1JANA

Complex of pro-leu-gly-hydroxylamine with the catalytic domain of matrix metallo proteinase-8 (phe79 form)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
164
structure length
164
Chain Sequence
FMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords MATRIX METALLO PROTEINASE-8 (PHE79 FORM)
publication title Structural implications for the role of the N terminus in the 'superactivation' of collagenases. A crystallographic study.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 164
sequence length 164
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1996-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1janA00
3HB2P 4J4MA 1ZXVA 3RTTA 1XFUA 4H76A 1QUAA 2X3BA 1GE7A 4JIJA 1SLMA 2OW0A 1XFWA 2CKIA 1MMRA 1OO9A 3HBVP 4CTHA 2MZEA 4WF6A 2JNPA 1HOVA 2HU6A 2E2DA 2ERPA 4L63A 2OW9A 3LEAA 1BM6A 2V4BA 2JT5A 1O0TA 3WV1A 3KMEA 966CA 4G0DA 1BKCI 1JJ9A 3LJZA 4WKIA 2TCLA 1JH1A 3DPEA 3U1RA 1R1JA 2MLSA 4WZVA 2X7MA 2XS4A 1JIWP 1JIZA 1BQOA 2DW0A 1BUVM 1Y93A 3V96B 2J83A 3K7LA 1QJJA 4DF9A 1Y8JA 1KUKA 1SLNA 3ZVSA 1G05A 1C3IA 1Z3JA 1ZTQA 1J7NA 2D1NA 2JSDA 1GO8P 1RM8A 4JQGA 1GO7P 1BKCA 3DPFA 2K9CA 3F17A 2W15A 4PKQA 1PWWA 4JP4A 4G9LA 1R1HA 4H82A 1Q3AA 3LK8A 3LKAA 2OVXA 2D1OA 3DL1A 3EDIA 1DMTA 4I03A 1DTHA 4FXYP 1D5JA 3B8ZA 4ON1A 2POJA 3HDBA 3ELMA 1YQYA 3G5CA 3HBUP 2N8RA 4H30A 2MLRA 2OXUA 1O0QA 1I1IP 3EDHA 3B2ZA 4DV8A 1UMTA 4I35A 3LIKA 1BIWA 3EHYA 4GR3A 456CA 1HTDA 3LJGA 1UEAA 1PWVA 4JA1A 5D2BA 4PKWA 4XM6A 4A7BA 2CLTA 1GKDA 1ROSA 3I7GA 4AYKA 3KRYA 1CQRA 1H71P 3KMCA 1KBCA 3KEJA 4FXQA 4AIGA 1I76A 3L0TA 1KUHA 1C8TA 3LUMA 3LQ0A 4PKVA 3OHLA 3LUNA 1BZSA 1OM7A 5BOTA 1CGFA 3USNA 1PWQA 3AYKA 2RJPA 4R3VA 5L79A 5B5OA 1EUBA 2X3CA 1QICA 4GF1A 1ZS0A 2OXWA 3TT4A 1G12A 1FLSA 3DNGA 3EHXA 2W13A 4L6TA 1ASTA 1EAKA 1CIZA 3LIRA 1AYKA 1CGEA 4GR8A 1OS9A 4XM7A 1G9KA 2RJQA 2DW1A 1HFCA 1CXVA 5D1TA 4EFSA 3F1AA 5CZMA 3GBOA 3KWVC 4WK7A 2ERQA 1WNIA 4XM8A 1K7QA 3F18A 4PKUA 2DDFA 3ZXHA 3F19A 5D3CA 1IABA 1BSWA 2YB9A 3WV3A 1GXDA 5D1UA 4PKTA 3LMCA 1OS2A 3LJTA 1YP1A 2KRJA 4GWMA 830CA 1PWPA 1UTZA 1AKLA 1A86A 4PKRA 4HX3A 1XUDA 4H49A 2O3EA 2QPJA 2L0RA 2I47A 1C7KA 4IJOA 1B3DA 1XFVA 2FV9A 4IUWA 4GUYA 1B8YA 3F15A 3CKIA 3EWJA 1OM6A 1JANA 4H1QA 4GR0A 1YCMA 2JT6A 1FBLA 3K7NA 3Q2GA 1G49A 1BQQM 1A85A 3EDZA 3AIGA 1IADA 2Y6CA 4HMAA 2AYKA 1SU3A 2W12A 1IAEA 1XFXA 4QKZA 1L6JA 3HY9A 1ZXCA 1BKCE 2OY4A 2PJTA 4GQLA 4ZR5A 1ATLA 1JKYA 3L0VA 5H8XA 1QIBA 1SMPA 1I73A 1OM8A 2Z2DA 1QJIA 1JAOA 5BOYA 1R1IA 3KECA 5L7FA 3SHIA 1G4KA 4FU4A 1BUDA 3N2UA 5D7WA 2OI0A 4H3XA 3NX7A 1KUGA 2WOAA 2W14A 3P1VA 3HYGA 1D8MA 1SRPA 3B92A 1JK3A 3KHIA 2J0TA 3LQBA 1XURA 1FM1A 4DD8A 1XUCA 1JAPA 3RTSA 1IACA 2OZRA 4XCTA 3DSLA 3BA0A 2OW2A 3P24A 1IAAA 1MMPA 1CAQA 1KAPP 2USNA 4DPEA 3LGPA 4A3WA 2DDYA 3VTGA 2XS3A 3O2XA 1Y0VA 