1JANA

Complex of pro-leu-gly-hydroxylamine with the catalytic domain of matrix metallo proteinase-8 (phe79 form)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
164
structure length
164
Chain Sequence
FMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLO PROTEINASE-8 (PHE79 FORM)
publication title Structural implications for the role of the N terminus in the 'superactivation' of collagenases. A crystallographic study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 47
structure length 164
sequence length 164
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1996-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1janA00
2CKIA 1HOVA 4GQLA 3F1AA 1JANA 1I76A 1K7QA 3LGPA 4CTHA 1DTHA 1AYKA 4ZR5A 4WK7A 4DV8A 3MA2A 4H76A 1ZXCA 4DF9A 2PJTA 2OZRA 3P1VA 4PKQA 1B8YA 2JIHA 2Y6CA 1CGFA 4I03A 3LIKA 1ASTA 3F16A 1SU3A 2FV9A 2E3XA 4PKVA 1XUCA 2ERPA 2W13A 1CQRA 2JT6A 1XFUA 5BPAA 1GXDA 2CLTA 1R1JA 5LABA 4PKRA 4H3XA 4FXYP 2AYKA 3BA0A 3EHYA 1BUDA 1XFWA 4FU4A 3N2VA 1ZVXA 1JAPA 1Z3JA 3U1RA 1CIZA 1XFVA 2W14A 3B8ZA 2YIGA 1UMTA 1QJIA 2EROA 1UEAA 1C3IA 1XFXA 2QPJA 3DWBA 1IABA 1OO9A 2J0TA 2OXZA 2DDFA 1GE5A 2OXUA 1IACA 2SRTA 4QKZA 1KUIA 1RM8A 4H1QA 1PWVA 1AF0A 1S4BP 3K7LA 1GO8P 2Y6DA 5D1UA 3ELMA 2MZHA 2X3CA 1G9KA 1DMTA 4GWNA 1BM6A 3G42A 1R1IA 1YQYA 2K9CA 3Q2GA 4XCTA 5B5PA 1SRPA 4PKTA 3B92A 2OW2A 1OM7A 3KMCA 1JJ9A 4IN9A 5CZMA 1ROSA 1YP1A 3OHLA 1JKYA 1ND1A 3CKIA 3HBVP 1JK3A 1OM8A 1BKCI 1SLMA 3KEKA 3LQ0A 3P24A 1D7XA 1L6JA 2N8RA 1HY7A 1UTZA 1SLNA 4GUYA 1GKCA 1USNA 3USNA 4JQGA 3ZUKA 3WV1A 1AKLA 5I12A 1OM6A 5I3MA 1MMBA 1C7KA 3K7NA 2JSDA 2RJPA 4L19A 2FV5A 830CA 1O0QA 2WOAA 4EFSA 1BKCA 4PKSA 5BOTA 3L0VA 5D1SA 4HMAA 1RMZA 1BIWA 3LK8A 1YCMA 5D1TA 2I47A 4L6TA 2JT5A 2WO8A 1XFYA 1XFZA 3L0TA 1PWUA 2DW1A 3DSLA 4AXQA 4GWMA 3ZVSA 4R3VA 4XBHA 4J4MA 1JH1A 4Q1LA 3HYGA 1BSWA 1WNIA 3HY7A 4AUOA 1YOUA 1G12A 1CGLA 1PWPA 