2DDYA

Solution structure of matrilysin (mmp-7) complexed to constraint conformational sulfonamide inhibitor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
173
Chain Sequence
YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrilysin
publication title Solution Structure of Matrilysin (MMP-7) Complexed to Constraint Conformational Sulfonamide Inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 38
structure length 173
sequence length 173
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2ddyA00
2XS4A 3LJTA 1BKCA 2CLTA 2A8HA 1D8FA 1ZXVA 2POJA 1ZVXA 1XFZA 4GWNA 3V96B 2JT6A 3I7IA 2HU6A 3LQ0A 3ZUKA 2QPJA 3EDIA 3UVCA 2OVZA 4PKSA 1HTDA 3KHIA 3KEKA 1CGEA 3DPEA 1HOVA 5CXAA 2J0TA 4JQGA 4Q1LA 2AIGP 1R54A 2V4BA 2X7MA 1JK3A 4H1QA 2W15A 3G5CA 4H76A 1JAQA 5L79A 3DWBA 1C8TA 3LGPA 1Y0VA 4FVLA 1RM8A 3MA2A 1GO8P 1USNA 4J4MA 4AYKA 4ON1A 1FM1A 2W14A 3SHIA 3LE9A 1JAOA 5L7FA 1YP1A 1R1JA 1QJJA 4PKQA 5I12A 1IAAA 5I43A 1S4BP 2DDFA 2X3AA 1OS9A 4IUWA 2OW2A 1OM7A 1ND1A 1XFXA 1YQYA 2MZEA 3O2XA 456CA 2Z2DA 1XFWA 3WV2A 1BM6A 1PWPA 1Z3JA 3OHOA 3LMCA 3HY7A 1G05A 1KUIA 3L0TA 4A3WA 2L0RA 1UMSA 1SATA 2J83A 2D1NA 1QICA 3AYUA 1HFSA 1GXDA 1XFYA 2D1OA 3EWJA 1BZSA 3DL1A 1FLSA 4A7BA 1PWWA 1XUCA 4IJOA 3KWVC 1R1IA 2OI0A 1UTZA 2OXWA 4WKEA 5H8XA 1BSWA 1CGLA 4GR8A 3LEAA 3HYGA 4GWMA 2YB9A 1ASTA 4XM6A 2MLRA 2DDYA 1IACA 4WK7A 3F18A 3HBUP 2X3CA 3ZVSA 2OW1A 2OY4A 3EHYA 3G42A 4EFSA 1QUAA 1KUHA 4L6TA 1XFVA 4ILWD 3O64A 1Y93A 2I47A 5JMYA 5CZMA 5I4OA 1MNCA 1O0QA 1G4KA 2JNPA 1KUGA 1AKLA 5D1UA 5D1SA 3DSLA 1QJIA 4ZR5A 1KAPP 4G0DA 2DW2A 4G9LA 3HDBA 1ATLA 3F19A 2K2GA 1SLNA 2OW9A 2TCLA 1EB6A 2MZIA 3KMCA 1BQOA 4L19A 1ROSA 4AIGA 2OXZA 3F1AA 4GUYA 1JIZA 1G12A 1XUDA 1D5JA 1R1HA 3AYKA 2FV9A 1OM8A 4H49A 1XFUA 2WO8A 1GKDA 2W12A 1JIWP 2Y6DA 4XBHA 3P24A 4I03A 1I73A 1FBLA 4JIJA 1CIZA 1Q3AA 3E8RA 4XM7A 4XCTA 1IAEA 1GO7P 1GE5A 3KMEA 5I0LA 1I1IP 3HBVP 1A86A 4FXQA 3LILA 1PWUA 2FV5A 4FU4A 1YOUA 3WV1A 1K7GA 1C7KA 5CUHA 1MMRA 3Q2GA 2Y6CA 3TT4A 2EROA 1BIWA 2SRTA 2JSDA 1KBCA 3LKAA 4DV8A 1EUBA 1EAKA 1AYKA 1HV5A 1DTHA 3B92A 1G9KA 1BQQM 2YIGA 4WKIA 3AIGA 2KRJA 1H71P 3NX7A 4QKZA 3LIKA 3EHXA 1JH1A 2WOAA 3LIRA 3WV3A 3DPFA 3P1VA 5I2ZA 4GR3A 1OMJA 1BKCI 3K7LA 3GBOA 2XS3A 3BA0A 3Q2HA 2DW1A 2X3BA 2O36A 1UMTA 2OW0A 2JT5A 5D2BA 4PKUA 4DD8A 2CKIA 1KUFA 1DMTA 3U1RA 1CAQA 3F16A 2E3XA 3EDZA 1J7NA 1K7QA 1ZXCA 2ERQA 4H30A 1R55A 3N2VA 4H2EA 5D1TA 3RTTA 3F17A 1PWVA 3LK8A 1SMPA 4FXYP 3KRYA 2USNA 3ELMA 1O0TA 2W13A 3VTGA 1GKCA 1XURA 1I76A 2ERPA 3LUNA 2K9CA 3B2ZA 3LQBA 4I35A 3F15A 1Y8JA 2JIHA 2N8RA 1MMBA 2OVXA 2OZRA 3K7NA 5BOTA 3TVCA 3RTSA 1C3IA 1WNIA 1RMZA 2RJPA 1BKCE 3DNGA 3EDHA 1IABA 2O3EA 4IN9A 1BUVM 3KEJA 3KECA 1GE7A 1MMPA 4GR0A 3N2UA 3VI1A 3OHLA 3HB2P 3TS4A 1SRPA 1UEAA 4PKTA 1B8YA 1OO9A 4PKVA 