C8TA 2YB9A 3LJZA 1MMQA 3LKAA 3F18A 3ZXHA 2OVXA 3L0TA 1ZTQA 3LIRA 2ERQA 4GR3A 5BOYA 4H49A 1XFYA 1GO7P 1YP1A 1XUDA 2OW2A 2EROA 3LK8A 3UVCA 1R1HA 2FV5A 2MLRA 3AYUA 4IJOA 1MMRA 2WO9A 1BUVM 2W12A 1R54A 1OM6A 1CQRA 1FLSA 2MZIA 3LUMA 5I12A 1Z3JA 1IAEA 3DPEA 2OW0A 3RTTA 2FV9A 5D1UA 5I2ZA 2OY4A 3HDAP 2DDFA 3HDBA 1O0TA 3EDIA 5B5PA 1CGLA 2I47A 4WZVA 1OS2A 1Y8JA 3WV1A 1BZSA 1G49A 3MA2A 1YOUA 1CIZA 2X3BA 2W0DA 1HY7A 1WNIA 2OW1A 4FU4A 3G5CA 2DDYA 3KHIA 2QPJA 1DMTA 1KBCA 4H30A 1AYKA 4GR0A 4JP4A 1G9KA 1K7QA 1XFUA 5D1SA 3HY9A 4JIJA 2USNA 4WF6A 1I1IP 4L19A 4L63A 1ZVXA 4FVLA 4J4MA 4DV8A 5CUHA 1PWVA 5JMYA 1XFXA 2CLTA 1GKDA 1HTDA 1SMPA 4IN9A 1KUGA 4GF1A 3V96B 5H8XA 1USNA 1BQQM 3TSKA 4G9LA 2D1OA 2XS4A 3B2ZA 2AIGP 4G0DA 3E8RA 1JAQA 4AUOA 2X3AA 2OXZA 1J7NA 1G05A 1KUKA 966CA 1BUDA 1C3IA 1QIAA 2E3XA 1QUAA 2OY2A 1GE7A 2OW9A 4XBHA 1ZS0A 1PWWA 5L79A 3N2VA 3G42A 1Y93A 3Q2GA 3CKIA 1L6JA 3EWJA 3VI1A 3EDZA 4XCTA 2ERPA 2PJTA 4ILWD 3Q2HA 5BPAA 1O0QA 2Y6DA 4R3VA 1CGEA 3LUNA 2W13A 4AYKA 3LJTA 3I7GA 4I03A 4Q1LA 4L6TA 1UEAA 3F15A 2OZRA 3HBUP 3HB2P 3K7NA 3GBOA 2HU6A 2RJPA 3OHLA 4DD8A 3USNA 4H76A 2Z2DA 3N2UA 3U1RA 3KMCA 1JH1A 1ZXCA 1C7KA 1R55A 4I35A 3DSLA 1SRPA 3LGPA 1JAOA 1AKLA 4AIGA 830CA 1YQYA 2SRTA 1UMSA 3EHXA 5I3MA 1IAAA 3BA0A 1QJIA 2RJQA 1KUIA 1CXVA 2Y6CA 1I76A 3ELMA 1QJJA 2JT6A 4WKIA 2OVZA 1Y0VA 2MZHA 2DW2A 5I4OA 4DPEA 2JT5A 3ZUKA 2X3CA 4IUWA 5D7WA 1CAQA 5B5OA 3KRYA 1XFVA 4EFSA 3DNGA 3O2XA 1G4KA 3LE9A 1D7XA 1XUCA 1JKYA 1GKCA 5BOTA 1EAKA 1H71P 5D1TA 1ZXVA 3HBVP 1GXDA 1MNCA 4PKUA 2DW0A 4ON1A 5D2BA 2AYKA 1I73A 2N8RA 1GO8P 1S4BP 1JK3A 3O64A 4GQLA 1ND1A 3SHIA 1IAGA 1HOVA 1BQOA 1BKCI 1QICA 1BM6A 3LJGA 2WOAA 4DF9A 2A8HA 1OMJA 3LQBA 2W15A 1D8FA 4H1QA 3TT4A 1FBLA 1SU3A 1BSWA 2MZEA 4H84A 4A3WA 1BKCE 4PKSA 1IACA 1EUBA 1CGFA 3F16A 2JIHA 4XM6A 1IABA 3KWVC 3LIKA 2WO8A 4XM7A 1CK7A 4GR8A 2O3EA 1PWUA 1SLMA 1ROSA 3RTSA 4PKWA 1UMTA 3P24A 4PKQA 3P1VA 5LABA 1QIBA 1R1JA 1HFSA 1B8YA 4FXYP 5D3CA 2CKIA 3DPFA 1G12A 2V4BA 1IADA 2W14A 1MMPA 3LILA 1OS9A 4JPAA 3LQ0A 1XFZA 1A86A 3F1AA 3HY7A 1XURA 2DW1A 4JQGA 4HX3A 2O36A 1R1IA 2YIGA 1XFWA 4H2EA 2OXWA 1KAPP 1PWPA 3DWBA 2K2GA 1GE5A 1HFCA 4WK7A 4H82A 1HV5A 3B92A 4AXQA 3NX7A 2MLSA 1ATLA 4GWNA 4CTHA 1D8MA 3WV3A 1SLNA 1OO9A 2JNPA 3K7LA 3ZVSA 2XS3A 5CZMA 3KMEA 5CXAA 4GWMA 3LEAA 3VTGA 3AIGA 2KRJA 1YCMA 4PKTA 3WV2A 4ZR5A 3KECA 3F19A 3HYGA 4H3XA 1KUHA 3KEJA 1K7IA 1UTZA 2JSDA 1PWQA 1ZP5A 4JA1A 1DTHA 2X7MA 2TCLA 3LMCA 1KUFA 1RMZA 3EHYA 5I43A 3I7IA 1AF0A 1ASTA 1JANA 2OXUA 5I0LA 1OM7A 1A85A 4HMAA 3L0VA 1BKCA 1FM1A 1OM8A 1SATA 456CA 3TS4A 1K7GA 3TVCA 1D5JA 1JIZA
chains in the Genus database with same CATH superfamily