1HTDA 4JA1A 2HU6A 3TSKA 4WZVA 1I1IP 1G49A 4IUWA 4AIGA 3EDIA 4PKWA 3N2UA 4PKUA 2MZIA 2W15A 1KAPP 1FBLA 4XM8A 3DPEA 1I73A 3DL1A 966CA 2OW1A 1CXVA 4FVLA 3HBUP 3LMCA 3VI1A 2POJA 1QUAA 3KEJA 1JAQA 5D2BA 4ILWD 1O0TA 5L79A 3EDGA 1HV5A 3G5CA 1H71P 1OS2A 3EDZA 1ZS0A 2OXWA 3F19A 4H30A 4AYKA 2DW2A 1BZSA 4WKIA 2L0RA 1JIWP 1SATA 1G4KA 4GR8A 4H82A 1KUGA 1QICA 1D5JA 1SMPA 5B5OA 1CK7A 3KMEA 5D3CA 2DW0A 3WV3A 3WV2A 2ERQA 3E8RA 2O36A 2MLSA 5CXAA 4GF1A 4IJOA 5CUHA 4DPEA 4H49A 3F15A 4G9LA 4ON1A 1FM1A 2TCLA 4L63A 3HDBA 1HFCA 2A8HA 1MMQA 3EDHA 2MLRA 2DDYA 5I4OA 2D1NA 2OVZA 1D8MA 1XUDA 1EUBA 2XS3A 1R54A 1MNCA 1HFSA 4A3WA 5JMYA 5H8XA 4XM6A 3ZXHA 3LJZA 2JNPA 1KBCA 3KWVC 3LUNA 3OHOA 3LKAA 1PWWA 1GE7A 1GKDA 2KRJA 2OW9A 3DNGA 1PWQA 1B3DA 2W0DA 2USNA 3HB2P 3LJGA 1JAOA 5D7WA 4G0DA 1EB6A 4JIJA 1ZTQA 3LUMA 1A86A 1UTTA 3LQBA 3EWJA 2X3BA 2X3AA 1MMRA 4XM7A 1XURA 4H84A 3GBOA 5L7FA 2K2GA 2YB9A 1ZP5A 2XS4A 1KUHA 4FXQA 4WF6A 2V4BA 4DD8A 1BQOA 2OI0A 1IAAA 1A85A 4I35A 3V96B 1CAQA 3O2XA 1KUKA 2RJQA 2E2DA 1BKCE 3LILA 1Y93A 1UMSA 1IAGA 3TT4A 2WO9A 1G05A 1MMPA 4WKEA 4A7BA 2O3EA 1BQQM 2OY2A 1K7IA 2MZEA 3B2ZA 2OVXA 1Q3AA 1Y0VA 1JIZA 3O64A 3AYKA 3F18A 1D8FA 1ZXVA 1J7NA 5BOYA 3KECA 3LIRA 2J83A 3RTSA 3AIGA 1IADA 2OY4A 3EHXA 3HY9A 5I2ZA 3LJTA 4GR0A 3NX7A 1GE6A 3F17A 4GR3A 5I43A 1CGEA 1QIBA 1C8TA 4HX3A 3KHIA 2Z2DA 3AYUA 3TVCA 4JP4A 3VTGA 1KUFA 1ATLA 3RTTA 3KRYA 4H2EA 5I0LA 1K7GA 4JPAA 3TS4A 1GO7P 3SHIA 3DPFA 1OS9A 1Y8JA 3LE9A 3I7IA 2AIGP 3LEAA 1OMJA 1FLSA 3Q2HA 456CA 1EAKA 1QIAA 2X7MA 1R55A 2D1OA 3I7GA 2OW0A 3UVCA 3HDAP 2W12A 1IAEA 1R1HA 1QJJA 1BUVM
chains in the Genus database with same CATH superfamily