4HMAA 1IADA 1PWQA 3L0VA 1CK7A 2MLSA 3TSKA 2WO9A 5I3MA 1CGFA 1JKYA 1ZTQA 3HDAP 4H84A 1BUDA 1OS2A 4PKRA 2DW0A 1IAGA 5D7WA 3LUMA 1QIBA 2OY2A 1ZP5A 4H3XA 4WZVA 4GQLA 3ZXHA 1OM6A 1D8MA 5B5OA 1D7XA 3LJZA 3CKIA 830CA 4H82A 1UTTA 4JP4A 1AF0A 1L6JA 1CQRA 2AYKA 1JAPA 4R3VA 1YCMA 4XM8A 1JJ9A 4CTHA 2RJQA 5BPAA 4AXQA 4JPAA 966CA 4JA1A 1SU3A 5LABA 2MZHA 4PKWA 5D3CA 4DF9A 3HY9A 1K7IA 4WF6A 4HX3A 2W0DA 3EDGA 1MMQA 4DPEA 4GF1A 1G49A 4AUOA 1A85A 5B5PA 2OXUA 3B8ZA 2PJTA 1HY7A 1HFCA 1ZS0A 1JANA 3I7GA 2E2DA 1QIAA 1CXVA 1GE6A 1B3DA 1SLMA 5BOYA 4L63A 1KUKA 3USNA 3LJGA
chains in the Genus database with same CATH superfamily
2XS4A 3LJTA 1BKCA 2CLTA 2A8HA 1D8FA 1ZXVA 2POJA 1ZVXA 1XFZA 4GWNA 1XAXA 3V96B 2JT6A 3I7IA 2HU6A 3LQ0A 3ZUKA 2QPJA 3EDIA 3UVCA 2OVZA 4PKSA 1HTDA 3KHIA 3KEKA 1CGEA 3DPEA 1HOVA 5CXAA 2J0TA 4JQGA 4Q1LA 2AIGP 1R54A 2V4BA 2X7MA 1JK3A 4H1QA 2W15A 3G5CA 4H76A 1JAQA 5L79A 3DWBA 1C8TA 3LGPA 1Y0VA 4FVLA 1RM8A 3MA2A 1GO8P 1USNA 4J4MA 4AYKA 4ON1A 1FM1A 2W14A 3SHIA 3LE9A 1JAOA 5L7FA 1YP1A 1R1JA 1QJJA 4PKQA 5I12A 1IAAA 5I43A 1S4BP 2DDFA 2X3AA 1OS9A 4IUWA 2OW2A 1OM7A 1ND1A 1XFXA 1YQYA 2MZEA 3O2XA 456CA 2Z2DA 1XFWA 3WV2A 1BM6A 1PWPA 1Z3JA 3OHOA 3LMCA 3HY7A 1G05A 1KUIA 3L0TA 4A3WA 2L0RA 1UMSA 1SATA 2J83A 2D1NA 1QICA 3AYUA 1HFSA 1GXDA 1XFYA 2D1OA 3EWJA 1BZSA 3DL1A 1FLSA 4A7BA 1PWWA 1XUCA 4IJOA 3KWVC 1R1IA 2OI0A 1UTZA 2OXWA 4WKEA 5H8XA 1BSWA 1CGLA 4GR8A 3LEAA 3HYGA 4GWMA 2YB9A 1ASTA 4XM6A 2MLRA 2DDYA 1IACA 4WK7A 3F18A 3HBUP 2X3CA 3ZVSA 2OW1A 2OY4A 3EHYA 3G42A 4EFSA 1QUAA 1KUHA 4L6TA 1XFVA 4ILWD 3O64A 1Y93A 2I47A 5JMYA 5CZMA 5I4OA 1MNCA 1O0QA 1G4KA 2JNPA 1KUGA 1AKLA 5D1UA 1TVIA 3DSLA 1QJIA 3DTEA 1KAPP 5D1SA 4ZR5A 4G0DA 2DW2A 4G9LA 3HDBA 1ATLA 3F19A 2K2GA 1SLNA 2OW9A 2TCLA 1EB6A 2MZIA 3KMCA 1BQOA 3DTIA 4L19A 1ROSA 4AIGA 2OXZA 3F1AA 4GUYA 1JIZA 1G12A 1XUDA 1D5JA 1R1HA 3AYKA 2FV9A 1OM8A 4H49A 1XFUA 2WO8A 1GKDA 1XM5A 2W12A 1JIWP 2Y6DA 4XBHA 3P24A 4I03A 1I73A 1FBLA 4JIJA 1CIZA 1Q3AA 3E8RA 4XM7A 4XCTA 1IAEA 1GO7P 1GE5A 3KMEA 5I0LA 1I1IP 3HBVP 1A86A 4FXQA 1PWUA 2FV5A 3LILA 4FU4A 1YOUA 3WV1A 1K7GA 1C7KA 5CUHA 1MMRA 3Q2GA 2Y6CA 3TT4A 2EROA 4L7AA 1BIWA 2SRTA 2JSDA 1KBCA 3LKAA 4DV8A 1EUBA 1EAKA 1AYKA 1HV5A 1DTHA 3B92A 1G9KA 1BQQM 2YIGA 4WKIA 3AIGA 2KRJA 1H71P 3NX7A 4QKZA 3LIKA 3EHXA 1JH1A 2WOAA 3LIRA 3WV3A 3DPFA 3P1VA 5I2ZA 4GR3A 1OMJA 1BKCI 3K7LA 3GBOA 2XS3A 3BA0A 3Q2HA 2DW1A 2X3BA 2O36A 1UMTA 2OW0A 2JT5A 5D2BA 4PKUA 4DD8A 2CKIA 1KUFA 1DMTA 3U1RA 1CAQA 3F16A 2E3XA 3EDZA 1J7NA 1K7QA 1ZXCA 2ERQA 4H30A 1R55A 3N2VA 4H2EA 5D1TA 3RTTA 3F17A 1PWVA 3LK8A 1SMPA 4FXYP 3KRYA 2USNA 3ELMA 1O0TA 2W13A 3VTGA 1GKCA 1XURA 1I76A 2ERPA 3LUNA 2K9CA 3B2ZA 3LQBA 4I35A 3F15A 1Y8JA 2JIHA 2N8RA 1MMBA 2OVXA 2OZRA 3K7NA 5BOTA 3TVCA 3RTSA 1C3IA 1WNIA 1RMZA 2RJPA 1BKCE 