2E2DA 4FXQA 1BIWA 1RM8A 3F17A 5L7FA 2J0TA 3B8ZA 1UTTA 1JIWP 2K9CA 2POJA 3EDHA 4PKRA 1Q3AA 3DL1A 1MMBA 3KEKA 3OHOA 1JJ9A 3EDGA 4QKZA 1B3DA 4WKEA 2L0RA 2D1NA 1GE6A 2OI0A 4PKVA 4GUYA 4XM8A 2J83A 4A7BA 1JAPA 1EB6A 3AYKA 1C8TA 2YB9A 3LJZA 1MMQA 3LKAA 3F18A 3ZXHA 2OVXA 3L0TA 1ZTQA 3LIRA 2ERQA 4GR3A 5BOYA 4H49A 1XFYA 1GO7P 1YP1A 1XUDA 2OW2A 2EROA 3LK8A 3UVCA 1R1HA 2FV5A 2MLRA 3AYUA 4IJOA 1MMRA 2WO9A 1BUVM 2W12A 1R54A 1OM6A 1CQRA 1FLSA 2MZIA 3LUMA 5I12A 1Z3JA 1IAEA 3DPEA 2OW0A 3RTTA 2FV9A 5D1UA 5I2ZA 2OY4A 3HDAP 2YUFA 2DDFA 3HDBA 1O0TA 3EDIA 5B5PA 1CGLA 2I47A 4WZVA 1OS2A 1Y8JA 3WV1A 1BZSA 1G49A 3MA2A 1YOUA 1CIZA 2X3BA 2W0DA 1HY7A 1WNIA 2OW1A 4FU4A 3G5CA 2DDYA 3KHIA 2QPJA 1DMTA 1KBCA 4H30A 1AYKA 4GR0A 4JP4A 1G9KA 1K7QA 1XFUA 5D1SA 3HY9A 4JIJA 2USNA 4WF6A 1I1IP 4L19A 4L63A 1ZVXA 4FVLA 4J4MA 4DV8A 5CUHA 1PWVA 5JMYA 1XFXA 2CLTA 1GKDA 1HTDA 1SMPA 4IN9A 1KUGA 4GF1A 3V96B 5H8XA 1USNA 1BQQM 3TSKA 4G9LA 2D1OA 2XS4A 3B2ZA 2AIGP 4G0DA 3E8RA 1JAQA 4AUOA 2X3AA 2OXZA 1J7NA 1G05A 1KUKA 966CA 1BUDA 1C3IA 1QIAA 2E3XA 1QUAA 2OY2A 1GE7A 2OW9A 4XBHA 1ZS0A 1PWWA 5L79A 3N2VA 3G42A 1Y93A 3Q2GA 3CKIA 1L6JA 3EWJA 3VI1A 3EDZA 4XCTA 2ERPA 2PJTA 4ILWD 3Q2HA 3DTKA 5BPAA 1O0QA 2Y6DA 4R3VA 1CGEA 3LUNA 2W13A 4AYKA 3LJTA 3I7GA 4I03A 4Q1LA 4L6TA 1UEAA 3F15A 2OZRA 3HBUP 3HB2P 3K7NA 3GBOA 2HU6A 2RJPA 3OHLA 4DD8A 3USNA 4H76A 2Z2DA 3N2UA 3U1RA 3KMCA 1JH1A 1ZXCA 1C7KA 1R55A 4I35A 3DSLA 1SRPA 3LGPA 1JAOA 1AKLA 4AIGA 830CA 1TVIA 1YQYA 2SRTA 1UMSA 3EHXA 5I3MA 1IAAA 3BA0A 1QJIA 2RJQA 1KUIA 1CXVA 2Y6CA 1I76A 3ELMA 1QJJA 2JT6A 4WKIA 2OVZA 1Y0VA 2MZHA 2DW2A 5I4OA 4DPEA 2JT5A 3ZUKA 2X3CA 4IUWA 5D7WA 1CAQA 5B5OA 3KRYA 1XFVA 4EFSA 3DNGA 3O2XA 1G4KA 3LE9A 1D7XA 1XUCA 1JKYA 1GKCA 5BOTA 1EAKA 1H71P 5D1TA 1ZXVA 3HBVP 1GXDA 1MNCA 4PKUA 2DW0A 4ON1A 5D2BA 2AYKA 1I73A 2N8RA 1GO8P 1S4BP 1JK3A 3O64A 4GQLA 1ND1A 3SHIA 1IAGA 1HOVA 1BQOA 1BKCI 1QICA 1BM6A 3LJGA 2WOAA 4DF9A 2A8HA 1OMJA 3LQBA 2W15A 1D8FA 4H1QA 3TT4A 1FBLA 1SU3A 1BSWA 2MZEA 4H84A 4A3WA 1BKCE 4PKSA 1IACA 1EUBA 1CGFA 3F16A 2JIHA 4XM6A 1IABA 3KWVC 3LIKA 2WO8A 4XM7A 3DTIA 1CK7A 4GR8A 2O3EA 1PWUA 1SLMA 1ROSA 3RTSA 4PKWA 1UMTA 3P24A 4PKQA 3P1VA 5LABA 1QIBA 1R1JA 1HFSA 1B8YA 4FXYP 5D3CA 2CKIA 3DPFA 1G12A 2V4BA 1IADA 2W14A 1MMPA 3LILA 1OS9A 4JPAA 3LQ0A 1XFZA 1A86A 3F1AA 3HY7A 1XURA 2DW1A 4JQGA 4HX3A 2O36A 1R1IA 2YIGA 4L7AA 1XFWA 4H2EA 2OXWA 1KAPP 1PWPA 3DWBA 1OZ9A 2K2GA 1GE5A 1HFCA 4WK7A 4H82A 1HV5A 3B92A 4AXQA 3NX7A 2MLSA 1ATLA 4GWNA 4CTHA 1D8MA 3WV3A 1SLNA 1OO9A 2JNPA 3K7LA 3ZVSA 2XS3A 5CZMA 3KMEA 5CXAA 4GWMA 3LEAA 1XM5A 3VTGA 3AIGA 2KRJA 1YCMA 4PKTA 3WV2A 1XAXA 3DTEA 4ZR5A 3KECA 3F19A 3HYGA 4H3XA 1KUHA 3KEJA 1K7IA 1UTZA 2JSDA 1PWQA 1ZP5A 4JA1A 1DTHA 2X7MA 2TCLA 3LMCA 1KUFA 1RMZA 3EHYA 5I43A 3I7IA 1AF0A 1ASTA 1JANA 2OXUA 5I0LA 1OM7A 1A85A 4HMAA 3L0VA 1BKCA 1FM1A 1OM8A 1SATA 456CA 3TS4A 1K7GA 3TVCA 1D5JA 1JIZA
