1JAQA

Complex of 1-hydroxylamine-2-isobutylmalonyl-ala-gly-nh2 with the catalytic domain of matrix metallo proteinase-8 (met80 form)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
b'NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLO PROTEINASE-8 (MET80 FORM)
publication title X-ray structures of human neutrophil collagenase complexed with peptide hydroxamate and peptide thiol inhibitors. Implications for substrate binding and rational drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1996-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1jaqA00
2FV5A 1JH1A 1XFVA 4AUOA 1DMTA 2E3XA 1GO8P 4XM6A 3BA0A 2Y6CA 5BPAA 4HMAA 5D7WA 3GBOA 1C8TA 1D8FA 4PKUA 4XM7A 3TS4A 4WF6A 3P1VA 1BKCA 1JAOA 1Y8JA 2QPJA 3UVCA 1XUDA 1EAKA 4H2EA 1D7XA 3USNA 2PJTA 3F18A 4IN9A 3HBVP 4J4MA 1BUDA 1JIZA 1IAGA 3K7NA 2MZIA 3VTGA 3LJTA 4G9LA 2N8RA 4A3WA 2ERQA 4I35A 2TCLA 2MZEA 4H49A 1HOVA 1SLMA 1CXVA 1IABA 3ZVSA 3WV3A 4GQLA 1YQYA 5D2BA 1XUCA 4H3XA 4FXYP 3KMCA 1OS9A 1YP1A 3HYGA 3EDHA 1DTHA 1IADA 2W15A 3KRYA 1YCMA 4FU4A 1ZTQA 5I0LA 2E2DA 1R54A 4ILWD 1QICA 966CA 3KHIA 1SATA 3AIGA 3MA2A 1Z3JA 3HDAP 1K7GA 1Q3AA 3F16A 4Q1LA 1CQRA 1Y0VA 1SMPA 3LE9A 3LGPA 1JAQA 1C7KA 4JIJA 2OW9A 3LILA 3Q2HA 3LIRA 1CGLA 5B5OA 2OW1A 1XURA 2O36A 1PWQA 2J83A 4CTHA 1OMJA 1RMZA 1SU3A 3N2UA 3DPEA 3LJGA 1BKCE 1BQOA 1PWPA 4GR3A 4EFSA 1GE6A 3B92A 1SRPA 1ATLA 1JANA 1D5JA 5BOTA 1A85A 2RJQA 1S4BP 2V4BA 3KECA 1XFYA 1ASTA 2YB9A 3LUNA 4WK7A 3F1AA 4H82A 4WZVA 1FLSA 1XFXA 1H71P 1JK3A 4WKEA 5D1TA 4XBHA 2OXZA 1KBCA 2DDFA 5I4OA 2OW0A 4G0DA 3LUMA 5D1UA 3HY9A 4PKTA 2W14A 3TT4A 2OXWA 4DV8A 4PKRA 1ZS0A 2XS4A 2ERPA 5I2ZA 2CLTA 3SHIA 2OW2A 1GKDA 1PWVA 4L6TA 2FV9A 1UTTA 830CA 1GE5A 3DPFA 2O3EA 1AKLA 4ON1A 1XFWA 1SLNA 3OHOA 1UMTA 1OM6A 1JKYA 5CXAA 3EWJA 1XFUA 4GUYA 4XM8A 3F15A 1UMSA 1R55A 1IAAA 1IACA 1GE7A 3EHYA 2DDYA 1J7NA 5L7FA 5I12A 4H76A 1HFCA 1HV5A 1ROSA 3EDIA 2HU6A 4IUWA 3KEKA 3O2XA 5CUHA 4ZR5A 1BKCI 1CAQA 3LK8A 1D8MA 5I3MA 3CKIA 1CK7A 1QIAA 2Y6DA 3B2ZA 1A86A 1PWUA 1RM8A 2AYKA 1OM8A 2DW1A 1ND1A 5D1SA 1MMQA 1G05A 1USNA 1I1IP 1C3IA 3HB2P 1JJ9A 4JA1A 4WKIA 3E8RA 3V96B 1L6JA 3F17A 3G5CA 2JT6A 1KUIA 1Y93A 3K7LA 1MMPA 2KRJA 1BQQM 2MLSA 1IAEA 1OO9A 3DNGA 4GF1A 3L0TA 2OY2A 1ZVXA 3HY7A 3LQBA 4PKVA 3LEAA 1QIBA 4R3VA 2JSDA 1G12A 1K7QA 2MZHA 2X3CA 4H1QA 1PWWA 2D1OA 456CA 1UTZA 4DF9A 1KUHA 1G4KA 4AIGA 2XS3A 3NX7A 5L79A 3KEJA 3RTSA 2W12A 4XCTA 2OI0A 2JIHA 3AYUA 5B5PA 3I7IA 1ZXCA 2K2GA 1JAPA 1QJIA 3VI1A 2SRTA 3KMEA 3TVCA 4H84A 3EDGA 4H30A 1FM1A 1O0QA 4AXQA 3OHLA 2I47A 5LABA 4L19A 1BSWA 5CZMA 1YOUA 2JT5A 1GKCA 5D3CA 1BZSA 1KUFA 2OVXA 1CGEA 2D1NA 3DSLA 3I7GA 1MMRA 2AIGP 3HBUP 1UEAA 2W13A 2RJPA 2OVZA 2W0DA 1G9KA 1I73A 1OM7A 3Q2GA 1R1HA 1HTDA 1KUGA 4JPAA 4QKZA 4PKQA 3F19A 1OS2A 1WNIA 1AYKA 1BIWA 