3DNGA 3EDHA 1IABA 2O3EA 4IN9A 1BUVM 3KEJA 3KECA 2YUFA 1GE7A 1MMPA 4GR0A 3N2UA 3VI1A 3OHLA 3HB2P 3TS4A 1SRPA 1UEAA 4PKTA 1B8YA 1OO9A 4PKVA 4HMAA 1IADA 1PWQA 3L0VA 1CK7A 2MLSA 3TSKA 2WO9A 5I3MA 1CGFA 1JKYA 1ZTQA 3HDAP 4H84A 1BUDA 1OS2A 4PKRA 2DW0A 1IAGA 5D7WA 3LUMA 1QIBA 2OY2A 1ZP5A 4H3XA 4WZVA 4GQLA 3ZXHA 1OM6A 1D8MA 5B5OA 1D7XA 3LJZA 3CKIA 830CA 4H82A 1UTTA 4JP4A 1AF0A 1L6JA 1CQRA 1OZ9A 2AYKA 1JAPA 4R3VA 1YCMA 4XM8A 1JJ9A 4CTHA 2RJQA 5BPAA 4AXQA 4JPAA 966CA 4JA1A 1SU3A 5LABA 2MZHA 4PKWA 5D3CA 4DF9A 3HY9A 1K7IA 4WF6A 4HX3A 2W0DA 3EDGA 1MMQA 4DPEA 4GF1A 3DTKA 1G49A 4AUOA 1A85A 5B5PA 2OXUA 3B8ZA 2PJTA 1HY7A 1HFCA 1ZS0A 1JANA 3I7GA 2E2DA 1QIAA 1CXVA 1GE6A 1B3DA 1SLMA 5BOYA 4L63A 1KUKA 3USNA 3LJGA
chains in the Genus database with same CATH topology
2XS4A 3LJTA 1BKCA 2CLTA 2A8HA 1D8FA 1ZXVA 2POJA 1ZVXA 1XFZA 4GWNA 3V96B 2JT6A 3I7IA 2HU6A 3LQ0A 3ZUKA 2QPJA 3EDIA 3UVCA 2OVZA 4PKSA 1HTDA 3KHIA 3KEKA 1CGEA 3DPEA 1HOVA 5CXAA 2J0TA 4JQGA 4Q1LA 2AIGP 1R54A 2V4BA 2X7MA 1JK3A 4H1QA 2W15A 3G5CA 4H76A 1JAQA 5L79A 3DWBA 1C8TA 3LGPA 1Y0VA 4FVLA 1RM8A 3MA2A 1GO8P 1USNA 4J4MA 4AYKA 4ON1A 1FM1A 2W14A 3SHIA 3LE9A 1JAOA 5L7FA 1YP1A 1R1JA 1QJJA 4PKQA 5I12A 1IAAA 5I43A 1S4BP 2DDFA 2X3AA 1OS9A 4IUWA 2OW2A 1OM7A 1ND1A 1XFXA 1YQYA 2MZEA 3O2XA 456CA 2Z2DA 1XFWA 3WV2A 1BM6A 1PWPA 1Z3JA 3OHOA 3LMCA 3HY7A 1G05A 1KUIA 3L0TA 4A3WA 2L0RA 1UMSA 1SATA 2J83A 2D1NA 1QICA 3AYUA 1HFSA 1GXDA 1XFYA 2D1OA 3EWJA 1BZSA 3DL1A 1FLSA 4A7BA 1PWWA 1XUCA 4IJOA 3KWVC 1R1IA 2OI0A 1UTZA 2OXWA 4WKEA 5H8XA 1BSWA 1CGLA 4GR8A 3LEAA 3HYGA 4GWMA 2YB9A 1ASTA 4XM6A 2MLRA 2DDYA 1IACA 4WK7A 3F18A 3HBUP 2X3CA 3ZVSA 2OW1A 2OY4A 3EHYA 3G42A 4EFSA 1QUAA 1KUHA 4L6TA 1XFVA 4ILWD 3O64A 1Y93A 2I47A 5JMYA 5CZMA 5I4OA 1MNCA 1O0QA 1G4KA 2JNPA 1KUGA 1AKLA 5D1UA 5D1SA 3DSLA 1QJIA 3DTEA 1KAPP 4ZR5A 4G0DA 2DW2A 4G9LA 3HDBA 1ATLA 3F19A 2K2GA 1SLNA 2OW9A 2TCLA 1EB6A 2MZIA 3KMCA 1BQOA 3DTIA 4L19A 1ROSA 4AIGA 2OXZA 3F1AA 4GUYA 1JIZA 1G12A 1XUDA 1D5JA 1R1HA 3AYKA 2FV9A 1OM8A 4H49A 1XFUA 2WO8A 1GKDA 2W12A 1JIWP 2Y6DA 4XBHA 3P24A 4I03A 1I73A 1FBLA 4JIJA 1CIZA 1Q3AA 3E8RA 4XM7A 4XCTA 1IAEA 1GO7P 1GE5A 3KMEA 5I0LA 1I1IP 3HBVP 1A86A 4FXQA 3LILA 1PWUA 2FV5A 4FU4A 1YOUA 3WV1A 1K7GA 1C7KA 5CUHA 1MMRA 3Q2GA 2Y6CA 3TT4A 2EROA 4L7AA 1BIWA 2SRTA 2JSDA 1KBCA 3LKAA 4DV8A 1EUBA 1EAKA 1AYKA 1HV5A 1DTHA 3B92A 1G9KA 1BQQM 2YIGA 4WKIA 3AIGA 2KRJA 1H71P 3NX7A 4QKZA 3LIKA 3EHXA 1JH1A 2WOAA 3LIRA 3WV3A 3DPFA 3P1VA 5I2ZA 4GR3A 1OMJA 1BKCI 3K7LA 3GBOA 2XS3A 3BA0A 3Q2HA 2DW1A 2X3BA 2O36A 1UMTA 2OW0A 2JT5A 5D2BA 4PKUA 4DD8A 2CKIA 1KUFA 1DMTA 3U1RA 1CAQA 3F16A 2E3XA 3EDZA 1J7NA 1K7QA 1ZXCA 2ERQA 4H30A 1R55A 3N2VA 4H2EA 5D1TA 3RTTA 3F17A 1PWVA 3LK8A 1SMPA 4FXYP 3KRYA 2USNA 3ELMA 1O0TA 2W13A 3VTGA 1GKCA 1XURA 1I76A 2ERPA 