5CXAA 4H84A 1UMSA 2OW1A 1JAQA 1GE5A 2K2GA 2E3XA 2MZIA 2OXZA 2O36A 2X3AA 5I3MA 5I2ZA 5I4OA 1IAGA 4AUOA 1D7XA 1PWUA 3G42A 1UTTA 1OMJA 3DWBA 1EB6A 5I12A 2W0DA 2OVZA 1RMZA 4L19A 1MNCA 3ZUKA 4Q1LA 1ZP5A 1ZVXA 2AIGP 1GKCA 1USNA 1ND1A 5CUHA 3VI1A 4H2EA 3TS4A 1XFZA 3WV2A 3LILA 3TSKA 5D1SA 2OY2A 2A8HA 4FVLA 5JMYA 2WO8A 3UVCA 1AF0A 3HY7A 1SATA 3KEKA 3E8RA 3EDGA 3I7IA 1CGLA 5I43A 5BPAA 1GE6A 3AYUA 1R54A 4IN9A 1CK7A 5I0LA 3TVCA 1HFSA 2FV5A 4WKEA 1HY7A 3LE9A 2JIHA 3N2VA 4JPAA 4XBHA 5LABA 1MMBA 2YIGA 1YOUA 1D8FA 4ILWD 5B5PA 2DW2A 3O64A 1MMQA 1KUFA 1K7IA 3MA2A 2Y6DA 4AXQA 3Q2HA 1QIAA 3HDAP 2EROA 2SRTA 2WO9A 4PKSA 1S4BP 1HV5A 4GWNA 3OHOA 1K7GA 2MZHA 1KUIA 3F16A 1R55A 1XFYA
chains in the Genus database with same CATH superfamily
3HB2P 4J4MA 1ZXVA 3RTTA 1XFUA 4H76A 1QUAA 2X3BA 1GE7A 4JIJA 1SLMA 2OW0A 1XFWA 2CKIA 1MMRA 1OO9A 3HBVP 4CTHA 2MZEA 4WF6A 2JNPA 1HOVA 2HU6A 2E2DA 2ERPA 4L63A 2OW9A 3LEAA 1BM6A 2V4BA 2JT5A 1O0TA 3WV1A 3KMEA 966CA 4G0DA 1BKCI 1JJ9A 3LJZA 3DTIA 4WKIA 2TCLA 1JH1A 3DPEA 3U1RA 1R1JA 2MLSA 4WZVA 2X7MA 2XS4A 1JIWP 1JIZA 1BQOA 2DW0A 1BUVM 1Y93A 3V96B 2J83A 3K7LA 1QJJA 4DF9A 1Y8JA 1KUKA 1SLNA 3ZVSA 1G05A 1C3IA 1Z3JA 1ZTQA 1J7NA 2D1NA 2JSDA 1GO8P 1RM8A 4JQGA 1GO7P 1BKCA 1TVIA 3DPFA 2K9CA 3F17A 2W15A 4PKQA 1PWWA 4JP4A 4G9LA 1R1HA 4H82A 1Q3AA 3LK8A 3LKAA 2OVXA 2D1OA 3DL1A 3EDIA 1DMTA 4I03A 1DTHA 4FXYP 1D5JA 3B8ZA 4ON1A 2POJA 3HDBA 3ELMA 1YQYA 3G5CA 3HBUP 2N8RA 4H30A 2MLRA 2OXUA 1O0QA 1I1IP 3EDHA 3B2ZA 4DV8A 1UMTA 4I35A 3LIKA 1BIWA 3EHYA 4GR3A 456CA 1HTDA 3LJGA 1UEAA 1PWVA 4JA1A 5D2BA 4PKWA 4XM6A 4A7BA 2CLTA 1GKDA 1ROSA 3I7GA 4AYKA 3KRYA 1CQRA 1H71P 3KMCA 1KBCA 3KEJA 4FXQA 4AIGA 1I76A 3L0TA 1KUHA 1C8TA 3LUMA 3LQ0A 4PKVA 3OHLA 3LUNA 1BZSA 1OM7A 5BOTA 1CGFA 3USNA 1PWQA 3AYKA 2RJPA 4R3VA 5L79A 5B5OA 1EUBA 2X3CA 1QICA 4GF1A 1ZS0A 2OXWA 3TT4A 1G12A 1FLSA 3DNGA 3EHXA 2W13A 4L6TA 1ASTA 1EAKA 1CIZA 3LIRA 1AYKA 1CGEA 3DTEA 4GR8A 1OS9A 4XM7A 1G9KA 2RJQA 2DW1A 1HFCA 1CXVA 5D1TA 4EFSA 3F1AA 5CZMA 3GBOA 3KWVC 4WK7A 2ERQA 1WNIA 4XM8A 1K7QA 3F18A 4PKUA 2DDFA 3ZXHA 3F19A 5D3CA 1IABA 1BSWA 2YB9A 3WV3A 1GXDA 5D1UA 4PKTA 3LMCA 1OS2A 3LJTA 1YP1A 2KRJA 4GWMA 830CA 1PWPA 1UTZA 1AKLA 1A86A 4PKRA 4HX3A 1XUDA 4H49A 2O3EA 2QPJA 2L0RA 2I47A 1C7KA 4IJOA 1B3DA 1XFVA 2FV9A 4IUWA 4GUYA 1B8YA 3F15A 3CKIA 3EWJA 1OM6A 1JANA 4H1QA 4GR0A 1YCMA 2JT6A 1FBLA 3K7NA 3Q2GA 1G49A 1BQQM 1A85A 3EDZA 3AIGA 1IADA 2Y6CA 4HMAA 2AYKA 1SU3A 2W12A 1IAEA 1XFXA 4QKZA 1L6JA 3HY9A 1ZXCA 1BKCE 2OY4A 2PJTA 4GQLA 4ZR5A 1ATLA 1JKYA 3L0VA 5H8XA 1QIBA 1SMPA 1I73A 1OM8A 2Z2DA 1QJIA 1JAOA 5BOYA 1R1IA 3KECA 5L7FA 3SHIA 1G4KA 4FU4A 1BUDA 3N2UA 5D7WA 2OI0A 4H3XA 3NX7A 1KUGA 2WOAA 2W14A 3P1VA 3HYGA 1D8MA 1SRPA 3B92A 1JK3A 3KHIA 2J0TA 3LQBA 1XURA 1FM1A 4DD8A 1XUCA 1JAPA 3RTSA 1XM5A 1IACA 2OZRA 4XCTA 