3LIKA 1EB6A 1O0TA 3WV2A 4PKSA 3LKAA 3LJZA 1BUVM 1R1JA 4L63A 1AF0A 1CGFA 3G42A 1QJJA 4A7BA 2DW0A 3P24A 1I76A 1MNCA 3KWVC 4IJOA 1K7IA 4AYKA 1GXDA 1MMBA 3ZUKA 4GR8A 4FVLA 3LQ0A 1B3DA 2J0TA 2JNPA 1FBLA 1KAPP 4GWNA 1ZP5A 5BOYA 2OY4A 3LMCA 2X7MA 1G49A 3DL1A 3O64A 2MLRA 3N2VA 4PKWA 5H8XA 1QUAA 3DWBA 1CIZA 3TSKA 4FXQA 2WO8A 4HX3A 1R1IA 1XFZA 2K9CA 3AYKA 1EUBA 1JIWP 1B8YA 2USNA 4JQGA 2X3AA 2WO9A 2L0RA 4DD8A 2A8HA 1KUKA 1GO7P 3ELMA 4JP4A 3B8ZA 3RTTA 3U1RA 3ZXHA 4I03A 2WOAA 2CKIA 1ZXVA 3EDZA 1HY7A 2OXUA 2OZRA 4DPEA 3EHXA 1HFSA 2Z2DA 1BM6A 4GWMA 2YIGA 2DW2A 2POJA 2X3BA 3WV1A 5I43A 3HDBA 5JMYA 2EROA 3L0VA 4GR0A
chains in the Genus database with same CATH superfamily
2FV5A 1JH1A 1XFVA 4AUOA 1DMTA 2E3XA 1GO8P 4XM6A 3BA0A 2Y6CA 5BPAA 4HMAA 5D7WA 3GBOA 2YUFA 1C8TA 1D8FA 4PKUA 4XM7A 3TS4A 4WF6A 3P1VA 1BKCA 1JAOA 1Y8JA 2QPJA 3UVCA 1XUDA 1EAKA 4H2EA 1D7XA 3USNA 2PJTA 3F18A 4IN9A 3HBVP 4J4MA 1BUDA 1JIZA 1IAGA 3K7NA 2MZIA 3VTGA 3LJTA 4G9LA 2N8RA 4A3WA 2ERQA 4I35A 2TCLA 2MZEA 4H49A 1HOVA 1SLMA 1CXVA 1IABA 3ZVSA 3WV3A 4GQLA 1YQYA 5D2BA 1XUCA 4H3XA 4FXYP 3KMCA 1OS9A 1YP1A 3HYGA 3EDHA 1DTHA 1IADA 2W15A 3KRYA 1YCMA 4FU4A 1ZTQA 5I0LA 2E2DA 1R54A 4ILWD 1QICA 966CA 3KHIA 1SATA 3AIGA 3MA2A 1Z3JA 3HDAP 1K7GA 1Q3AA 3F16A 4Q1LA 1CQRA 1Y0VA 1SMPA 3LE9A 3LGPA 1JAQA 1C7KA 4JIJA 2OW9A 3LILA 3Q2HA 3LIRA 1CGLA 1XAXA 5B5OA 2OW1A 1XURA 2O36A 1PWQA 2J83A 4CTHA 1OMJA 1RMZA 1SU3A 3N2UA 3DPEA 3LJGA 1BKCE 1BQOA 1PWPA 4GR3A 4EFSA 1GE6A 3B92A 1SRPA 1ATLA 1JANA 1D5JA 5BOTA 1A85A 2RJQA 1S4BP 2V4BA 3KECA 1XFYA 1ASTA 2YB9A 3LUNA 4WK7A 3F1AA 4H82A 4WZVA 1FLSA 1XFXA 1H71P 1JK3A 4WKEA 5D1TA 4XBHA 2OXZA 1KBCA 2DDFA 5I4OA 2OW0A 4G0DA 3LUMA 5D1UA 3HY9A 4PKTA 2W14A 3TT4A 2OXWA 4DV8A 4PKRA 1ZS0A 2XS4A 2ERPA 5I2ZA 2CLTA 3SHIA 1TVIA 2OW2A 1GKDA 1PWVA 4L6TA 2FV9A 1UTTA 830CA 1GE5A 3DPFA 2O3EA 1AKLA 4ON1A 1XFWA 1SLNA 3OHOA 1UMTA 1OM6A 1JKYA 5CXAA 3EWJA 1XFUA 4GUYA 4XM8A 3F15A 1UMSA 1R55A 1IAAA 1IACA 1GE7A 3EHYA 2DDYA 1J7NA 5L7FA 5I12A 3DTKA 4H76A 1HFCA 1HV5A 1ROSA 3EDIA 2HU6A 4IUWA 3KEKA 3O2XA 5CUHA 4ZR5A 1BKCI 1CAQA 3LK8A 1D8MA 5I3MA 3CKIA 1CK7A 1QIAA 2Y6DA 3B2ZA 1A86A 1PWUA 1RM8A 2AYKA 1OM8A 2DW1A 1ND1A 5D1SA 1MMQA 1G05A 1USNA 1I1IP 1C3IA 3HB2P 1JJ9A 4JA1A 4WKIA 3E8RA 3V96B 1L6JA 3F17A 3G5CA 2JT6A 1KUIA 1Y93A 3K7LA 1MMPA 2KRJA 1BQQM 2MLSA 1IAEA 1OO9A 3DNGA 4GF1A 3L0TA 2OY2A 1ZVXA 3HY7A 3LQBA 4PKVA 3LEAA 1QIBA 4R3VA 2JSDA 1G12A 1K7QA 2MZHA 2X3CA 4H1QA 1PWWA 2D1OA 456CA 1UTZA 4DF9A 1KUHA 1G4KA 4AIGA 2XS3A 3NX7A 5L79A 3KEJA 3RTSA 2W12A 4XCTA 2OI0A 4L7AA 2JIHA 3AYUA 3DTEA 5B5PA 3I7IA 1ZXCA 2K2GA 1JAPA 1QJIA 3VI1A 2SRTA 3KMEA 3TVCA 4H84A 3EDGA 4H30A 1FM1A 1O0QA 4AXQA 3OHLA 2I47A 5LABA 4L19A 1OZ9A 1BSWA 5CZMA 1YOUA 2JT5A 1GKCA 5D3CA 1BZSA 1KUFA 2OVXA 1CGEA 2D1NA 3DSLA 3I7GA 1MMRA 2AIGP 