3LUNA 2K9CA 3B2ZA 3LQBA 4I35A 3F15A 1Y8JA 2JIHA 2N8RA 1MMBA 2OVXA 2OZRA 3K7NA 5BOTA 3TVCA 3RTSA 1C3IA 1WNIA 1RMZA 2RJPA 1BKCE 3DNGA 3EDHA 1IABA 2O3EA 4IN9A 1BUVM 3KEJA 3KECA 2YUFA 1GE7A 1MMPA 4GR0A 3N2UA 3VI1A 3OHLA 3HB2P 3TS4A 1SRPA 1UEAA 4PKTA 1B8YA 1OO9A 4PKVA 4HMAA 1IADA 1PWQA 3L0VA 1CK7A 2MLSA 3TSKA 2WO9A 5I3MA 1CGFA 1JKYA 1ZTQA 3HDAP 4H84A 1BUDA 1OS2A 4PKRA 2DW0A 1IAGA 5D7WA 3LUMA 1QIBA 2OY2A 1ZP5A 4H3XA 4WZVA 4GQLA 3ZXHA 1OM6A 1D8MA 5B5OA 1D7XA 3LJZA 3CKIA 830CA 4H82A 1UTTA 4JP4A 1AF0A 1L6JA 1CQRA 2AYKA 1JAPA 4R3VA 1YCMA 4XM8A 1JJ9A 4CTHA 2RJQA 5BPAA 4AXQA 4JPAA 966CA 4JA1A 1SU3A 5LABA 2MZHA 4PKWA 5D3CA 4DF9A 3HY9A 1K7IA 4WF6A 4HX3A 2W0DA 3EDGA 1MMQA 4DPEA 4GF1A 3DTKA 1G49A 4AUOA 1A85A 5B5PA 2OXUA 3B8ZA 2PJTA 1HY7A 1HFCA 1ZS0A 1JANA 3I7GA 2E2DA 1QIAA 1CXVA 1GE6A 1B3DA 1SLMA 5BOYA 4L63A 1KUKA 3USNA 3LJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XS4 A;  3LJT A;  1BKC A;  2CLT A;  2A8H A;  1D8F A;  1ZXV A;  2POJ A;  1ZVX A;  1XFZ A;  4GWN A;  3V96 B;  2JT6 A;  3I7I A;  2HU6 A;  3LQ0 A;  3ZUK A;  2QPJ A;  3EDI A;  3UVC A;  2OVZ A;  4PKS A;  1HTD A;  3KHI A;  3KEK A;  1CGE A;  3DPE A;  1HOV A;  5CXA A;  2J0T A;  4JQG A;  4Q1L A;  2AIG P;  1R54 A;  2V4B A;  2X7M A;  1JK3 A;  4H1Q A;  2W15 A;  3G5C A;  4H76 A;  1JAQ A;  5L79 A;  3DWB A;  1C8T A;  3LGP A;  1Y0V A;  4FVL A;  1RM8 A;  3MA2 A;  1GO8 P;  1USN A;  4J4M A;  4AYK A;  4ON1 A;  1FM1 A;  2W14 A;  3SHI A;  3LE9 A;  1JAO A;  5L7F A;  1YP1 A;  1R1J A;  1QJJ A;  4PKQ A;  5I12 A;  1IAA A;  5I43 A;  1S4B P;  2DDF A;  2X3A A;  1OS9 A;  4IUW A;  2OW2 A;  1OM7 A;  1ND1 A;  1XFX A;  1YQY A;  2MZE A;  3O2X A;  456C A;  2Z2D A;  1XFW A;  3WV2 A;  1BM6 A;  1PWP A;  1Z3J A;  3OHO A;  3LMC A;  3HY7 A;  1G05 A;  1KUI A;  3L0T A;  4A3W A;  2L0R A;  1UMS A;  1SAT A;  2J83 A;  2D1N A;  1QIC A;  3AYU A;  1HFS A;  1GXD A;  1XFY A;  2D1O A;  3EWJ A;  1BZS A;  3DL1 A;  1FLS A;  4A7B A;  1PWW A;  1XUC A;  4IJO A;  3KWV C;  1R1I A;  2OI0 A;  1UTZ A;  2OXW A;  4WKE A;  5H8X A;  1BSW A;  1CGL A;  4GR8 A;  3LEA A;  3HYG A;  4GWM A;  2YB9 A;  1AST A;  4XM6 A;  2MLR A;  2DDY A;  1IAC A;  4WK7 A;  3F18 A;  3HBU P;  2X3C A;  3ZVS A;  2OW1 A;  2OY4 A;  3EHY A;  3G42 A;  4EFS A;  1QUA A;  1KUH A;  4L6T A;  1XFV A;  4ILW D;  3O64 A;  1Y93 A;  2I47 A;  5JMY A;  5CZM A;  5I4O A;  1MNC A;  1O0Q A;  1G4K A;  2JNP A;  1KUG A;  1AKL A;  5D1U A;  5D1S A;  3DSL A;  1QJI A;  4ZR5 A;  1KAP P;  4G0D A;  2DW2 A;  4G9L A;  3HDB A;  1ATL A;  3F19 A;  2K2G A;  1SLN A;  2OW9 A;  2TCL A;  1EB6 A;  2MZI A;  3KMC A;  1BQO A;  4L19 A;  1ROS A;  4AIG A;  2OXZ A;  3F1A A;  4GUY A;  1JIZ A;  1G12 A;  1XUD A;  1D5J A;  1R1H A;  3AYK A;  2FV9 A;  1OM8 A;  4H49 A;  1XFU A;  2WO8 A;  1GKD A;  2W12 A;  1JIW