4L7AA 3DSLA 3BA0A 2OW2A 3P24A 1IAAA 1MMPA 1CAQA 1KAPP 2USNA 4DPEA 3LGPA 4A3WA 2DDYA 3VTGA 2XS3A 3O2XA 1Y0VA 5CXAA 4H84A 1UMSA 2OW1A 1JAQA 1GE5A 2K2GA 2E3XA 2MZIA 2OXZA 2O36A 2X3AA 5I3MA 5I2ZA 5I4OA 1IAGA 4AUOA 1D7XA 1PWUA 3G42A 1UTTA 1OMJA 3DWBA 1EB6A 5I12A 2W0DA 2OVZA 1RMZA 4L19A 1MNCA 3ZUKA 4Q1LA 1ZP5A 1ZVXA 2AIGP 2YUFA 1GKCA 1USNA 1ND1A 5CUHA 3VI1A 4H2EA 1OZ9A 3TS4A 1XFZA 3WV2A 3LILA 3TSKA 5D1SA 2OY2A 2A8HA 4FVLA 5JMYA 2WO8A 3UVCA 1AF0A 3HY7A 1SATA 3KEKA 3E8RA 3EDGA 3I7IA 1CGLA 5I43A 5BPAA 1GE6A 3AYUA 3DTKA 1XAXA 1R54A 4IN9A 1CK7A 5I0LA 3TVCA 1HFSA 2FV5A 4WKEA 1HY7A 3LE9A 2JIHA 3N2VA 4JPAA 4XBHA 5LABA 1MMBA 2YIGA 1YOUA 1D8FA 4ILWD 5B5PA 2DW2A 3O64A 1MMQA 1KUFA 1K7IA 3MA2A 2Y6DA 4AXQA 3Q2HA 1QIAA 3HDAP 2EROA 2SRTA 2WO9A 4PKSA 1S4BP 1HV5A 4GWNA 3OHOA 1K7GA 2MZHA 1KUIA 3F16A 1R55A 1XFYA
chains in the Genus database with same CATH topology
3HB2P 4J4MA 1ZXVA 3RTTA 1XFUA 4H76A 1QUAA 2X3BA 1GE7A 4JIJA 1SLMA 2OW0A 1XFWA 2CKIA 1MMRA 1OO9A 3HBVP 4CTHA 2MZEA 4WF6A 2JNPA 1HOVA 2HU6A 2E2DA 2ERPA 4L63A 2OW9A 3LEAA 1BM6A 2V4BA 2JT5A 1O0TA 3WV1A 3KMEA 966CA 4G0DA 1BKCI 1JJ9A 3LJZA 3DTIA 4WKIA 2TCLA 1JH1A 3DPEA 3U1RA 1R1JA 2MLSA 4WZVA 2X7MA 2XS4A 1JIWP 1JIZA 1BQOA 2DW0A 1BUVM 1Y93A 3V96B 2J83A 3K7LA 1QJJA 4DF9A 1Y8JA 1KUKA 1SLNA 3ZVSA 1G05A 1C3IA 1Z3JA 1ZTQA 1J7NA 2D1NA 2JSDA 1GO8P 1RM8A 4JQGA 1GO7P 1BKCA 3DPFA 2K9CA 3F17A 2W15A 4PKQA 1PWWA 4JP4A 4G9LA 1R1HA 4H82A 1Q3AA 3LK8A 3LKAA 2OVXA 2D1OA 3DL1A 3EDIA 1DMTA 4I03A 1DTHA 4FXYP 1D5JA 3B8ZA 4ON1A 2POJA 3HDBA 3ELMA 1YQYA 3G5CA 3HBUP 2N8RA 4H30A 2MLRA 2OXUA 1O0QA 1I1IP 3EDHA 3B2ZA 4DV8A 1UMTA 4I35A 3LIKA 1BIWA 3EHYA 4GR3A 456CA 1HTDA 3LJGA 1UEAA 1PWVA 4JA1A 5D2BA 4PKWA 4XM6A 4A7BA 2CLTA 1GKDA 1ROSA 3I7GA 4AYKA 3KRYA 1CQRA 1H71P 3KMCA 1KBCA 3KEJA 4FXQA 4AIGA 1I76A 3L0TA 1KUHA 1C8TA 3LUMA 3LQ0A 4PKVA 3OHLA 3LUNA 1BZSA 1OM7A 5BOTA 1CGFA 3USNA 1PWQA 3AYKA 2RJPA 4R3VA 5L79A 5B5OA 1EUBA 2X3CA 1QICA 4GF1A 1ZS0A 2OXWA 3TT4A 1G12A 1FLSA 3DNGA 3EHXA 2W13A 4L6TA 1ASTA 1EAKA 1CIZA 3LIRA 1AYKA 1CGEA 3DTEA 4GR8A 1OS9A 4XM7A 1G9KA 2RJQA 2DW1A 1HFCA 1CXVA 5D1TA 4EFSA 3F1AA 5CZMA 3GBOA 3KWVC 4WK7A 2ERQA 1WNIA 4XM8A 1K7QA 3F18A 4PKUA 2DDFA 3ZXHA 3F19A 5D3CA 1IABA 1BSWA 2YB9A 3WV3A 1GXDA 5D1UA 4PKTA 3LMCA 1OS2A 3LJTA 1YP1A 2KRJA 4GWMA 830CA 1PWPA 1UTZA 1AKLA 1A86A 4PKRA 4HX3A 1XUDA 4H49A 2O3EA 2QPJA 2L0RA 2I47A 1C7KA 4IJOA 1B3DA 1XFVA 2FV9A 4IUWA 4GUYA 1B8YA 3F15A 3CKIA 3EWJA 1OM6A 1JANA 4H1QA 4GR0A 1YCMA 2JT6A 1FBLA 3K7NA 3Q2GA 1G49A 1BQQM 1A85A 3EDZA 3AIGA 1IADA 2Y6CA 4HMAA 2AYKA 1SU3A 2W12A 1IAEA 1XFXA 4QKZA 1L6JA 3HY9A 1ZXCA 1BKCE 2OY4A 2PJTA 4GQLA 4ZR5A 1ATLA 1JKYA 3L0VA 5H8XA 1QIBA 1SMPA 1I73A 1OM8A 2Z2DA 1QJIA 1JAOA 5BOYA 1R1IA 3KECA 5L7FA 3SHIA 1G4KA 4FU4A 1BUDA 3N2UA 5D7WA 2OI0A 4H3XA 3NX7A 1KUGA 