chains in the Genus database with same CATH topology
2E2DA 4FXQA 1BIWA 1RM8A 3F17A 5L7FA 2J0TA 3B8ZA 1UTTA 1JIWP 2K9CA 2POJA 3EDHA 4PKRA 1Q3AA 3DL1A 1MMBA 3KEKA 3OHOA 1JJ9A 3EDGA 4QKZA 1B3DA 4WKEA 2L0RA 2D1NA 1GE6A 2OI0A 4PKVA 4GUYA 4XM8A 2J83A 4A7BA 1JAPA 1EB6A 3AYKA 1C8TA 2YB9A 3LJZA 1MMQA 3LKAA 3F18A 3ZXHA 2OVXA 3L0TA 1ZTQA 3LIRA 2ERQA 4GR3A 5BOYA 4H49A 1XFYA 1GO7P 1YP1A 1XUDA 2OW2A 2EROA 3LK8A 3UVCA 1R1HA 2FV5A 2MLRA 3AYUA 4IJOA 1MMRA 2WO9A 1BUVM 2W12A 1R54A 1OM6A 1CQRA 1FLSA 2MZIA 3LUMA 5I12A 1Z3JA 1IAEA 3DPEA 2OW0A 3RTTA 2FV9A 5D1UA 5I2ZA 2OY4A 3HDAP 2YUFA 2DDFA 3HDBA 1O0TA 3EDIA 5B5PA 1CGLA 2I47A 4WZVA 1OS2A 1Y8JA 3WV1A 1BZSA 1G49A 3MA2A 1YOUA 1CIZA 2X3BA 2W0DA 1HY7A 1WNIA 2OW1A 4FU4A 3G5CA 2DDYA 3KHIA 2QPJA 1DMTA 1KBCA 4H30A 1AYKA 4GR0A 4JP4A 1G9KA 1K7QA 1XFUA 5D1SA 3HY9A 4JIJA 2USNA 4WF6A 1I1IP 4L19A 4L63A 1ZVXA 4FVLA 4J4MA 4DV8A 5CUHA 1PWVA 5JMYA 1XFXA 2CLTA 1GKDA 1HTDA 1SMPA 4IN9A 1KUGA 4GF1A 3V96B 5H8XA 1USNA 1BQQM 3TSKA 4G9LA 2D1OA 2XS4A 3B2ZA 2AIGP 4G0DA 3E8RA 1JAQA 4AUOA 2X3AA 2OXZA 1J7NA 1G05A 1KUKA 966CA 1BUDA 1C3IA 1QIAA 2E3XA 1QUAA 2OY2A 1GE7A 2OW9A 4XBHA 1ZS0A 1PWWA 5L79A 3N2VA 3G42A 1Y93A 3Q2GA 3CKIA 1L6JA 3EWJA 3VI1A 3EDZA 4XCTA 2ERPA 2PJTA 4ILWD 3Q2HA 3DTKA 5BPAA 1O0QA 2Y6DA 4R3VA 1CGEA 3LUNA 2W13A 4AYKA 3LJTA 3I7GA 4I03A 4Q1LA 4L6TA 1UEAA 3F15A 2OZRA 3HBUP 3HB2P 3K7NA 3GBOA 2HU6A 2RJPA 3OHLA 4DD8A 3USNA 4H76A 2Z2DA 3N2UA 3U1RA 3KMCA 1JH1A 1ZXCA 1C7KA 1R55A 4I35A 3DSLA 1SRPA 3LGPA 1JAOA 1AKLA 4AIGA 830CA 1YQYA 2SRTA 1UMSA 3EHXA 5I3MA 1IAAA 3BA0A 1QJIA 2RJQA 1KUIA 1CXVA 2Y6CA 1I76A 3ELMA 1QJJA 2JT6A 4WKIA 2OVZA 1Y0VA 2MZHA 2DW2A 5I4OA 4DPEA 2JT5A 3ZUKA 2X3CA 4IUWA 5D7WA 1CAQA 5B5OA 3KRYA 1XFVA 4EFSA 3DNGA 3O2XA 1G4KA 3LE9A 1D7XA 1XUCA 1JKYA 1GKCA 5BOTA 1EAKA 1H71P 5D1TA 1ZXVA 3HBVP 1GXDA 1MNCA 4PKUA 2DW0A 4ON1A 5D2BA 2AYKA 1I73A 2N8RA 1GO8P 1S4BP 1JK3A 3O64A 4GQLA 1ND1A 3SHIA 1IAGA 1HOVA 1BQOA 1BKCI 1QICA 1BM6A 3LJGA 2WOAA 4DF9A 2A8HA 1OMJA 3LQBA 2W15A 1D8FA 4H1QA 3TT4A 1FBLA 1SU3A 1BSWA 2MZEA 4H84A 4A3WA 1BKCE 4PKSA 1IACA 1EUBA 1CGFA 3F16A 2JIHA 4XM6A 1IABA 3KWVC 3LIKA 2WO8A 4XM7A 3DTIA 1CK7A 4GR8A 2O3EA 1PWUA 1SLMA 1ROSA 3RTSA 4PKWA 1UMTA 3P24A 4PKQA 3P1VA 5LABA 1QIBA 1R1JA 1HFSA 1B8YA 4FXYP 5D3CA 2CKIA 3DPFA 1G12A 2V4BA 1IADA 2W14A 1MMPA 3LILA 1OS9A 4JPAA 3LQ0A 1XFZA 1A86A 3F1AA 3HY7A 1XURA 2DW1A 4JQGA 4HX3A 2O36A 1R1IA 2YIGA 4L7AA 1XFWA 4H2EA 2OXWA 1KAPP 1PWPA 3DWBA 2K2GA 1GE5A 1HFCA 4WK7A 4H82A 1HV5A 3B92A 4AXQA 3NX7A 2MLSA 1ATLA 4GWNA 4CTHA 