3HBUP 1UEAA 2W13A 2RJPA 2OVZA 2W0DA 1G9KA 1I73A 1OM7A 3Q2GA 1R1HA 1HTDA 1KUGA 4JPAA 4QKZA 4PKQA 3F19A 1OS2A 1WNIA 1AYKA 1BIWA 3LIKA 1EB6A 1O0TA 3WV2A 3DTIA 4PKSA 3LKAA 3LJZA 1BUVM 1R1JA 4L63A 1AF0A 1CGFA 3G42A 1QJJA 4A7BA 2DW0A 3P24A 1I76A 1MNCA 3KWVC 4IJOA 1K7IA 4AYKA 1GXDA 1MMBA 3ZUKA 4GR8A 4FVLA 1XM5A 3LQ0A 1B3DA 2J0TA 2JNPA 1FBLA 1KAPP 4GWNA 1ZP5A 5BOYA 2OY4A 3LMCA 2X7MA 1G49A 3DL1A 3O64A 2MLRA 3N2VA 4PKWA 5H8XA 1QUAA 3DWBA 1CIZA 3TSKA 4FXQA 2WO8A 4HX3A 1R1IA 1XFZA 2K9CA 3AYKA 1EUBA 1JIWP 1B8YA 2USNA 4JQGA 2X3AA 2WO9A 2L0RA 4DD8A 2A8HA 1KUKA 1GO7P 3ELMA 4JP4A 3B8ZA 3RTTA 3U1RA 3ZXHA 4I03A 2WOAA 2CKIA 1ZXVA 3EDZA 1HY7A 2OXUA 2OZRA 4DPEA 3EHXA 1HFSA 2Z2DA 1BM6A 4GWMA 2YIGA 2DW2A 2POJA 2X3BA 3WV1A 5I43A 3HDBA 5JMYA 2EROA 3L0VA 4GR0A
chains in the Genus database with same CATH topology
2FV5A 1JH1A 1XFVA 4AUOA 1DMTA 2E3XA 1GO8P 4XM6A 3BA0A 2Y6CA 5BPAA 4HMAA 5D7WA 3GBOA 2YUFA 1C8TA 1D8FA 4PKUA 4XM7A 3TS4A 4WF6A 3P1VA 1BKCA 1JAOA 1Y8JA 2QPJA 3UVCA 1XUDA 1EAKA 4H2EA 1D7XA 3USNA 2PJTA 3F18A 4IN9A 3HBVP 4J4MA 1BUDA 1JIZA 1IAGA 3K7NA 2MZIA 3VTGA 3LJTA 4G9LA 2N8RA 4A3WA 2ERQA 4I35A 2TCLA 2MZEA 4H49A 1HOVA 1SLMA 1CXVA 1IABA 3ZVSA 3WV3A 4GQLA 1YQYA 5D2BA 1XUCA 4H3XA 4FXYP 3KMCA 1OS9A 1YP1A 3HYGA 3EDHA 1DTHA 1IADA 2W15A 3KRYA 1YCMA 4FU4A 1ZTQA 5I0LA 2E2DA 1R54A 4ILWD 1QICA 966CA 3KHIA 1SATA 3AIGA 3MA2A 1Z3JA 3HDAP 1K7GA 1Q3AA 3F16A 4Q1LA 1CQRA 1Y0VA 1SMPA 3LE9A 3LGPA 1JAQA 1C7KA 4JIJA 2OW9A 3LILA 3Q2HA 3LIRA 1CGLA 5B5OA 2OW1A 1XURA 2O36A 1PWQA 2J83A 4CTHA 1OMJA 1RMZA 1SU3A 3N2UA 3DPEA 3LJGA 1BKCE 1BQOA 1PWPA 4GR3A 4EFSA 1GE6A 3B92A 1SRPA 1ATLA 1JANA 1D5JA 5BOTA 1A85A 2RJQA 1S4BP 2V4BA 3KECA 1XFYA 1ASTA 2YB9A 3LUNA 4WK7A 3F1AA 4H82A 4WZVA 1FLSA 1XFXA 1H71P 1JK3A 4WKEA 5D1TA 4XBHA 2OXZA 1KBCA 2DDFA 5I4OA 2OW0A 4G0DA 3LUMA 5D1UA 3HY9A 4PKTA 2W14A 3TT4A 2OXWA 4DV8A 4PKRA 1ZS0A 2XS4A 2ERPA 5I2ZA 2CLTA 3SHIA 2OW2A 1GKDA 1PWVA 4L6TA 2FV9A 1UTTA 830CA 1GE5A 3DPFA 2O3EA 1AKLA 4ON1A 1XFWA 1SLNA 3OHOA 1UMTA 1OM6A 1JKYA 5CXAA 3EWJA 1XFUA 4GUYA 4XM8A 3F15A 1UMSA 1R55A 1IAAA 1IACA 1GE7A 3EHYA 2DDYA 1J7NA 5L7FA 5I12A 3DTKA 4H76A 1HFCA 1HV5A 1ROSA 3EDIA 2HU6A 4IUWA 3KEKA 3O2XA 5CUHA 4ZR5A 1BKCI 1CAQA 3LK8A 1D8MA 5I3MA 3CKIA 1CK7A 1QIAA 2Y6DA 3B2ZA 1A86A 1PWUA 1RM8A 2AYKA 1OM8A 2DW1A 1ND1A 5D1SA 1MMQA 1G05A 1USNA 1I1IP 1C3IA 3HB2P 1JJ9A 4JA1A 4WKIA 3E8RA 3V96B 1L6JA 3F17A 3G5CA 2JT6A 1KUIA 1Y93A 3K7LA 1MMPA 2KRJA 1BQQM 2MLSA 1IAEA 1OO9A 3DNGA 4GF1A 3L0TA 2OY2A 1ZVXA 3HY7A 3LQBA 4PKVA 3LEAA 1QIBA 4R3VA 2JSDA 1G12A 1K7QA 2MZHA 2X3CA 4H1QA 1PWWA 2D1OA 456CA 1UTZA 4DF9A 1KUHA 1G4KA 4AIGA 2XS3A 3NX7A 5L79A 3KEJA 3RTSA 2W12A 4XCTA 2OI0A 4L7AA 2JIHA 3AYUA 3DTEA 5B5PA 3I7IA 1ZXCA 2K2GA 1JAPA 1QJIA 3VI1A 2SRTA 3KMEA 3TVCA 4H84A 3EDGA 4H30A 1FM1A 1O0QA 