P;  2Y6D A;  4XBH A;  3P24 A;  4I03 A;  1I73 A;  1FBL A;  4JIJ A;  1CIZ A;  1Q3A A;  3E8R A;  4XM7 A;  4XCT A;  1IAE A;  1GO7 P;  1GE5 A;  3KME A;  5I0L A;  1I1I P;  3HBV P;  1A86 A;  4FXQ A;  3LIL A;  1PWU A;  2FV5 A;  4FU4 A;  1YOU A;  3WV1 A;  1K7G A;  1C7K A;  5CUH A;  1MMR A;  3Q2G A;  2Y6C A;  3TT4 A;  2ERO A;  1BIW A;  2SRT A;  2JSD A;  1KBC A;  3LKA A;  4DV8 A;  1EUB A;  1EAK A;  1AYK A;  1HV5 A;  1DTH A;  3B92 A;  1G9K A;  1BQQ M;  2YIG A;  4WKI A;  3AIG A;  2KRJ A;  1H71 P;  3NX7 A;  4QKZ A;  3LIK A;  3EHX A;  1JH1 A;  2WOA A;  3LIR A;  3WV3 A;  3DPF A;  3P1V A;  5I2Z A;  4GR3 A;  1OMJ A;  1BKC I;  3K7L A;  3GBO A;  2XS3 A;  3BA0 A;  3Q2H A;  2DW1 A;  2X3B A;  2O36 A;  1UMT A;  2OW0 A;  2JT5 A;  5D2B A;  4PKU A;  4DD8 A;  2CKI A;  1KUF A;  1DMT A;  3U1R A;  1CAQ A;  3F16 A;  2E3X A;  3EDZ A;  1J7N A;  1K7Q A;  1ZXC A;  2ERQ A;  4H30 A;  1R55 A;  3N2V A;  4H2E A;  5D1T A;  3RTT A;  3F17 A;  1PWV A;  3LK8 A;  1SMP A;  4FXY P;  3KRY A;  2USN A;  3ELM A;  1O0T A;  2W13 A;  3VTG A;  1GKC A;  1XUR A;  1I76 A;  2ERP A;  3LUN A;  2K9C A;  3B2Z A;  3LQB A;  4I35 A;  3F15 A;  1Y8J A;  2JIH A;  2N8R A;  1MMB A;  2OVX A;  2OZR A;  3K7N A;  5BOT A;  3TVC A;  3RTS A;  1C3I A;  1WNI A;  1RMZ A;  2RJP A;  1BKC E;  3DNG A;  3EDH A;  1IAB A;  2O3E A;  4IN9 A;  1BUV M;  3KEJ A;  3KEC A;  1GE7 A;  1MMP A;  4GR0 A;  3N2U A;  3VI1 A;  3OHL A;  3HB2 P;  3TS4 A;  1SRP A;  1UEA A;  4PKT A;  1B8Y A;  1OO9 A;  4PKV A;  4HMA A;  1IAD A;  1PWQ A;  3L0V A;  1CK7 A;  2MLS A;  3TSK A;  2WO9 A;  5I3M A;  1CGF A;  1JKY A;  1ZTQ A;  3HDA P;  4H84 A;  1BUD A;  1OS2 A;  4PKR A;  2DW0 A;  1IAG A;  5D7W A;  3LUM A;  1QIB A;  2OY2 A;  1ZP5 A;  4H3X A;  4WZV A;  4GQL A;  3ZXH A;  1OM6 A;  1D8M A;  5B5O A;  1D7X A;  3LJZ A;  3CKI A;  830C A;  4H82 A;  1UTT A;  4JP4 A;  1AF0 A;  1L6J A;  1CQR A;  2AYK A;  1JAP A;  4R3V A;  1YCM A;  4XM8 A;  1JJ9 A;  4CTH A;  2RJQ A;  5BPA A;  4AXQ A;  4JPA A;  966C A;  4JA1 A;  1SU3 A;  5LAB A;  2MZH A;  4PKW A;  5D3C A;  4DF9 A;  3HY9 A;  1K7I A;  4WF6 A;  4HX3 A;  2W0D A;  3EDG A;  1MMQ A;  4DPE A;  4GF1 A;  1G49 A;  4AUO A;  1A85 A;  5B5P A;  2OXU A;  3B8Z A;  2PJT A;  1HY7 A;  1HFC A;  1ZS0 A;  1JAN A;  3I7G A;  2E2D A;  1QIA A;  1CXV A;  1GE6 A;  1B3D A;  1SLM A;  5BOY A;  4L63 A;  1KUK A;  3USN A;  3LJG A; 
#chains in the Genus database with same CATH topology