1D8MA 3WV3A 1SLNA 1OO9A 2JNPA 3K7LA 3ZVSA 2XS3A 5CZMA 3KMEA 5CXAA 4GWMA 3LEAA 3VTGA 3AIGA 2KRJA 1YCMA 4PKTA 3WV2A 3DTEA 4ZR5A 3KECA 3F19A 3HYGA 4H3XA 1KUHA 3KEJA 1K7IA 1UTZA 2JSDA 1PWQA 1ZP5A 4JA1A 1DTHA 2X7MA 2TCLA 3LMCA 1KUFA 1RMZA 3EHYA 5I43A 3I7IA 1AF0A 1ASTA 1JANA 2OXUA 5I0LA 1OM7A 1A85A 4HMAA 3L0VA 1BKCA 1FM1A 1OM8A 1SATA 456CA 3TS4A 1K7GA 3TVCA 1D5JA 1JIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2D A;  4FXQ A;  1BIW A;  1RM8 A;  3F17 A;  5L7F A;  2J0T A;  3B8Z A;  1UTT A;  1JIW P;  2K9C A;  2POJ A;  3EDH A;  4PKR A;  1Q3A A;  3DL1 A;  1MMB A;  3KEK A;  3OHO A;  1JJ9 A;  3EDG A;  4QKZ A;  1B3D A;  4WKE A;  2L0R A;  2D1N A;  1GE6 A;  2OI0 A;  4PKV A;  4GUY A;  4XM8 A;  2J83 A;  4A7B A;  1JAP A;  1EB6 A;  3AYK A;  1C8T A;  2YB9 A;  3LJZ A;  1MMQ A;  3LKA A;  3F18 A;  3ZXH A;  2OVX A;  3L0T A;  1ZTQ A;  3LIR A;  2ERQ A;  4GR3 A;  5BOY A;  4H49 A;  1XFY A;  1GO7 P;  1YP1 A;  1XUD A;  2OW2 A;  2ERO A;  3LK8 A;  3UVC A;  1R1H A;  2FV5 A;  2MLR A;  3AYU A;  4IJO A;  1MMR A;  2WO9 A;  1BUV M;  2W12 A;  1R54 A;  1OM6 A;  1CQR A;  1FLS A;  2MZI A;  3LUM A;  5I12 A;  1Z3J A;  1IAE A;  3DPE A;  2OW0 A;  3RTT A;  2FV9 A;  5D1U A;  5I2Z A;  2OY4 A;  3HDA P;  2DDF A;  3HDB A;  1O0T A;  3EDI A;  5B5P A;  1CGL A;  2I47 A;  4WZV A;  1OS2 A;  1Y8J A;  3WV1 A;  1BZS A;  1G49 A;  3MA2 A;  1YOU A;  1CIZ A;  2X3B A;  2W0D A;  1HY7 A;  1WNI A;  2OW1 A;  4FU4 A;  3G5C A;  2DDY A;  3KHI A;  2QPJ A;  1DMT A;  1KBC A;  4H30 A;  1AYK A;  4GR0 A;  4JP4 A;  1G9K A;  1K7Q A;  1XFU A;  5D1S A;  3HY9 A;  4JIJ A;  2USN A;  4WF6 A;  1I1I P;  4L19 A;  4L63 A;  1ZVX A;  4FVL A;  4J4M A;  4DV8 A;  5CUH A;  1PWV A;  5JMY A;  1XFX A;  2CLT A;  1GKD A;  1HTD A;  1SMP A;  4IN9 A;  1KUG A;  4GF1 A;  3V96 B;  5H8X A;  1USN A;  1BQQ M;  3TSK A;  4G9L A;  2D1O A;  2XS4 A;  3B2Z A;  2AIG P;  4G0D A;  3E8R A;  1JAQ A;  4AUO A;  2X3A A;  2OXZ A;  1J7N A;  1G05 A;  1KUK A;  966C A;  1BUD A;  1C3I A;  1QIA A;  2E3X A;  1QUA A;  2OY2 A;  1GE7 A;  2OW9 A;  4XBH A;  1ZS0 A;  1PWW A;  5L79 A;  3N2V A;  3G42 A;  1Y93 A;  3Q2G A;  3CKI A;  1L6J A;  3EWJ A;  3VI1 A;  3EDZ A;  4XCT A;  2ERP A;  2PJT A;  4ILW D;  3Q2H A;  5BPA A;  1O0Q A;  2Y6D A;  4R3V A;  1CGE A;  3LUN A;  2W13 A;  4AYK A;  3LJT A;  3I7G A;  4I03 A;  4Q1L A;  4L6T A;  1UEA A;  3F15 A;  2OZR A;  3HBU P;  3HB2 P;  3K7N A;  3GBO A;  2HU6 A;  2RJP A;  3OHL A;  4DD8 A;  3USN A;  4H76 A;  2Z2D A;  3N2U A;  3U1R A;  3KMC A;  1JH1 A;  1ZXC A;  1C7K A;  1R55 A;  4I35 A;  3DSL A;  1SRP A;  3LGP A;  1JAO A;  1AKL A;  4AIG A;  830C A;  1YQY A;  2SRT A;  1UMS A;  3EHX A;  5I3M A;  1IAA A;  3BA0 A;  1QJI A;  