4AXQA 3OHLA 2I47A 5LABA 4L19A 1BSWA 5CZMA 1YOUA 2JT5A 1GKCA 5D3CA 1BZSA 1KUFA 2OVXA 1CGEA 2D1NA 3DSLA 3I7GA 1MMRA 2AIGP 3HBUP 1UEAA 2W13A 2RJPA 2OVZA 2W0DA 1G9KA 1I73A 1OM7A 3Q2GA 1R1HA 1HTDA 1KUGA 4JPAA 4QKZA 4PKQA 3F19A 1OS2A 1WNIA 1AYKA 1BIWA 3LIKA 1EB6A 1O0TA 3WV2A 3DTIA 4PKSA 3LKAA 3LJZA 1BUVM 1R1JA 4L63A 1AF0A 1CGFA 3G42A 1QJJA 4A7BA 2DW0A 3P24A 1I76A 1MNCA 3KWVC 4IJOA 1K7IA 4AYKA 1GXDA 1MMBA 3ZUKA 4GR8A 4FVLA 3LQ0A 1B3DA 2J0TA 2JNPA 1FBLA 1KAPP 4GWNA 1ZP5A 5BOYA 2OY4A 3LMCA 2X7MA 1G49A 3DL1A 3O64A 2MLRA 3N2VA 4PKWA 5H8XA 1QUAA 3DWBA 1CIZA 3TSKA 4FXQA 2WO8A 4HX3A 1R1IA 1XFZA 2K9CA 3AYKA 1EUBA 1JIWP 1B8YA 2USNA 4JQGA 2X3AA 2WO9A 2L0RA 4DD8A 2A8HA 1KUKA 1GO7P 3ELMA 4JP4A 3B8ZA 3RTTA 3U1RA 3ZXHA 4I03A 2WOAA 2CKIA 1ZXVA 3EDZA 1HY7A 2OXUA 2OZRA 4DPEA 3EHXA 1HFSA 2Z2DA 1BM6A 4GWMA 2YIGA 2DW2A 2POJA 2X3BA 3WV1A 5I43A 3HDBA 5JMYA 2EROA 3L0VA 4GR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FV5 A;  1JH1 A;  1XFV A;  4AUO A;  1DMT A;  2E3X A;  1GO8 P;  4XM6 A;  3BA0 A;  2Y6C A;  5BPA A;  4HMA A;  5D7W A;  3GBO A;  1C8T A;  1D8F A;  4PKU A;  4XM7 A;  3TS4 A;  4WF6 A;  3P1V A;  1BKC A;  1JAO A;  1Y8J A;  2QPJ A;  3UVC A;  1XUD A;  1EAK A;  4H2E A;  1D7X A;  3USN A;  2PJT A;  3F18 A;  4IN9 A;  3HBV P;  4J4M A;  1BUD A;  1JIZ A;  1IAG A;  3K7N A;  2MZI A;  3VTG A;  3LJT A;  4G9L A;  2N8R A;  4A3W A;  2ERQ A;  4I35 A;  2TCL A;  2MZE A;  4H49 A;  1HOV A;  1SLM A;  1CXV A;  1IAB A;  3ZVS A;  3WV3 A;  4GQL A;  1YQY A;  5D2B A;  1XUC A;  4H3X A;  4FXY P;  3KMC A;  1OS9 A;  1YP1 A;  3HYG A;  3EDH A;  1DTH A;  1IAD A;  2W15 A;  3KRY A;  1YCM A;  4FU4 A;  1ZTQ A;  5I0L A;  2E2D A;  1R54 A;  4ILW D;  1QIC A;  966C A;  3KHI A;  1SAT A;  3AIG A;  3MA2 A;  1Z3J A;  3HDA P;  1K7G A;  1Q3A A;  3F16 A;  4Q1L A;  1CQR A;  1Y0V A;  1SMP A;  3LE9 A;  3LGP A;  1JAQ A;  1C7K A;  4JIJ A;  2OW9 A;  3LIL A;  3Q2H A;  3LIR A;  1CGL A;  5B5O A;  2OW1 A;  1XUR A;  2O36 A;  1PWQ A;  2J83 A;  4CTH A;  1OMJ A;  1RMZ A;  1SU3 A;  3N2U A;  3DPE A;  3LJG A;  1BKC E;  1BQO A;  1PWP A;  4GR3 A;  4EFS A;  1GE6 A;  3B92 A;  1SRP A;  1ATL A;  1JAN A;  1D5J A;  5BOT A;  1A85 A;  2RJQ A;  1S4B P;  2V4B A;  3KEC A;  1XFY A;  1AST A;  2YB9 A;  3LUN A;  4WK7 A;  3F1A A;  4H82 A;  4WZV A;  1FLS A;  1XFX A;  1H71 P;  1JK3 A;  4WKE A;  5D1T A;  4XBH A;  2OXZ A;  1KBC A;  2DDF A;  5I4O A;  2OW0 A;  4G0D A;  3LUM A;  5D1U A;  3HY9 A;  4PKT A;  2W14 A;  3TT4 A;  2OXW A;  4DV8 A;  4PKR A;  1ZS0 A;  2XS4 A;  2ERP A;  5I2Z A;  2CLT A;  3SHI A;  2OW2 A;  1GKD A;  1PWV A;  4L6T A;  2FV9 A;  1UTT A;  830C A;  1GE5 A;  3DPF A;  2O3E A;  1AKL A;  4ON1 A;  1XFW A;  1SLN A;  3OHO A;  1UMT A;  1OM6 A;  1JKY A;  5CXA A;  3EWJ A;  1XFU A;  4GUY A;  4XM8 A;  3F15 A;  1UMS A;  