 2XS4 A;  3LJT A;  1BKC A;  2CLT A;  2A8H A;  1D8F A;  1ZXV A;  2POJ A;  1ZVX A;  1XFZ A;  4GWN A;  1XAX A;  3V96 B;  2JT6 A;  3I7I A;  2HU6 A;  3LQ0 A;  3ZUK A;  2QPJ A;  3EDI A;  3UVC A;  2OVZ A;  4PKS A;  1HTD A;  3KHI A;  3KEK A;  1CGE A;  3DPE A;  1HOV A;  5CXA A;  2J0T A;  4JQG A;  4Q1L A;  2AIG P;  1R54 A;  2V4B A;  2X7M A;  1JK3 A;  4H1Q A;  2W15 A;  3G5C A;  4H76 A;  1JAQ A;  5L79 A;  3DWB A;  1C8T A;  3LGP A;  1Y0V A;  4FVL A;  1RM8 A;  3MA2 A;  1GO8 P;  1USN A;  4J4M A;  4AYK A;  4ON1 A;  1FM1 A;  2W14 A;  3SHI A;  3LE9 A;  1JAO A;  5L7F A;  1YP1 A;  1R1J A;  1QJJ A;  4PKQ A;  5I12 A;  1IAA A;  5I43 A;  1S4B P;  2DDF A;  2X3A A;  1OS9 A;  4IUW A;  2OW2 A;  1OM7 A;  1ND1 A;  1XFX A;  1YQY A;  2MZE A;  3O2X A;  456C A;  2Z2D A;  1XFW A;  3WV2 A;  1BM6 A;  1PWP A;  1Z3J A;  3OHO A;  3LMC A;  3HY7 A;  1G05 A;  1KUI A;  3L0T A;  4A3W A;  2L0R A;  1UMS A;  1SAT A;  2J83 A;  2D1N A;  1QIC A;  3AYU A;  1HFS A;  1GXD A;  1XFY A;  2D1O A;  3EWJ A;  1BZS A;  3DL1 A;  1FLS A;  4A7B A;  1PWW A;  1XUC A;  4IJO A;  3KWV C;  1R1I A;  2OI0 A;  1UTZ A;  2OXW A;  4WKE A;  5H8X A;  1BSW A;  1CGL A;  4GR8 A;  3LEA A;  3HYG A;  4GWM A;  2YB9 A;  1AST A;  4XM6 A;  2MLR A;  2DDY A;  1IAC A;  4WK7 A;  3F18 A;  3HBU P;  2X3C A;  3ZVS A;  2OW1 A;  2OY4 A;  3EHY A;  3G42 A;  4EFS A;  1QUA A;  1KUH A;  4L6T A;  1XFV A;  4ILW D;  3O64 A;  1Y93 A;  2I47 A;  5JMY A;  5CZM A;  5I4O A;  1MNC A;  1O0Q A;  1G4K A;  2JNP A;  1KUG A;  1AKL A;  5D1U A;  1TVI A;  3DSL A;  1QJI A;  3DTE A;  1KAP P;  5D1S A;  4ZR5 A;  4G0D A;  2DW2 A;  4G9L A;  3HDB A;  1ATL A;  3F19 A;  2K2G A;  1SLN A;  2OW9 A;  2TCL A;  1EB6 A;  2MZI A;  3KMC A;  1BQO A;  3DTI A;  4L19 A;  1ROS A;  4AIG A;  2OXZ A;  3F1A A;  4GUY A;  1JIZ A;  1G12 A;  1XUD A;  1D5J A;  1R1H A;  3AYK A;  2FV9 A;  1OM8 A;  4H49 A;  1XFU A;  2WO8 A;  1GKD A;  1XM5 A;  2W12 A;  1JIW P;  2Y6D A;  4XBH A;  3P24 A;  4I03 A;  1I73 A;  1FBL A;  4JIJ A;  1CIZ A;  1Q3A A;  3E8R A;  4XM7 A;  4XCT A;  1IAE A;  1GO7 P;  1GE5 A;  3KME A;  5I0L A;  1I1I P;  3HBV P;  1A86 A;  4FXQ A;  1PWU A;  2FV5 A;  3LIL A;  4FU4 A;  1YOU A;  3WV1 A;  1K7G A;  1C7K A;  5CUH A;  1MMR A;  3Q2G A;  2Y6C A;  3TT4 A;  2ERO A;  4L7A A;  1BIW A;  2SRT A;  2JSD A;  1KBC A;  3LKA A;  4DV8 A;  1EUB A;  1EAK A;  1AYK A;  1HV5 A;  1DTH A;  3B92 A;  1G9K A;  1BQQ M;  2YIG A;  4WKI A;  3AIG A;  2KRJ A;  1H71 P;  3NX7 A;  4QKZ A;  3LIK A;  3EHX A;  1JH1 A;  2WOA A;  3LIR A;  3WV3 A;  3DPF A;  3P1V A;  5I2Z A;  4GR3 A;  1OMJ A;  1BKC I;  3K7L A;  3GBO A;  2XS3 A;  3BA0 A;  3Q2H A;  2DW1 A;  2X3B A;  2O36 A;  1UMT A;  2OW0 A;  2JT5 A;  5D2B A;  4PKU A;  4DD8 A;  2CKI A;  1KUF A;  1DMT A;  3U1R A;  1CAQ A;  3F16 A;  2E3X A;  3EDZ A;  1J7N A;  1K7Q A;  1ZXC A;  2ERQ A;  4H30 A;  1R55 A;  3N2V A;  4H2E A;  5D1T A;  3RTT A;  3F17 A;  1PWV A;  3LK8 A;  1SMP A;  4FXY P;  3KRY A;  2USN A;  3ELM A;  1O0T A;  2W13 A;  3VTG A;  1GKC A;  1XUR A;  1I76 A;  2ERP A;  3LUN A;  2K9C A;  3B2Z A;  3LQB A;  4I35 A;  3F15 A;  1Y8J A;  2JIH A;  2N8R A;  1MMB A;  2OVX A;  2OZR A;  3K7N A;  5BOT