2WOAA 2W14A 3P1VA 3HYGA 1D8MA 1SRPA 3B92A 1JK3A 3KHIA 2J0TA 3LQBA 1XURA 1FM1A 4DD8A 1XUCA 1JAPA 3RTSA 1IACA 2OZRA 4XCTA 4L7AA 3DSLA 3BA0A 2OW2A 3P24A 1IAAA 1MMPA 1CAQA 1KAPP 2USNA 4DPEA 3LGPA 4A3WA 2DDYA 3VTGA 2XS3A 3O2XA 1Y0VA 5CXAA 4H84A 1UMSA 2OW1A 1JAQA 1GE5A 2K2GA 2E3XA 2MZIA 2OXZA 2O36A 2X3AA 5I3MA 5I2ZA 5I4OA 1IAGA 4AUOA 1D7XA 1PWUA 3G42A 1UTTA 1OMJA 3DWBA 1EB6A 5I12A 2W0DA 2OVZA 1RMZA 4L19A 1MNCA 3ZUKA 4Q1LA 1ZP5A 1ZVXA 2AIGP 2YUFA 1GKCA 1USNA 1ND1A 5CUHA 3VI1A 4H2EA 3TS4A 1XFZA 3WV2A 3LILA 3TSKA 5D1SA 2OY2A 2A8HA 4FVLA 5JMYA 2WO8A 3UVCA 1AF0A 3HY7A 1SATA 3KEKA 3E8RA 3EDGA 3I7IA 1CGLA 5I43A 5BPAA 1GE6A 3AYUA 3DTKA 1R54A 4IN9A 1CK7A 5I0LA 3TVCA 1HFSA 2FV5A 4WKEA 1HY7A 3LE9A 2JIHA 3N2VA 4JPAA 4XBHA 5LABA 1MMBA 2YIGA 1YOUA 1D8FA 4ILWD 5B5PA 2DW2A 3O64A 1MMQA 1KUFA 1K7IA 3MA2A 2Y6DA 4AXQA 3Q2HA 1QIAA 3HDAP 2EROA 2SRTA 2WO9A 4PKSA 1S4BP 1HV5A 4GWNA 3OHOA 1K7GA 2MZHA 1KUIA 3F16A 1R55A 1XFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HB2 P;  4J4M A;  1ZXV A;  3RTT A;  1XFU A;  4H76 A;  1QUA A;  2X3B A;  1GE7 A;  4JIJ A;  1SLM A;  2OW0 A;  1XFW A;  2CKI A;  1MMR A;  1OO9 A;  3HBV P;  4CTH A;  2MZE A;  4WF6 A;  2JNP A;  1HOV A;  2HU6 A;  2E2D A;  2ERP A;  4L63 A;  2OW9 A;  3LEA A;  1BM6 A;  2V4B A;  2JT5 A;  1O0T A;  3WV1 A;  3KME A;  966C A;  4G0D A;  1BKC I;  1JJ9 A;  3LJZ A;  4WKI A;  2TCL A;  1JH1 A;  3DPE A;  3U1R A;  1R1J A;  2MLS A;  4WZV A;  2X7M A;  2XS4 A;  1JIW P;  1JIZ A;  1BQO A;  2DW0 A;  1BUV M;  1Y93 A;  3V96 B;  2J83 A;  3K7L A;  1QJJ A;  4DF9 A;  1Y8J A;  1KUK A;  1SLN A;  3ZVS A;  1G05 A;  1C3I A;  1Z3J A;  1ZTQ A;  1J7N A;  2D1N A;  2JSD A;  1GO8 P;  1RM8 A;  4JQG A;  1GO7 P;  1BKC A;  3DPF A;  2K9C A;  3F17 A;  2W15 A;  4PKQ A;  1PWW A;  4JP4 A;  4G9L A;  1R1H A;  4H82 A;  1Q3A A;  3LK8 A;  3LKA A;  2OVX A;  2D1O A;  3DL1 A;  3EDI A;  1DMT A;  4I03 A;  1DTH A;  4FXY P;  1D5J A;  3B8Z A;  4ON1 A;  2POJ A;  3HDB A;  3ELM A;  1YQY A;  3G5C A;  3HBU P;  2N8R A;  4H30 A;  2MLR A;  2OXU A;  1O0Q A;  1I1I P;  3EDH A;  3B2Z A;  4DV8 A;  1UMT A;  4I35 A;  3LIK A;  1BIW A;  3EHY A;  4GR3 A;  456C A;  1HTD A;  3LJG A;  1UEA A;  1PWV A;  4JA1 A;  5D2B A;  4PKW A;  4XM6 A;  4A7B A;  2CLT A;  1GKD A;  1ROS A;  3I7G A;  4AYK A;  3KRY A;  1CQR A;  1H71 P;  3KMC A;  1KBC A;  3KEJ A;  4FXQ A;  4AIG A;  1I76 A;  3L0T A;  1KUH A;  1C8T A;  3LUM A;  3LQ0 A;  4PKV A;  3OHL A;  3LUN A;  1BZS A;  1OM7 A;  5BOT A;  1CGF A;  3USN A;  1PWQ A;  3AYK A;  2RJP A;  4R3V A;  5L79 A;  5B5O A;  1EUB A;  2X3C A;  1QIC A;  4GF1 A;  1ZS0 A;  2OXW A;  3TT4 A;  1G12 A;  1FLS A;  3DNG A;  3EHX A;  2W13 A;  4L6T A;  1AST A;  1EAK A;  1CIZ A;  3LIR A;  1AYK A;  1CGE A;  4GR8 A;  1OS9 A;  4XM7 A;  1G9K A;  2RJQ A;  2DW1 A;  1HFC A;  1CXV A;  