1R55 A;  1IAA A;  1IAC A;  1GE7 A;  3EHY A;  2DDY A;  1J7N A;  5L7F A;  5I12 A;  4H76 A;  1HFC A;  1HV5 A;  1ROS A;  3EDI A;  2HU6 A;  4IUW A;  3KEK A;  3O2X A;  5CUH A;  4ZR5 A;  1BKC I;  1CAQ A;  3LK8 A;  1D8M A;  5I3M A;  3CKI A;  1CK7 A;  1QIA A;  2Y6D A;  3B2Z A;  1A86 A;  1PWU A;  1RM8 A;  2AYK A;  1OM8 A;  2DW1 A;  1ND1 A;  5D1S A;  1MMQ A;  1G05 A;  1USN A;  1I1I P;  1C3I A;  3HB2 P;  1JJ9 A;  4JA1 A;  4WKI A;  3E8R A;  3V96 B;  1L6J A;  3F17 A;  3G5C A;  2JT6 A;  1KUI A;  1Y93 A;  3K7L A;  1MMP A;  2KRJ A;  1BQQ M;  2MLS A;  1IAE A;  1OO9 A;  3DNG A;  4GF1 A;  3L0T A;  2OY2 A;  1ZVX A;  3HY7 A;  3LQB A;  4PKV A;  3LEA A;  1QIB A;  4R3V A;  2JSD A;  1G12 A;  1K7Q A;  2MZH A;  2X3C A;  4H1Q A;  1PWW A;  2D1O A;  456C A;  1UTZ A;  4DF9 A;  1KUH A;  1G4K A;  4AIG A;  2XS3 A;  3NX7 A;  5L79 A;  3KEJ A;  3RTS A;  2W12 A;  4XCT A;  2OI0 A;  2JIH A;  3AYU A;  5B5P A;  3I7I A;  1ZXC A;  2K2G A;  1JAP A;  1QJI A;  3VI1 A;  2SRT A;  3KME A;  3TVC A;  4H84 A;  3EDG A;  4H30 A;  1FM1 A;  1O0Q A;  4AXQ A;  3OHL A;  2I47 A;  5LAB A;  4L19 A;  1BSW A;  5CZM A;  1YOU A;  2JT5 A;  1GKC A;  5D3C A;  1BZS A;  1KUF A;  2OVX A;  1CGE A;  2D1N A;  3DSL A;  3I7G A;  1MMR A;  2AIG P;  3HBU P;  1UEA A;  2W13 A;  2RJP A;  2OVZ A;  2W0D A;  1G9K A;  1I73 A;  1OM7 A;  3Q2G A;  1R1H A;  1HTD A;  1KUG A;  4JPA A;  4QKZ A;  4PKQ A;  3F19 A;  1OS2 A;  1WNI A;  1AYK A;  1BIW A;  3LIK A;  1EB6 A;  1O0T A;  3WV2 A;  4PKS A;  3LKA A;  3LJZ A;  1BUV M;  1R1J A;  4L63 A;  1AF0 A;  1CGF A;  3G42 A;  1QJJ A;  4A7B A;  2DW0 A;  3P24 A;  1I76 A;  1MNC A;  3KWV C;  4IJO A;  1K7I A;  4AYK A;  1GXD A;  1MMB A;  3ZUK A;  4GR8 A;  4FVL A;  3LQ0 A;  1B3D A;  2J0T A;  2JNP A;  1FBL A;  1KAP P;  4GWN A;  1ZP5 A;  5BOY A;  2OY4 A;  3LMC A;  2X7M A;  1G49 A;  3DL1 A;  3O64 A;  2MLR A;  3N2V A;  4PKW A;  5H8X A;  1QUA A;  3DWB A;  1CIZ A;  3TSK A;  4FXQ A;  2WO8 A;  4HX3 A;  1R1I A;  1XFZ A;  2K9C A;  3AYK A;  1EUB A;  1JIW P;  1B8Y A;  2USN A;  4JQG A;  2X3A A;  2WO9 A;  2L0R A;  4DD8 A;  2A8H A;  1KUK A;  1GO7 P;  3ELM A;  4JP4 A;  3B8Z A;  3RTT A;  3U1R A;  3ZXH A;  4I03 A;  2WOA A;  2CKI A;  1ZXV A;  3EDZ A;  1HY7 A;  2OXU A;  2OZR A;  4DPE A;  3EHX A;  1HFS A;  2Z2D A;  1BM6 A;  4GWM A;  2YIG A;  2DW2 A;  2POJ A;  2X3B A;  3WV1 A;  5I43 A;  3HDB A;  5JMY A;  2ERO A;  3L0V A;  4GR0 A; 
#chains in the Genus database with same CATH topology