2RJQ A;  1KUI A;  1CXV A;  2Y6C A;  1I76 A;  3ELM A;  1QJJ A;  2JT6 A;  4WKI A;  2OVZ A;  1Y0V A;  2MZH A;  2DW2 A;  5I4O A;  4DPE A;  2JT5 A;  3ZUK A;  2X3C A;  4IUW A;  5D7W A;  1CAQ A;  5B5O A;  3KRY A;  1XFV A;  4EFS A;  3DNG A;  3O2X A;  1G4K A;  3LE9 A;  1D7X A;  1XUC A;  1JKY A;  1GKC A;  5BOT A;  1EAK A;  1H71 P;  5D1T A;  1ZXV A;  3HBV P;  1GXD A;  1MNC A;  4PKU A;  2DW0 A;  4ON1 A;  5D2B A;  2AYK A;  1I73 A;  2N8R A;  1GO8 P;  1S4B P;  1JK3 A;  3O64 A;  4GQL A;  1ND1 A;  3SHI A;  1IAG A;  1HOV A;  1BQO A;  1BKC I;  1QIC A;  1BM6 A;  3LJG A;  2WOA A;  4DF9 A;  2A8H A;  1OMJ A;  3LQB A;  2W15 A;  1D8F A;  4H1Q A;  3TT4 A;  1FBL A;  1SU3 A;  1BSW A;  2MZE A;  4H84 A;  4A3W A;  1BKC E;  4PKS A;  1IAC A;  1EUB A;  1CGF A;  3F16 A;  2JIH A;  4XM6 A;  1IAB A;  3KWV C;  3LIK A;  2WO8 A;  4XM7 A;  1CK7 A;  4GR8 A;  2O3E A;  1PWU A;  1SLM A;  1ROS A;  3RTS A;  4PKW A;  1UMT A;  3P24 A;  4PKQ A;  3P1V A;  5LAB A;  1QIB A;  1R1J A;  1HFS A;  1B8Y A;  4FXY P;  5D3C A;  2CKI A;  3DPF A;  1G12 A;  2V4B A;  1IAD A;  2W14 A;  1MMP A;  3LIL A;  1OS9 A;  4JPA A;  3LQ0 A;  1XFZ A;  1A86 A;  3F1A A;  3HY7 A;  1XUR A;  2DW1 A;  4JQG A;  4HX3 A;  2O36 A;  1R1I A;  2YIG A;  1XFW A;  4H2E A;  2OXW A;  1KAP P;  1PWP A;  3DWB A;  2K2G A;  1GE5 A;  1HFC A;  4WK7 A;  4H82 A;  1HV5 A;  3B92 A;  4AXQ A;  3NX7 A;  2MLS A;  1ATL A;  4GWN A;  4CTH A;  1D8M A;  3WV3 A;  1SLN A;  1OO9 A;  2JNP A;  3K7L A;  3ZVS A;  2XS3 A;  5CZM A;  3KME A;  5CXA A;  4GWM A;  3LEA A;  3VTG A;  3AIG A;  2KRJ A;  1YCM A;  4PKT A;  3WV2 A;  4ZR5 A;  3KEC A;  3F19 A;  3HYG A;  4H3X A;  1KUH A;  3KEJ A;  1K7I A;  1UTZ A;  2JSD A;  1PWQ A;  1ZP5 A;  4JA1 A;  1DTH A;  2X7M A;  2TCL A;  3LMC A;  1KUF A;  1RMZ A;  3EHY A;  5I43 A;  3I7I A;  1AF0 A;  1AST A;  1JAN A;  2OXU A;  5I0L A;  1OM7 A;  1A85 A;  4HMA A;  3L0V A;  1BKC A;  1FM1 A;  1OM8 A;  1SAT A;  456C A;  3TS4 A;  1K7G A;  3TVC A;  1D5J A;  1JIZ A; 
#chains in the Genus database with same CATH topology
 2E2D A;  4FXQ A;  1BIW A;  1RM8 A;  3F17 A;  5L7F A;  2J0T A;  3B8Z A;  1UTT A;  1JIW P;  2K9C A;  2POJ A;  3EDH A;  4PKR A;  1Q3A A;  3DL1 A;  1MMB A;  3KEK A;  3OHO A;  1JJ9 A;  3EDG A;  4QKZ A;  1B3D A;  4WKE A;  2L0R A;  2D1N A;  1GE6 A;  2OI0 A;  4PKV A;  4GUY A;  4XM8 A;  2J83 A;  4A7B A;  1JAP A;  1EB6 A;  3AYK A;  1C8T A;  2YB9 A;  3LJZ A;  1MMQ A;  3LKA A;  3F18 A;  3ZXH A;  2OVX A;  3L0T A;  1ZTQ A;  3LIR A;  2ERQ A;  4GR3 A;  5BOY A;  4H49 A;  1XFY A;  1GO7 P;  1YP1 A;  1XUD A;  2OW2 A;  2ERO A;  3LK8 A;  3UVC A;  1R1H A;  2FV5 A;  2MLR A;  3AYU A;  4IJO A;  1MMR A;  2WO9 A;  1BUV M;  2W12 A;  1R54 A;  