5D1T A;  4EFS A;  3F1A A;  5CZM A;  3GBO A;  3KWV C;  4WK7 A;  2ERQ A;  1WNI A;  4XM8 A;  1K7Q A;  3F18 A;  4PKU A;  2DDF A;  3ZXH A;  3F19 A;  5D3C A;  1IAB A;  1BSW A;  2YB9 A;  3WV3 A;  1GXD A;  5D1U A;  4PKT A;  3LMC A;  1OS2 A;  3LJT A;  1YP1 A;  2KRJ A;  4GWM A;  830C A;  1PWP A;  1UTZ A;  1AKL A;  1A86 A;  4PKR A;  4HX3 A;  1XUD A;  4H49 A;  2O3E A;  2QPJ A;  2L0R A;  2I47 A;  1C7K A;  4IJO A;  1B3D A;  1XFV A;  2FV9 A;  4IUW A;  4GUY A;  1B8Y A;  3F15 A;  3CKI A;  3EWJ A;  1OM6 A;  1JAN A;  4H1Q A;  4GR0 A;  1YCM A;  2JT6 A;  1FBL A;  3K7N A;  3Q2G A;  1G49 A;  1BQQ M;  1A85 A;  3EDZ A;  3AIG A;  1IAD A;  2Y6C A;  4HMA A;  2AYK A;  1SU3 A;  2W12 A;  1IAE A;  1XFX A;  4QKZ A;  1L6J A;  3HY9 A;  1ZXC A;  1BKC E;  2OY4 A;  2PJT A;  4GQL A;  4ZR5 A;  1ATL A;  1JKY A;  3L0V A;  5H8X A;  1QIB A;  1SMP A;  1I73 A;  1OM8 A;  2Z2D A;  1QJI A;  1JAO A;  5BOY A;  1R1I A;  3KEC A;  5L7F A;  3SHI A;  1G4K A;  4FU4 A;  1BUD A;  3N2U A;  5D7W A;  2OI0 A;  4H3X A;  3NX7 A;  1KUG A;  2WOA A;  2W14 A;  3P1V A;  3HYG A;  1D8M A;  1SRP A;  3B92 A;  1JK3 A;  3KHI A;  2J0T A;  3LQB A;  1XUR A;  1FM1 A;  4DD8 A;  1XUC A;  1JAP A;  3RTS A;  1IAC A;  2OZR A;  4XCT A;  3DSL A;  3BA0 A;  2OW2 A;  3P24 A;  1IAA A;  1MMP A;  1CAQ A;  1KAP P;  2USN A;  4DPE A;  3LGP A;  4A3W A;  2DDY A;  3VTG A;  2XS3 A;  3O2X A;  1Y0V A;  5CXA A;  4H84 A;  1UMS A;  2OW1 A;  1JAQ A;  1GE5 A;  2K2G A;  2E3X A;  2MZI A;  2OXZ A;  2O36 A;  2X3A A;  5I3M A;  5I2Z A;  5I4O A;  1IAG A;  4AUO A;  1D7X A;  1PWU A;  3G42 A;  1UTT A;  1OMJ A;  3DWB A;  1EB6 A;  5I12 A;  2W0D A;  2OVZ A;  1RMZ A;  4L19 A;  1MNC A;  3ZUK A;  4Q1L A;  1ZP5 A;  1ZVX A;  2AIG P;  1GKC A;  1USN A;  1ND1 A;  5CUH A;  3VI1 A;  4H2E A;  3TS4 A;  1XFZ A;  3WV2 A;  3LIL A;  3TSK A;  5D1S A;  2OY2 A;  2A8H A;  4FVL A;  5JMY A;  2WO8 A;  3UVC A;  1AF0 A;  3HY7 A;  1SAT A;  3KEK A;  3E8R A;  3EDG A;  3I7I A;  1CGL A;  5I43 A;  5BPA A;  1GE6 A;  3AYU A;  1R54 A;  4IN9 A;  1CK7 A;  5I0L A;  3TVC A;  1HFS A;  2FV5 A;  4WKE A;  1HY7 A;  3LE9 A;  2JIH A;  3N2V A;  4JPA A;  4XBH A;  5LAB A;  1MMB A;  2YIG A;  1YOU A;  1D8F A;  4ILW D;  5B5P A;  2DW2 A;  3O64 A;  1MMQ A;  1KUF A;  1K7I A;  3MA2 A;  2Y6D A;  4AXQ A;  3Q2H A;  1QIA A;  3HDA P;  2ERO A;  2SRT A;  2WO9 A;  4PKS A;  1S4B P;  1HV5 A;  4GWN A;  3OHO A;  1K7G A;  2MZH A;  1KUI A;  3F16 A;  1R55 A;  1XFY A; 
#chains in the Genus database with same CATH topology