 2FV5 A;  1JH1 A;  1XFV A;  4AUO A;  1DMT A;  2E3X A;  1GO8 P;  4XM6 A;  3BA0 A;  2Y6C A;  5BPA A;  4HMA A;  5D7W A;  3GBO A;  2YUF A;  1C8T A;  1D8F A;  4PKU A;  4XM7 A;  3TS4 A;  4WF6 A;  3P1V A;  1BKC A;  1JAO A;  1Y8J A;  2QPJ A;  3UVC A;  1XUD A;  1EAK A;  4H2E A;  1D7X A;  3USN A;  2PJT A;  3F18 A;  4IN9 A;  3HBV P;  4J4M A;  1BUD A;  1JIZ A;  1IAG A;  3K7N A;  2MZI A;  3VTG A;  3LJT A;  4G9L A;  2N8R A;  4A3W A;  2ERQ A;  4I35 A;  2TCL A;  2MZE A;  4H49 A;  1HOV A;  1SLM A;  1CXV A;  1IAB A;  3ZVS A;  3WV3 A;  4GQL A;  1YQY A;  5D2B A;  1XUC A;  4H3X A;  4FXY P;  3KMC A;  1OS9 A;  1YP1 A;  3HYG A;  3EDH A;  1DTH A;  1IAD A;  2W15 A;  3KRY A;  1YCM A;  4FU4 A;  1ZTQ A;  5I0L A;  2E2D A;  1R54 A;  4ILW D;  1QIC A;  966C A;  3KHI A;  1SAT A;  3AIG A;  3MA2 A;  1Z3J A;  3HDA P;  1K7G A;  1Q3A A;  3F16 A;  4Q1L A;  1CQR A;  1Y0V A;  1SMP A;  3LE9 A;  3LGP A;  1JAQ A;  1C7K A;  4JIJ A;  2OW9 A;  3LIL A;  3Q2H A;  3LIR A;  1CGL A;  1XAX A;  5B5O A;  2OW1 A;  1XUR A;  2O36 A;  1PWQ A;  2J83 A;  4CTH A;  1OMJ A;  1RMZ A;  1SU3 A;  3N2U A;  3DPE A;  3LJG A;  1BKC E;  1BQO A;  1PWP A;  4GR3 A;  4EFS A;  1GE6 A;  3B92 A;  1SRP A;  1ATL A;  1JAN A;  1D5J A;  5BOT A;  1A85 A;  2RJQ A;  1S4B P;  2V4B A;  3KEC A;  1XFY A;  1AST A;  2YB9 A;  3LUN A;  4WK7 A;  3F1A A;  4H82 A;  4WZV A;  1FLS A;  1XFX A;  1H71 P;  1JK3 A;  4WKE A;  5D1T A;  4XBH A;  2OXZ A;  1KBC A;  2DDF A;  5I4O A;  2OW0 A;  4G0D A;  3LUM A;  5D1U A;  3HY9 A;  4PKT A;  2W14 A;  3TT4 A;  2OXW A;  4DV8 A;  4PKR A;  1ZS0 A;  2XS4 A;  2ERP A;  5I2Z A;  2CLT A;  3SHI A;  1TVI A;  2OW2 A;  1GKD A;  1PWV A;  4L6T A;  2FV9 A;  1UTT A;  830C A;  1GE5 A;  3DPF A;  2O3E A;  1AKL A;  4ON1 A;  1XFW A;  1SLN A;  3OHO A;  1UMT A;  1OM6 A;  1JKY A;  5CXA A;  3EWJ A;  1XFU A;  4GUY A;  4XM8 A;  3F15 A;  1UMS A;  1R55 A;  1IAA A;  1IAC A;  1GE7 A;  3EHY A;  2DDY A;  1J7N A;  5L7F A;  5I12 A;  3DTK A;  4H76 A;  1HFC A;  1HV5 A;  1ROS A;  3EDI A;  2HU6 A;  4IUW A;  3KEK A;  3O2X A;  5CUH A;  4ZR5 A;  1BKC I;  1CAQ A;  3LK8 A;  1D8M A;  5I3M A;  3CKI A;  1CK7 A;  1QIA A;  2Y6D A;  3B2Z A;  1A86 A;  1PWU A;  1RM8 A;  2AYK A;  1OM8 A;  2DW1 A;  1ND1 A;  5D1S A;  1MMQ A;  1G05 A;  1USN A;  1I1I P;  1C3I A;  3HB2 P;  1JJ9 A;  4JA1 A;  4WKI A;  3E8R A;  3V96 B;  1L6J A;  3F17 A;  3G5C A;  2JT6 A;  1KUI A;  1Y93 A;  3K7L A;  1MMP A;  2KRJ A;  1BQQ M;  2MLS A;  1IAE A;  1OO9 A;  3DNG A;  4GF1 A;  3L0T A;  2OY2 A;  1ZVX A;  3HY7 A;  3LQB A;  4PKV A;  3LEA A;  1QIB A;  4R3V A;  2JSD A;  1G12 A;  1K7Q A;  2MZH A;  2X3C A;  4H1Q A;  1PWW A;  2D1O A;  456C A;  1UTZ A;  4DF9 A;  1KUH A;  1G4K A;  4AIG A;  2XS3 A;  3NX7 A;  5L79 A;  3KEJ A;  3RTS A;  2W12 A;  4XCT A;  2OI0 A;  4L7A A;  2JIH A;  3AYU A;  3DTE A;  5B5P A;  3I7I A;  1ZXC A;  2K2G A;  1JAP A;  1QJI A;  3VI1 A;  2SRT A;  3KME A;  3TVC A;  4H84 A;  3EDG A;  4H30 A;  1FM1 A;  1O0Q A;  4AXQ A;  3OHL A;  2I47 A;  5LAB A;  4L19 A;  1OZ9 A;  1BSW A;  5CZM A;  1YOU A;  2JT5 A;  1GKC A;  5D3C A;  1BZS A;  1KUF A;  2OVX A;  1CGE A;  2D1N A;  3DSL A;  3I7G A;  