1OM6 A;  1CQR A;  1FLS A;  2MZI A;  3LUM A;  5I12 A;  1Z3J A;  1IAE A;  3DPE A;  2OW0 A;  3RTT A;  2FV9 A;  5D1U A;  5I2Z A;  2OY4 A;  3HDA P;  2YUF A;  2DDF A;  3HDB A;  1O0T A;  3EDI A;  5B5P A;  1CGL A;  2I47 A;  4WZV A;  1OS2 A;  1Y8J A;  3WV1 A;  1BZS A;  1G49 A;  3MA2 A;  1YOU A;  1CIZ A;  2X3B A;  2W0D A;  1HY7 A;  1WNI A;  2OW1 A;  4FU4 A;  3G5C A;  2DDY A;  3KHI A;  2QPJ A;  1DMT A;  1KBC A;  4H30 A;  1AYK A;  4GR0 A;  4JP4 A;  1G9K A;  1K7Q A;  1XFU A;  5D1S A;  3HY9 A;  4JIJ A;  2USN A;  4WF6 A;  1I1I P;  4L19 A;  4L63 A;  1ZVX A;  4FVL A;  4J4M A;  4DV8 A;  5CUH A;  1PWV A;  5JMY A;  1XFX A;  2CLT A;  1GKD A;  1HTD A;  1SMP A;  4IN9 A;  1KUG A;  4GF1 A;  3V96 B;  5H8X A;  1USN A;  1BQQ M;  3TSK A;  4G9L A;  2D1O A;  2XS4 A;  3B2Z A;  2AIG P;  4G0D A;  3E8R A;  1JAQ A;  4AUO A;  2X3A A;  2OXZ A;  1J7N A;  1G05 A;  1KUK A;  966C A;  1BUD A;  1C3I A;  1QIA A;  2E3X A;  1QUA A;  2OY2 A;  1GE7 A;  2OW9 A;  4XBH A;  1ZS0 A;  1PWW A;  5L79 A;  3N2V A;  3G42 A;  1Y93 A;  3Q2G A;  3CKI A;  1L6J A;  3EWJ A;  3VI1 A;  3EDZ A;  4XCT A;  2ERP A;  2PJT A;  4ILW D;  3Q2H A;  3DTK A;  5BPA A;  1O0Q A;  2Y6D A;  4R3V A;  1CGE A;  3LUN A;  2W13 A;  4AYK A;  3LJT A;  3I7G A;  4I03 A;  4Q1L A;  4L6T A;  1UEA A;  3F15 A;  2OZR A;  3HBU P;  3HB2 P;  3K7N A;  3GBO A;  2HU6 A;  2RJP A;  3OHL A;  4DD8 A;  3USN A;  4H76 A;  2Z2D A;  3N2U A;  3U1R A;  3KMC A;  1JH1 A;  1ZXC A;  1C7K A;  1R55 A;  4I35 A;  3DSL A;  1SRP A;  3LGP A;  1JAO A;  1AKL A;  4AIG A;  830C A;  1TVI A;  1YQY A;  2SRT A;  1UMS A;  3EHX A;  5I3M A;  1IAA A;  3BA0 A;  1QJI A;  2RJQ A;  1KUI A;  1CXV A;  2Y6C A;  1I76 A;  3ELM A;  1QJJ A;  2JT6 A;  4WKI A;  2OVZ A;  1Y0V A;  2MZH A;  2DW2 A;  5I4O A;  4DPE A;  2JT5 A;  3ZUK A;  2X3C A;  4IUW A;  5D7W A;  1CAQ A;  5B5O A;  3KRY A;  1XFV A;  4EFS A;  3DNG A;  3O2X A;  1G4K A;  3LE9 A;  1D7X A;  1XUC A;  1JKY A;  1GKC A;  5BOT A;  1EAK A;  1H71 P;  5D1T A;  1ZXV A;  3HBV P;  1GXD A;  1MNC A;  4PKU A;  2DW0 A;  4ON1 A;  5D2B A;  2AYK A;  1I73 A;  2N8R A;  1GO8 P;  1S4B P;  1JK3 A;  3O64 A;  4GQL A;  1ND1 A;  3SHI A;  1IAG A;  1HOV A;  1BQO A;  1BKC I;  1QIC A;  1BM6 A;  3LJG A;  2WOA A;  4DF9 A;  2A8H A;  1OMJ A;  3LQB A;  2W15 A;  1D8F A;  4H1Q A;  3TT4 A;  1FBL A;  1SU3 A;  1BSW A;  2MZE A;  4H84 A;  4A3W A;  1BKC E;  4PKS A;  1IAC A;  1EUB A;  1CGF A;  3F16 A;  2JIH A;  4XM6 A;  1IAB A;  3KWV C;  3LIK A;  2WO8 A;  4XM7 A;  3DTI A;  1CK7 A;  4GR8 A;  2O3E A;  1PWU A;  1SLM A;  1ROS A;  3RTS A;  4PKW A;  1UMT A;  3P24 A;  4PKQ A;  3P1V A;  5LAB A;  1QIB A;  1R1J A;  1HFS A;  1B8Y A;  4FXY P;  5D3C A;  2CKI A;  3DPF A;  