 3HB2 P;  4J4M A;  1ZXV A;  3RTT A;  1XFU A;  4H76 A;  1QUA A;  2X3B A;  1GE7 A;  4JIJ A;  1SLM A;  2OW0 A;  1XFW A;  2CKI A;  1MMR A;  1OO9 A;  3HBV P;  4CTH A;  2MZE A;  4WF6 A;  2JNP A;  1HOV A;  2HU6 A;  2E2D A;  2ERP A;  4L63 A;  2OW9 A;  3LEA A;  1BM6 A;  2V4B A;  2JT5 A;  1O0T A;  3WV1 A;  3KME A;  966C A;  4G0D A;  1BKC I;  1JJ9 A;  3LJZ A;  3DTI A;  4WKI A;  2TCL A;  1JH1 A;  3DPE A;  3U1R A;  1R1J A;  2MLS A;  4WZV A;  2X7M A;  2XS4 A;  1JIW P;  1JIZ A;  1BQO A;  2DW0 A;  1BUV M;  1Y93 A;  3V96 B;  2J83 A;  3K7L A;  1QJJ A;  4DF9 A;  1Y8J A;  1KUK A;  1SLN A;  3ZVS A;  1G05 A;  1C3I A;  1Z3J A;  1ZTQ A;  1J7N A;  2D1N A;  2JSD A;  1GO8 P;  1RM8 A;  4JQG A;  1GO7 P;  1BKC A;  1TVI A;  3DPF A;  2K9C A;  3F17 A;  2W15 A;  4PKQ A;  1PWW A;  4JP4 A;  4G9L A;  1R1H A;  4H82 A;  1Q3A A;  3LK8 A;  3LKA A;  2OVX A;  2D1O A;  3DL1 A;  3EDI A;  1DMT A;  4I03 A;  1DTH A;  4FXY P;  1D5J A;  3B8Z A;  4ON1 A;  2POJ A;  3HDB A;  3ELM A;  1YQY A;  3G5C A;  3HBU P;  2N8R A;  4H30 A;  2MLR A;  2OXU A;  1O0Q A;  1I1I P;  3EDH A;  3B2Z A;  4DV8 A;  1UMT A;  4I35 A;  3LIK A;  1BIW A;  3EHY A;  4GR3 A;  456C A;  1HTD A;  3LJG A;  1UEA A;  1PWV A;  4JA1 A;  5D2B A;  4PKW A;  4XM6 A;  4A7B A;  2CLT A;  1GKD A;  1ROS A;  3I7G A;  4AYK A;  3KRY A;  1CQR A;  1H71 P;  3KMC A;  1KBC A;  3KEJ A;  4FXQ A;  4AIG A;  1I76 A;  3L0T A;  1KUH A;  1C8T A;  3LUM A;  3LQ0 A;  4PKV A;  3OHL A;  3LUN A;  1BZS A;  1OM7 A;  5BOT A;  1CGF A;  3USN A;  1PWQ A;  3AYK A;  2RJP A;  4R3V A;  5L79 A;  5B5O A;  1EUB A;  2X3C A;  1QIC A;  4GF1 A;  1ZS0 A;  2OXW A;  3TT4 A;  1G12 A;  1FLS A;  3DNG A;  3EHX A;  2W13 A;  4L6T A;  1AST A;  1EAK A;  1CIZ A;  3LIR A;  1AYK A;  1CGE A;  3DTE A;  4GR8 A;  1OS9 A;  4XM7 A;  1G9K A;  2RJQ A;  2DW1 A;  1HFC A;  1CXV A;  5D1T A;  4EFS A;  3F1A A;  5CZM A;  3GBO A;  3KWV C;  4WK7 A;  2ERQ A;  1WNI A;  4XM8 A;  1K7Q A;  3F18 A;  4PKU A;  2DDF A;  3ZXH A;  3F19 A;  5D3C A;  1IAB A;  1BSW A;  2YB9 A;  3WV3 A;  1GXD A;  5D1U A;  4PKT A;  3LMC A;  1OS2 A;  3LJT A;  1YP1 A;  2KRJ A;  4GWM A;  830C A;  1PWP A;  1UTZ A;  1AKL A;  1A86 A;  4PKR A;  4HX3 A;  1XUD A;  4H49 A;  2O3E A;  2QPJ A;  2L0R A;  2I47 A;  1C7K A;  4IJO A;  1B3D A;  1XFV A;  2FV9 A;  4IUW A;  4GUY A;  1B8Y A;  3F15 A;  3CKI A;  3EWJ A;  1OM6 A;  1JAN A;  4H1Q A;  4GR0 A;  1YCM A;  2JT6 A;  1FBL A;  3K7N A;  3Q2G A;  1G49 A;  1BQQ M;  1A85 A;  3EDZ A;  3AIG A;  1IAD A;  2Y6C A;  4HMA A;  2AYK A;  1SU3 A;  2W12 A;  1IAE A;  1XFX A;  4QKZ A;  1L6J A;  3HY9 A;  1ZXC A;  1BKC E;  2OY4 A;  2PJT A;  4GQL A;  4ZR5 A;  1ATL A;  1JKY A;  3L0V A;  5H8X A;  1QIB A;  1SMP A;  1I73 A;  1OM8 A;  2Z2D A;  1QJI A;  1JAO A;  5BOY A;  1R1I A;  3KEC A;  5L7F A;  3SHI A;  1G4K A;  4FU4 A;  1BUD A;  3N2U A;  5D7W A;  2OI0 A;  4H3X A;  3NX7 A;  1KUG A;  2WOA A;  2W14 A;  3P1V A;  3HYG A;  1D8M A;  1SRP A;  3B92 A;  1JK3 A;  3KHI A;  2J0T A;  3LQB A;  1XUR A;  1FM1 A;  4DD8 A;  1XUC A;  1JAP A;  3RTS A;  1XM5 A;  1IAC A;  2OZR A;  4XCT A;  4L7A A;  3DSL A;  3BA0 A;  2OW2 A;  3P24 A;  