A;  3TVC A;  3RTS A;  1C3I A;  1WNI A;  1RMZ A;  2RJP A;  1BKC E;  3DNG A;  3EDH A;  1IAB A;  2O3E A;  4IN9 A;  1BUV M;  3KEJ A;  3KEC A;  2YUF A;  1GE7 A;  1MMP A;  4GR0 A;  3N2U A;  3VI1 A;  3OHL A;  3HB2 P;  3TS4 A;  1SRP A;  1UEA A;  4PKT A;  1B8Y A;  1OO9 A;  4PKV A;  4HMA A;  1IAD A;  1PWQ A;  3L0V A;  1CK7 A;  2MLS A;  3TSK A;  2WO9 A;  5I3M A;  1CGF A;  1JKY A;  1ZTQ A;  3HDA P;  4H84 A;  1BUD A;  1OS2 A;  4PKR A;  2DW0 A;  1IAG A;  5D7W A;  3LUM A;  1QIB A;  2OY2 A;  1ZP5 A;  4H3X A;  4WZV A;  4GQL A;  3ZXH A;  1OM6 A;  1D8M A;  5B5O A;  1D7X A;  3LJZ A;  3CKI A;  830C A;  4H82 A;  1UTT A;  4JP4 A;  1AF0 A;  1L6J A;  1CQR A;  1OZ9 A;  2AYK A;  1JAP A;  4R3V A;  1YCM A;  4XM8 A;  1JJ9 A;  4CTH A;  2RJQ A;  5BPA A;  4AXQ A;  4JPA A;  966C A;  4JA1 A;  1SU3 A;  5LAB A;  2MZH A;  4PKW A;  5D3C A;  4DF9 A;  3HY9 A;  1K7I A;  4WF6 A;  4HX3 A;  2W0D A;  3EDG A;  1MMQ A;  4DPE A;  4GF1 A;  3DTK A;  1G49 A;  4AUO A;  1A85 A;  5B5P A;  2OXU A;  3B8Z A;  2PJT A;  1HY7 A;  1HFC A;  1ZS0 A;  1JAN A;  3I7G A;  2E2D A;  1QIA A;  1CXV A;  1GE6 A;  1B3D A;  1SLM A;  5BOY A;  4L63 A;  1KUK A;  3USN A;  3LJG A; 
#chains in the Genus database with same CATH homology
 2XS4 A;  3LJT A;  1BKC A;  2CLT A;  2A8H A;  1D8F A;  1ZXV A;  2POJ A;  1ZVX A;  1XFZ A;  4GWN A;  3V96 B;  2JT6 A;  3I7I A;  2HU6 A;  3LQ0 A;  3ZUK A;  2QPJ A;  3EDI A;  3UVC A;  2OVZ A;  4PKS A;  1HTD A;  3KHI A;  3KEK A;  1CGE A;  3DPE A;  1HOV A;  5CXA A;  2J0T A;  4JQG A;  4Q1L A;  2AIG P;  1R54 A;  2V4B A;  2X7M A;  1JK3 A;  4H1Q A;  2W15 A;  3G5C A;  4H76 A;  1JAQ A;  5L79 A;  3DWB A;  1C8T A;  3LGP A;  1Y0V A;  4FVL A;  1RM8 A;  3MA2 A;  1GO8 P;  1USN A;  4J4M A;  4AYK A;  4ON1 A;  1FM1 A;  2W14 A;  3SHI A;  3LE9 A;  1JAO A;  5L7F A;  1YP1 A;  1R1J A;  1QJJ A;  4PKQ A;  5I12 A;  1IAA A;  5I43 A;  1S4B P;  2DDF A;  2X3A A;  1OS9 A;  4IUW A;  2OW2 A;  1OM7 A;  1ND1 A;  1XFX A;  1YQY A;  2MZE A;  3O2X A;  456C A;  2Z2D A;  1XFW A;  3WV2 A;  1BM6 A;  1PWP A;  1Z3J A;  3OHO A;  3LMC A;  3HY7 A;  1G05 A;  1KUI A;  3L0T A;  4A3W A;  2L0R A;  1UMS A;  1SAT A;  2J83 A;  2D1N A;  1QIC A;  3AYU A;  1HFS A;  1GXD A;  1XFY A;  2D1O A;  3EWJ A;  1BZS A;  3DL1 A;  1FLS A;  4A7B A;  1PWW A;  1XUC A;  4IJO A;  3KWV C;  1R1I A;  2OI0 A;  1UTZ A;  2OXW A;  4WKE A;  5H8X A;  1BSW A;  1CGL A;  4GR8 A;  3LEA A;  3HYG A;  4GWM A;  2YB9 A;  1AST A;  4XM6 A;  2MLR A;  2DDY A;  1IAC A;  4WK7 A;  3F18 A;  3HBU P;  2X3C A;  3ZVS A;  2OW1 A;  2OY4 A;  3EHY A;  3G42 A;  4EFS A;  1QUA A;  1KUH A;  4L6T A;  1XFV A;  4ILW D;  3O64 A;  1Y93 A;  2I47 A;  5JMY A;  5CZM A;  5I4O A;  1MNC A;  1O0Q A;  1G4K A;  2JNP A;  1KUG A;  1AKL A;  5D1U A;  5D1S A;  3DSL A;  1QJI A;  3DTE A;  1KAP