1G12 A;  2V4B A;  1IAD A;  2W14 A;  1MMP A;  3LIL A;  1OS9 A;  4JPA A;  3LQ0 A;  1XFZ A;  1A86 A;  3F1A A;  3HY7 A;  1XUR A;  2DW1 A;  4JQG A;  4HX3 A;  2O36 A;  1R1I A;  2YIG A;  4L7A A;  1XFW A;  4H2E A;  2OXW A;  1KAP P;  1PWP A;  3DWB A;  1OZ9 A;  2K2G A;  1GE5 A;  1HFC A;  4WK7 A;  4H82 A;  1HV5 A;  3B92 A;  4AXQ A;  3NX7 A;  2MLS A;  1ATL A;  4GWN A;  4CTH A;  1D8M A;  3WV3 A;  1SLN A;  1OO9 A;  2JNP A;  3K7L A;  3ZVS A;  2XS3 A;  5CZM A;  3KME A;  5CXA A;  4GWM A;  3LEA A;  1XM5 A;  3VTG A;  3AIG A;  2KRJ A;  1YCM A;  4PKT A;  3WV2 A;  1XAX A;  3DTE A;  4ZR5 A;  3KEC A;  3F19 A;  3HYG A;  4H3X A;  1KUH A;  3KEJ A;  1K7I A;  1UTZ A;  2JSD A;  1PWQ A;  1ZP5 A;  4JA1 A;  1DTH A;  2X7M A;  2TCL A;  3LMC A;  1KUF A;  1RMZ A;  3EHY A;  5I43 A;  3I7I A;  1AF0 A;  1AST A;  1JAN A;  2OXU A;  5I0L A;  1OM7 A;  1A85 A;  4HMA A;  3L0V A;  1BKC A;  1FM1 A;  1OM8 A;  1SAT A;  456C A;  3TS4 A;  1K7G A;  3TVC A;  1D5J A;  1JIZ A; 
#chains in the Genus database with same CATH homology
 2E2D A;  4FXQ A;  1BIW A;  1RM8 A;  3F17 A;  5L7F A;  2J0T A;  3B8Z A;  1UTT A;  1JIW P;  2K9C A;  2POJ A;  3EDH A;  4PKR A;  1Q3A A;  3DL1 A;  1MMB A;  3KEK A;  3OHO A;  1JJ9 A;  3EDG A;  4QKZ A;  1B3D A;  4WKE A;  2L0R A;  2D1N A;  1GE6 A;  2OI0 A;  4PKV A;  4GUY A;  4XM8 A;  2J83 A;  4A7B A;  1JAP A;  1EB6 A;  3AYK A;  1C8T A;  2YB9 A;  3LJZ A;  1MMQ A;  3LKA A;  3F18 A;  3ZXH A;  2OVX A;  3L0T A;  1ZTQ A;  3LIR A;  2ERQ A;  4GR3 A;  5BOY A;  4H49 A;  1XFY A;  1GO7 P;  1YP1 A;  1XUD A;  2OW2 A;  2ERO A;  3LK8 A;  3UVC A;  1R1H A;  2FV5 A;  2MLR A;  3AYU A;  4IJO A;  1MMR A;  2WO9 A;  1BUV M;  2W12 A;  1R54 A;  1OM6 A;  1CQR A;  1FLS A;  2MZI A;  3LUM A;  5I12 A;  1Z3J A;  1IAE A;  3DPE A;  2OW0 A;  3RTT A;  2FV9 A;  5D1U A;  5I2Z A;  2OY4 A;  3HDA P;  2YUF A;  2DDF A;  3HDB A;  1O0T A;  3EDI A;  5B5P A;  1CGL A;  2I47 A;  4WZV A;  1OS2 A;  1Y8J A;  3WV1 A;  1BZS A;  1G49 A;  3MA2 A;  1YOU A;  1CIZ A;  2X3B A;  2W0D A;  1HY7 A;  1WNI A;  2OW1 A;  4FU4 A;  3G5C A;  2DDY A;  3KHI A;  2QPJ A;  1DMT A;  1KBC A;  4H30 A;  1AYK A;  4GR0 A;  4JP4 A;  1G9K A;  1K7Q A;  1XFU A;  5D1S A;  3HY9 A;  4JIJ A;  2USN A;  4WF6 A;  1I1I P;  4L19 A;  4L63 A;  1ZVX A;  4FVL A;  4J4M A;  4DV8 A;  5CUH A;  1PWV A;  5JMY A;  1XFX A;  2CLT A;  1GKD A;  1HTD A;  1SMP A;  4IN9 A;  1KUG A;  4GF1 A;  3V96 B;  5H8X A;  1USN A;  1BQQ M;  3TSK A;  4G9L A;  2D1O A;  2XS4 A;  3B2Z A;  2AIG P;  4G0D A;  3E8R A;  1JAQ A;  4AUO A;  2X3A A;  2OXZ A;  1J7N A;  1G05 A;  1KUK A;  966C A;  1BUD A;  1C3I A;  1QIA A;  2E3X A;  1QUA A;  2OY2 A;  1GE7 A;  2OW9 A;  4XBH A;  1ZS0 A;  1PWW