1IAA A;  1MMP A;  1CAQ A;  1KAP P;  2USN A;  4DPE A;  3LGP A;  4A3W A;  2DDY A;  3VTG A;  2XS3 A;  3O2X A;  1Y0V A;  5CXA A;  4H84 A;  1UMS A;  2OW1 A;  1JAQ A;  1GE5 A;  2K2G A;  2E3X A;  2MZI A;  2OXZ A;  2O36 A;  2X3A A;  5I3M A;  5I2Z A;  5I4O A;  1IAG A;  4AUO A;  1D7X A;  1PWU A;  3G42 A;  1UTT A;  1OMJ A;  3DWB A;  1EB6 A;  5I12 A;  2W0D A;  2OVZ A;  1RMZ A;  4L19 A;  1MNC A;  3ZUK A;  4Q1L A;  1ZP5 A;  1ZVX A;  2AIG P;  2YUF A;  1GKC A;  1USN A;  1ND1 A;  5CUH A;  3VI1 A;  4H2E A;  1OZ9 A;  3TS4 A;  1XFZ A;  3WV2 A;  3LIL A;  3TSK A;  5D1S A;  2OY2 A;  2A8H A;  4FVL A;  5JMY A;  2WO8 A;  3UVC A;  1AF0 A;  3HY7 A;  1SAT A;  3KEK A;  3E8R A;  3EDG A;  3I7I A;  1CGL A;  5I43 A;  5BPA A;  1GE6 A;  3AYU A;  3DTK A;  1XAX A;  1R54 A;  4IN9 A;  1CK7 A;  5I0L A;  3TVC A;  1HFS A;  2FV5 A;  4WKE A;  1HY7 A;  3LE9 A;  2JIH A;  3N2V A;  4JPA A;  4XBH A;  5LAB A;  1MMB A;  2YIG A;  1YOU A;  1D8F A;  4ILW D;  5B5P A;  2DW2 A;  3O64 A;  1MMQ A;  1KUF A;  1K7I A;  3MA2 A;  2Y6D A;  4AXQ A;  3Q2H A;  1QIA A;  3HDA P;  2ERO A;  2SRT A;  2WO9 A;  4PKS A;  1S4B P;  1HV5 A;  4GWN A;  3OHO A;  1K7G A;  2MZH A;  1KUI A;  3F16 A;  1R55 A;  1XFY A; 
#chains in the Genus database with same CATH homology
 3HB2 P;  4J4M A;  1ZXV A;  3RTT A;  1XFU A;  4H76 A;  1QUA A;  2X3B A;  1GE7 A;  4JIJ A;  1SLM A;  2OW0 A;  1XFW A;  2CKI A;  1MMR A;  1OO9 A;  3HBV P;  4CTH A;  2MZE A;  4WF6 A;  2JNP A;  1HOV A;  2HU6 A;  2E2D A;  2ERP A;  4L63 A;  2OW9 A;  3LEA A;  1BM6 A;  2V4B A;  2JT5 A;  1O0T A;  3WV1 A;  3KME A;  966C A;  4G0D A;  1BKC I;  1JJ9 A;  3LJZ A;  3DTI A;  4WKI A;  2TCL A;  1JH1 A;  3DPE A;  3U1R A;  1R1J A;  2MLS A;  4WZV A;  2X7M A;  2XS4 A;  1JIW P;  1JIZ A;  1BQO A;  2DW0 A;  1BUV M;  1Y93 A;  3V96 B;  2J83 A;  3K7L A;  1QJJ A;  4DF9 A;  1Y8J A;  1KUK A;  1SLN A;  3ZVS A;  1G05 A;  1C3I A;  1Z3J A;  1ZTQ A;  1J7N A;  2D1N A;  2JSD A;  1GO8 P;  1RM8 A;  4JQG A;  1GO7 P;  1BKC A;  3DPF A;  2K9C A;  3F17 A;  2W15 A;  4PKQ A;  1PWW A;  4JP4 A;  4G9L A;  1R1H A;  4H82 A;  1Q3A A;  3LK8 A;  3LKA A;  2OVX A;  2D1O A;  3DL1 A;  3EDI A;  1DMT A;  4I03 A;  1DTH A;  4FXY P;  1D5J A;  3B8Z A;  4ON1 A;  2POJ A;  3HDB A;  3ELM A;  1YQY A;  3G5C A;  3HBU P;  2N8R A;  4H30 A;  2MLR A;  2OXU A;  1O0Q A;  1I1I P;  3EDH A;  3B2Z A;  4DV8 A;  1UMT A;  4I35 A;  3LIK A;  1BIW A;  3EHY A;  4GR3 A;  456C A;  1HTD A;  3LJG A;  1UEA A;  1PWV A;  4JA1 A;  5D2B A;  4PKW A;  4XM6 A;  4A7B A;  2CLT A;  1GKD A;  1ROS A;  3I7G A;  4AYK A;  3KRY A;  1CQR A;  1H71 P;  3KMC A;  1KBC A;  3KEJ A;  4FXQ A;  4AIG A;  1I76 A;  3L0T A;  1KUH A;  1C8T A;  3LUM A;  3LQ0 A;  4PKV A;  3OHL A;  3LUN A;  1BZS A;  1OM7 A;  5BOT A;  1CGF A;  3USN A;  1PWQ A;  3AYK A;  2RJP A;  4R3V