P;  4ZR5 A;  4G0D A;  2DW2 A;  4G9L A;  3HDB A;  1ATL A;  3F19 A;  2K2G A;  1SLN A;  2OW9 A;  2TCL A;  1EB6 A;  2MZI A;  3KMC A;  1BQO A;  3DTI A;  4L19 A;  1ROS A;  4AIG A;  2OXZ A;  3F1A A;  4GUY A;  1JIZ A;  1G12 A;  1XUD A;  1D5J A;  1R1H A;  3AYK A;  2FV9 A;  1OM8 A;  4H49 A;  1XFU A;  2WO8 A;  1GKD A;  2W12 A;  1JIW P;  2Y6D A;  4XBH A;  3P24 A;  4I03 A;  1I73 A;  1FBL A;  4JIJ A;  1CIZ A;  1Q3A A;  3E8R A;  4XM7 A;  4XCT A;  1IAE A;  1GO7 P;  1GE5 A;  3KME A;  5I0L A;  1I1I P;  3HBV P;  1A86 A;  4FXQ A;  3LIL A;  1PWU A;  2FV5 A;  4FU4 A;  1YOU A;  3WV1 A;  1K7G A;  1C7K A;  5CUH A;  1MMR A;  3Q2G A;  2Y6C A;  3TT4 A;  2ERO A;  4L7A A;  1BIW A;  2SRT A;  2JSD A;  1KBC A;  3LKA A;  4DV8 A;  1EUB A;  1EAK A;  1AYK A;  1HV5 A;  1DTH A;  3B92 A;  1G9K A;  1BQQ M;  2YIG A;  4WKI A;  3AIG A;  2KRJ A;  1H71 P;  3NX7 A;  4QKZ A;  3LIK A;  3EHX A;  1JH1 A;  2WOA A;  3LIR A;  3WV3 A;  3DPF A;  3P1V A;  5I2Z A;  4GR3 A;  1OMJ A;  1BKC I;  3K7L A;  3GBO A;  2XS3 A;  3BA0 A;  3Q2H A;  2DW1 A;  2X3B A;  2O36 A;  1UMT A;  2OW0 A;  2JT5 A;  5D2B A;  4PKU A;  4DD8 A;  2CKI A;  1KUF A;  1DMT A;  3U1R A;  1CAQ A;  3F16 A;  2E3X A;  3EDZ A;  1J7N A;  1K7Q A;  1ZXC A;  2ERQ A;  4H30 A;  1R55 A;  3N2V A;  4H2E A;  5D1T A;  3RTT A;  3F17 A;  1PWV A;  3LK8 A;  1SMP A;  4FXY P;  3KRY A;  2USN A;  3ELM A;  1O0T A;  2W13 A;  3VTG A;  1GKC A;  1XUR A;  1I76 A;  2ERP A;  3LUN A;  2K9C A;  3B2Z A;  3LQB A;  4I35 A;  3F15 A;  1Y8J A;  2JIH A;  2N8R A;  1MMB A;  2OVX A;  2OZR A;  3K7N A;  5BOT A;  3TVC A;  3RTS A;  1C3I A;  1WNI A;  1RMZ A;  2RJP A;  1BKC E;  3DNG A;  3EDH A;  1IAB A;  2O3E A;  4IN9 A;  1BUV M;  3KEJ A;  3KEC A;  2YUF A;  1GE7 A;  1MMP A;  4GR0 A;  3N2U A;  3VI1 A;  3OHL A;  3HB2 P;  3TS4 A;  1SRP A;  1UEA A;  4PKT A;  1B8Y A;  1OO9 A;  4PKV A;  4HMA A;  1IAD A;  1PWQ A;  3L0V A;  1CK7 A;  2MLS A;  3TSK A;  2WO9 A;  5I3M A;  1CGF A;  1JKY A;  1ZTQ A;  3HDA P;  4H84 A;  1BUD A;  1OS2 A;  4PKR A;  2DW0 A;  1IAG A;  5D7W A;  3LUM A;  1QIB A;  2OY2 A;  1ZP5 A;  4H3X A;  4WZV A;  4GQL A;  3ZXH A;  1OM6 A;  1D8M A;  5B5O A;  1D7X A;  3LJZ A;  3CKI A;  830C A;  4H82 A;  1UTT A;  4JP4 A;  1AF0 A;  1L6J A;  1CQR A;  2AYK A;  1JAP A;  4R3V A;  1YCM A;  4XM8 A;  1JJ9 A;  4CTH A;  2RJQ A;  5BPA A;  4AXQ A;  4JPA A;  966C A;  4JA1 A;  1SU3 A;  5LAB A;  2MZH A;  4PKW A;  5D3C A;  4DF9 A;  3HY9 A;  1K7I A;  4WF6 A;  4HX3 A;  2W0D A;  3EDG A;  1MMQ A;  4DPE A;  4GF1 A;  3DTK A;  1G49 A;  4AUO A;  1A85 A;  5B5P A;  2OXU A;  3B8Z A;  2PJT A;  1HY7 A;  1HFC A;  1ZS0 A;  1JAN A;  3I7G A;  2E2D A;  1QIA A;  1CXV A;  1GE6 A;  1B3D A;  1SLM A;  5BOY A;  4L63 A;  1KUK A;  3USN A;  3LJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...