1MMR A;  2AIG P;  3HBU P;  1UEA A;  2W13 A;  2RJP A;  2OVZ A;  2W0D A;  1G9K A;  1I73 A;  1OM7 A;  3Q2G A;  1R1H A;  1HTD A;  1KUG A;  4JPA A;  4QKZ A;  4PKQ A;  3F19 A;  1OS2 A;  1WNI A;  1AYK A;  1BIW A;  3LIK A;  1EB6 A;  1O0T A;  3WV2 A;  3DTI A;  4PKS A;  3LKA A;  3LJZ A;  1BUV M;  1R1J A;  4L63 A;  1AF0 A;  1CGF A;  3G42 A;  1QJJ A;  4A7B A;  2DW0 A;  3P24 A;  1I76 A;  1MNC A;  3KWV C;  4IJO A;  1K7I A;  4AYK A;  1GXD A;  1MMB A;  3ZUK A;  4GR8 A;  4FVL A;  1XM5 A;  3LQ0 A;  1B3D A;  2J0T A;  2JNP A;  1FBL A;  1KAP P;  4GWN A;  1ZP5 A;  5BOY A;  2OY4 A;  3LMC A;  2X7M A;  1G49 A;  3DL1 A;  3O64 A;  2MLR A;  3N2V A;  4PKW A;  5H8X A;  1QUA A;  3DWB A;  1CIZ A;  3TSK A;  4FXQ A;  2WO8 A;  4HX3 A;  1R1I A;  1XFZ A;  2K9C A;  3AYK A;  1EUB A;  1JIW P;  1B8Y A;  2USN A;  4JQG A;  2X3A A;  2WO9 A;  2L0R A;  4DD8 A;  2A8H A;  1KUK A;  1GO7 P;  3ELM A;  4JP4 A;  3B8Z A;  3RTT A;  3U1R A;  3ZXH A;  4I03 A;  2WOA A;  2CKI A;  1ZXV A;  3EDZ A;  1HY7 A;  2OXU A;  2OZR A;  4DPE A;  3EHX A;  1HFS A;  2Z2D A;  1BM6 A;  4GWM A;  2YIG A;  2DW2 A;  2POJ A;  2X3B A;  3WV1 A;  5I43 A;  3HDB A;  5JMY A;  2ERO A;  3L0V A;  4GR0 A; 
#chains in the Genus database with same CATH homology
 2FV5 A;  1JH1 A;  1XFV A;  4AUO A;  1DMT A;  2E3X A;  1GO8 P;  4XM6 A;  3BA0 A;  2Y6C A;  5BPA A;  4HMA A;  5D7W A;  3GBO A;  2YUF A;  1C8T A;  1D8F A;  4PKU A;  4XM7 A;  3TS4 A;  4WF6 A;  3P1V A;  1BKC A;  1JAO A;  1Y8J A;  2QPJ A;  3UVC A;  1XUD A;  1EAK A;  4H2E A;  1D7X A;  3USN A;  2PJT A;  3F18 A;  4IN9 A;  3HBV P;  4J4M A;  1BUD A;  1JIZ A;  1IAG A;  3K7N A;  2MZI A;  3VTG A;  3LJT A;  4G9L A;  2N8R A;  4A3W A;  2ERQ A;  4I35 A;  2TCL A;  2MZE A;  4H49 A;  1HOV A;  1SLM A;  1CXV A;  1IAB A;  3ZVS A;  3WV3 A;  4GQL A;  1YQY A;  5D2B A;  1XUC A;  4H3X A;  4FXY P;  3KMC A;  1OS9 A;  1YP1 A;  3HYG A;  3EDH A;  1DTH A;  1IAD A;  2W15 A;  3KRY A;  1YCM A;  4FU4 A;  1ZTQ A;  5I0L A;  2E2D A;  1R54 A;  4ILW D;  1QIC A;  966C A;  3KHI A;  1SAT A;  3AIG A;  3MA2 A;  1Z3J A;  3HDA P;  1K7G A;  1Q3A A;  3F16 A;  4Q1L A;  1CQR A;  1Y0V A;  1SMP A;  3LE9 A;  3LGP A;  1JAQ A;  1C7K A;  4JIJ A;  2OW9 A;  3LIL A;  3Q2H A;  3LIR A;  1CGL A;  5B5O A;  2OW1 A;  1XUR A;  2O36 A;  1PWQ A;  2J83 A;  4CTH A;  1OMJ A;  1RMZ A;  1SU3 A;  3N2U A;  3DPE A;  3LJG A;  1BKC E;  1BQO A;  1PWP A;  4GR3 A;  4EFS A;  1GE6 A;  3B92 A;  1SRP A;  1ATL A;  1JAN A;  1D5J A;  5BOT A;  1A85 A;  2RJQ A;  1S4B P;  2V4B A;  3KEC A;  1XFY A;  1AST A;  2YB9 A;  3LUN A;  4WK7 A;  3F1A A;  4H82 A;  4WZV A;  1FLS A;  1XFX A;  1H71 P;  1JK3 A;  4WKE A;  5D1T A;  4XBH A;  2OXZ A;  1KBC A;  2DDF A;  5I4O A;  2OW0 A;  4G0D A;  3LUM A;  5D1U A;  3HY9 A;  4PKT A;  2W14 A;  3TT4 A;  2OXW A;  4DV8 