A;  5L79 A;  5B5O A;  1EUB A;  2X3C A;  1QIC A;  4GF1 A;  1ZS0 A;  2OXW A;  3TT4 A;  1G12 A;  1FLS A;  3DNG A;  3EHX A;  2W13 A;  4L6T A;  1AST A;  1EAK A;  1CIZ A;  3LIR A;  1AYK A;  1CGE A;  3DTE A;  4GR8 A;  1OS9 A;  4XM7 A;  1G9K A;  2RJQ A;  2DW1 A;  1HFC A;  1CXV A;  5D1T A;  4EFS A;  3F1A A;  5CZM A;  3GBO A;  3KWV C;  4WK7 A;  2ERQ A;  1WNI A;  4XM8 A;  1K7Q A;  3F18 A;  4PKU A;  2DDF A;  3ZXH A;  3F19 A;  5D3C A;  1IAB A;  1BSW A;  2YB9 A;  3WV3 A;  1GXD A;  5D1U A;  4PKT A;  3LMC A;  1OS2 A;  3LJT A;  1YP1 A;  2KRJ A;  4GWM A;  830C A;  1PWP A;  1UTZ A;  1AKL A;  1A86 A;  4PKR A;  4HX3 A;  1XUD A;  4H49 A;  2O3E A;  2QPJ A;  2L0R A;  2I47 A;  1C7K A;  4IJO A;  1B3D A;  1XFV A;  2FV9 A;  4IUW A;  4GUY A;  1B8Y A;  3F15 A;  3CKI A;  3EWJ A;  1OM6 A;  1JAN A;  4H1Q A;  4GR0 A;  1YCM A;  2JT6 A;  1FBL A;  3K7N A;  3Q2G A;  1G49 A;  1BQQ M;  1A85 A;  3EDZ A;  3AIG A;  1IAD A;  2Y6C A;  4HMA A;  2AYK A;  1SU3 A;  2W12 A;  1IAE A;  1XFX A;  4QKZ A;  1L6J A;  3HY9 A;  1ZXC A;  1BKC E;  2OY4 A;  2PJT A;  4GQL A;  4ZR5 A;  1ATL A;  1JKY A;  3L0V A;  5H8X A;  1QIB A;  1SMP A;  1I73 A;  1OM8 A;  2Z2D A;  1QJI A;  1JAO A;  5BOY A;  1R1I A;  3KEC A;  5L7F A;  3SHI A;  1G4K A;  4FU4 A;  1BUD A;  3N2U A;  5D7W A;  2OI0 A;  4H3X A;  3NX7 A;  1KUG A;  2WOA A;  2W14 A;  3P1V A;  3HYG A;  1D8M A;  1SRP A;  3B92 A;  1JK3 A;  3KHI A;  2J0T A;  3LQB A;  1XUR A;  1FM1 A;  4DD8 A;  1XUC A;  1JAP A;  3RTS A;  1IAC A;  2OZR A;  4XCT A;  4L7A A;  3DSL A;  3BA0 A;  2OW2 A;  3P24 A;  1IAA A;  1MMP A;  1CAQ A;  1KAP P;  2USN A;  4DPE A;  3LGP A;  4A3W A;  2DDY A;  3VTG A;  2XS3 A;  3O2X A;  1Y0V A;  5CXA A;  4H84 A;  1UMS A;  2OW1 A;  1JAQ A;  1GE5 A;  2K2G A;  2E3X A;  2MZI A;  2OXZ A;  2O36 A;  2X3A A;  5I3M A;  5I2Z A;  5I4O A;  1IAG A;  4AUO A;  1D7X A;  1PWU A;  3G42 A;  1UTT A;  1OMJ A;  3DWB A;  1EB6 A;  5I12 A;  2W0D A;  2OVZ A;  1RMZ A;  4L19 A;  1MNC A;  3ZUK A;  4Q1L A;  1ZP5 A;  1ZVX A;  2AIG P;  2YUF A;  1GKC A;  1USN A;  1ND1 A;  5CUH A;  3VI1 A;  4H2E A;  3TS4 A;  1XFZ A;  3WV2 A;  3LIL A;  3TSK A;  5D1S A;  2OY2 A;  2A8H A;  4FVL A;  5JMY A;  2WO8 A;  3UVC A;  1AF0 A;  3HY7 A;  1SAT A;  3KEK A;  3E8R A;  3EDG A;  3I7I A;  1CGL A;  5I43 A;  5BPA A;  1GE6 A;  3AYU A;  3DTK A;  1R54 A;  4IN9 A;  1CK7 A;  5I0L A;  3TVC A;  1HFS A;  2FV5 A;  4WKE A;  1HY7 A;  3LE9 A;  2JIH A;  3N2V A;  4JPA A;  4XBH A;  5LAB A;  1MMB A;  2YIG A;  1YOU A;  1D8F A;  4ILW D;  5B5P A;  2DW2 A;  3O64 A;  1MMQ A;  1KUF A;  1K7I A;  3MA2 A;  2Y6D A;  4AXQ A;  3Q2H A;  1QIA A;  3HDA P;  2ERO A;  2SRT A;  2WO9 A;  4PKS A;  1S4B P;  1HV5 A;  4GWN A;  3OHO A;  1K7G A;  2MZH A;  1KUI A;  3F16 A;  1R55 A;  1XFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...