A;  5L79 A;  3N2V A;  3G42 A;  1Y93 A;  3Q2G A;  3CKI A;  1L6J A;  3EWJ A;  3VI1 A;  3EDZ A;  4XCT A;  2ERP A;  2PJT A;  4ILW D;  3Q2H A;  3DTK A;  5BPA A;  1O0Q A;  2Y6D A;  4R3V A;  1CGE A;  3LUN A;  2W13 A;  4AYK A;  3LJT A;  3I7G A;  4I03 A;  4Q1L A;  4L6T A;  1UEA A;  3F15 A;  2OZR A;  3HBU P;  3HB2 P;  3K7N A;  3GBO A;  2HU6 A;  2RJP A;  3OHL A;  4DD8 A;  3USN A;  4H76 A;  2Z2D A;  3N2U A;  3U1R A;  3KMC A;  1JH1 A;  1ZXC A;  1C7K A;  1R55 A;  4I35 A;  3DSL A;  1SRP A;  3LGP A;  1JAO A;  1AKL A;  4AIG A;  830C A;  1YQY A;  2SRT A;  1UMS A;  3EHX A;  5I3M A;  1IAA A;  3BA0 A;  1QJI A;  2RJQ A;  1KUI A;  1CXV A;  2Y6C A;  1I76 A;  3ELM A;  1QJJ A;  2JT6 A;  4WKI A;  2OVZ A;  1Y0V A;  2MZH A;  2DW2 A;  5I4O A;  4DPE A;  2JT5 A;  3ZUK A;  2X3C A;  4IUW A;  5D7W A;  1CAQ A;  5B5O A;  3KRY A;  1XFV A;  4EFS A;  3DNG A;  3O2X A;  1G4K A;  3LE9 A;  1D7X A;  1XUC A;  1JKY A;  1GKC A;  5BOT A;  1EAK A;  1H71 P;  5D1T A;  1ZXV A;  3HBV P;  1GXD A;  1MNC A;  4PKU A;  2DW0 A;  4ON1 A;  5D2B A;  2AYK A;  1I73 A;  2N8R A;  1GO8 P;  1S4B P;  1JK3 A;  3O64 A;  4GQL A;  1ND1 A;  3SHI A;  1IAG A;  1HOV A;  1BQO A;  1BKC I;  1QIC A;  1BM6 A;  3LJG A;  2WOA A;  4DF9 A;  2A8H A;  1OMJ A;  3LQB A;  2W15 A;  1D8F A;  4H1Q A;  3TT4 A;  1FBL A;  1SU3 A;  1BSW A;  2MZE A;  4H84 A;  4A3W A;  1BKC E;  4PKS A;  1IAC A;  1EUB A;  1CGF A;  3F16 A;  2JIH A;  4XM6 A;  1IAB A;  3KWV C;  3LIK A;  2WO8 A;  4XM7 A;  3DTI A;  1CK7 A;  4GR8 A;  2O3E A;  1PWU A;  1SLM A;  1ROS A;  3RTS A;  4PKW A;  1UMT A;  3P24 A;  4PKQ A;  3P1V A;  5LAB A;  1QIB A;  1R1J A;  1HFS A;  1B8Y A;  4FXY P;  5D3C A;  2CKI A;  3DPF A;  1G12 A;  2V4B A;  1IAD A;  2W14 A;  1MMP A;  3LIL A;  1OS9 A;  4JPA A;  3LQ0 A;  1XFZ A;  1A86 A;  3F1A A;  3HY7 A;  1XUR A;  2DW1 A;  4JQG A;  4HX3 A;  2O36 A;  1R1I A;  2YIG A;  4L7A A;  1XFW A;  4H2E A;  2OXW A;  1KAP P;  1PWP A;  3DWB A;  2K2G A;  1GE5 A;  1HFC A;  4WK7 A;  4H82 A;  1HV5 A;  3B92 A;  4AXQ A;  3NX7 A;  2MLS A;  1ATL A;  4GWN A;  4CTH A;  1D8M A;  3WV3 A;  1SLN A;  1OO9 A;  2JNP A;  3K7L A;  3ZVS A;  2XS3 A;  5CZM A;  3KME A;  5CXA A;  4GWM A;  3LEA A;  3VTG A;  3AIG A;  2KRJ A;  1YCM A;  4PKT A;  3WV2 A;  3DTE A;  4ZR5 A;  3KEC A;  3F19 A;  3HYG A;  4H3X A;  1KUH A;  3KEJ A;  1K7I A;  1UTZ A;  2JSD A;  1PWQ A;  1ZP5 A;  4JA1 A;  1DTH A;  2X7M A;  2TCL A;  3LMC A;  1KUF A;  1RMZ A;  3EHY A;  5I43 A;  3I7I A;  1AF0 A;  1AST A;  1JAN A;  2OXU A;  5I0L A;  1OM7 A;  1A85 A;  4HMA A;  3L0V A;  1BKC A;  1FM1 A;  1OM8 A;  1SAT A;  456C A;  3TS4 A;  1K7G A;  3TVC A;  1D5J A;  1JIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...