A;  4PKR A;  1ZS0 A;  2XS4 A;  2ERP A;  5I2Z A;  2CLT A;  3SHI A;  2OW2 A;  1GKD A;  1PWV A;  4L6T A;  2FV9 A;  1UTT A;  830C A;  1GE5 A;  3DPF A;  2O3E A;  1AKL A;  4ON1 A;  1XFW A;  1SLN A;  3OHO A;  1UMT A;  1OM6 A;  1JKY A;  5CXA A;  3EWJ A;  1XFU A;  4GUY A;  4XM8 A;  3F15 A;  1UMS A;  1R55 A;  1IAA A;  1IAC A;  1GE7 A;  3EHY A;  2DDY A;  1J7N A;  5L7F A;  5I12 A;  3DTK A;  4H76 A;  1HFC A;  1HV5 A;  1ROS A;  3EDI A;  2HU6 A;  4IUW A;  3KEK A;  3O2X A;  5CUH A;  4ZR5 A;  1BKC I;  1CAQ A;  3LK8 A;  1D8M A;  5I3M A;  3CKI A;  1CK7 A;  1QIA A;  2Y6D A;  3B2Z A;  1A86 A;  1PWU A;  1RM8 A;  2AYK A;  1OM8 A;  2DW1 A;  1ND1 A;  5D1S A;  1MMQ A;  1G05 A;  1USN A;  1I1I P;  1C3I A;  3HB2 P;  1JJ9 A;  4JA1 A;  4WKI A;  3E8R A;  3V96 B;  1L6J A;  3F17 A;  3G5C A;  2JT6 A;  1KUI A;  1Y93 A;  3K7L A;  1MMP A;  2KRJ A;  1BQQ M;  2MLS A;  1IAE A;  1OO9 A;  3DNG A;  4GF1 A;  3L0T A;  2OY2 A;  1ZVX A;  3HY7 A;  3LQB A;  4PKV A;  3LEA A;  1QIB A;  4R3V A;  2JSD A;  1G12 A;  1K7Q A;  2MZH A;  2X3C A;  4H1Q A;  1PWW A;  2D1O A;  456C A;  1UTZ A;  4DF9 A;  1KUH A;  1G4K A;  4AIG A;  2XS3 A;  3NX7 A;  5L79 A;  3KEJ A;  3RTS A;  2W12 A;  4XCT A;  2OI0 A;  4L7A A;  2JIH A;  3AYU A;  3DTE A;  5B5P A;  3I7I A;  1ZXC A;  2K2G A;  1JAP A;  1QJI A;  3VI1 A;  2SRT A;  3KME A;  3TVC A;  4H84 A;  3EDG A;  4H30 A;  1FM1 A;  1O0Q A;  4AXQ A;  3OHL A;  2I47 A;  5LAB A;  4L19 A;  1BSW A;  5CZM A;  1YOU A;  2JT5 A;  1GKC A;  5D3C A;  1BZS A;  1KUF A;  2OVX A;  1CGE A;  2D1N A;  3DSL A;  3I7G A;  1MMR A;  2AIG P;  3HBU P;  1UEA A;  2W13 A;  2RJP A;  2OVZ A;  2W0D A;  1G9K A;  1I73 A;  1OM7 A;  3Q2G A;  1R1H A;  1HTD A;  1KUG A;  4JPA A;  4QKZ A;  4PKQ A;  3F19 A;  1OS2 A;  1WNI A;  1AYK A;  1BIW A;  3LIK A;  1EB6 A;  1O0T A;  3WV2 A;  3DTI A;  4PKS A;  3LKA A;  3LJZ A;  1BUV M;  1R1J A;  4L63 A;  1AF0 A;  1CGF A;  3G42 A;  1QJJ A;  4A7B A;  2DW0 A;  3P24 A;  1I76 A;  1MNC A;  3KWV C;  4IJO A;  1K7I A;  4AYK A;  1GXD A;  1MMB A;  3ZUK A;  4GR8 A;  4FVL A;  3LQ0 A;  1B3D A;  2J0T A;  2JNP A;  1FBL A;  1KAP P;  4GWN A;  1ZP5 A;  5BOY A;  2OY4 A;  3LMC A;  2X7M A;  1G49 A;  3DL1 A;  3O64 A;  2MLR A;  3N2V A;  4PKW A;  5H8X A;  1QUA A;  3DWB A;  1CIZ A;  3TSK A;  4FXQ A;  2WO8 A;  4HX3 A;  1R1I A;  1XFZ A;  2K9C A;  3AYK A;  1EUB A;  1JIW P;  1B8Y A;  2USN A;  4JQG A;  2X3A A;  2WO9 A;  2L0R A;  4DD8 A;  2A8H A;  1KUK A;  1GO7 P;  3ELM A;  4JP4 A;  3B8Z A;  3RTT A;  3U1R A;  3ZXH A;  4I03 A;  2WOA A;  2CKI A;  1ZXV A;  3EDZ A;  1HY7 A;  2OXU A;  2OZR A;  4DPE A;  3EHX A;  1HFS A;  2Z2D A;  1BM6 A;  4GWM A;  2YIG A;  2DW2 A;  2POJ A;  2X3B A;  3WV1 A;  5I43 A;  3HDB A;  5JMY A;  2ERO A;  3L0V A;  4GR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...