2CKIA 1HOVA 4GQLA 3F1AA 1JANA 1I76A 1K7QA 3LGPA 4CTHA 1DTHA 1AYKA 4ZR5A 4WK7A 4DV8A 3MA2A 4H76A 1ZXCA 4DF9A 2PJTA 2OZRA 3P1VA 4PKQA 1B8YA 2JIHA 2Y6CA 1CGFA 4I03A 3LIKA 1ASTA 3F16A 1SU3A 2FV9A 2E3XA 4PKVA 1XUCA 2ERPA 2W13A 1CQRA 2JT6A 1XFUA 5BPAA 1GXDA 2CLTA 1R1JA 5LABA 4PKRA 4H3XA 4FXYP 2AYKA 1XAXA 3BA0A 3EHYA 1BUDA 1XFWA 4FU4A 3N2VA 1ZVXA 1JAPA 1Z3JA 3U1RA 1CIZA 1XFVA 2W14A 3B8ZA 4L7AA 2YIGA 1UMTA 1QJIA 2EROA 1UEAA 1C3IA 1XFXA 2QPJA 3DWBA 1IABA 1OO9A 2J0TA 2OXZA 2DDFA 3DTEA 1GE5A 2OXUA 1IACA 2SRTA 4QKZA 1KUIA 1RM8A 4H1QA 1PWVA 1AF0A 1S4BP 3K7LA 1GO8P 2Y6DA 5D1UA 3ELMA 2MZHA 2X3CA 1G9KA 1DMTA 4GWNA 1BM6A 3G42A 1R1IA 1YQYA 2K9CA 3Q2GA 4XCTA 5B5PA 1SRPA 4PKTA 3B92A 2OW2A 1OM7A 3KMCA 1JJ9A 4IN9A 5CZMA 1ROSA 1YP1A 3OHLA 1JKYA 1ND1A 3CKIA 3HBVP 1JK3A 1OM8A 1BKCI 1SLMA 3KEKA 3LQ0A 3P24A 1D7XA 1L6JA 2N8RA 1HY7A 1UTZA 1SLNA 4GUYA 1GKCA 1USNA 3USNA 4JQGA 3ZUKA 3WV1A 1AKLA 5I12A 1OM6A 1XM5A 5I3MA 1MMBA 1C7KA 3K7NA 2JSDA 2RJPA 4L19A 2FV5A 830CA 1O0QA 2WOAA 4EFSA 1BKCA 4PKSA 5BOTA 3L0VA 5D1SA 4HMAA 1RMZA 1BIWA 3LK8A 1YCMA 5D1TA 2I47A 4L6TA 2JT5A 2WO8A 1XFYA 1XFZA 3L0TA 1PWUA 2DW1A 3DSLA 4AXQA 4GWMA 3ZVSA 4R3VA 4XBHA 4J4MA 1JH1A 4Q1LA 3HYGA 1BSWA 1WNIA 3HY7A 4AUOA 1YOUA 1G12A 1CGLA 1PWPA 1HTDA 4JA1A 2HU6A 3TSKA 4WZVA 1I1IP 1G49A 4IUWA 4AIGA 3EDIA 4PKWA 3N2UA 4PKUA 2MZIA 2W15A 1KAPP 1FBLA 4XM8A 3DPEA 1I73A 3DL1A 966CA 2OW1A 1CXVA 4FVLA 3HBUP 3LMCA 3VI1A 2POJA 1QUAA 3KEJA 1JAQA 5D2BA 4ILWD 1O0TA 5L79A 3EDGA 1HV5A 3G5CA 1H71P 1OS2A 3EDZA 1ZS0A 2OXWA 3F19A 4H30A 4AYKA 2DW2A 1BZSA 4WKIA 2L0RA 1JIWP 1SATA 1G4KA 4GR8A 4H82A 1KUGA 1QICA 1D5JA 1SMPA 5B5OA 1CK7A 3KMEA 5D3CA 2DW0A 3WV3A 3WV2A 2ERQA 2YUFA 3E8RA 2O36A 2MLSA 5CXAA 4GF1A 4IJOA 5CUHA 4DPEA 4H49A 3F15A 4G9LA 4ON1A 1FM1A 2TCLA 4L63A 3HDBA 1HFCA 2A8HA 1MMQA 3EDHA 2MLRA 2DDYA 5I4OA 2D1NA 2OVZA 1D8MA 1XUDA 1EUBA 2XS3A 1R54A 1MNCA 1HFSA 4A3WA 5JMYA 5H8XA 4XM6A 3ZXHA 3LJZA 2JNPA 1KBCA 3KWVC 3LUNA 3OHOA 3LKAA 1PWWA 1GE7A 1GKDA 2KRJA 2OW9A 3DNGA 1PWQA 1B3DA 2W0DA 2USNA 3HB2P 3LJGA 1JAOA 5D7WA 4G0DA 1EB6A 4JIJA 1ZTQA 3LUMA 1A86A 1UTTA 3LQBA 3EWJA 2X3BA 2X3AA 1MMRA 4XM7A 1XURA 4H84A 3GBOA 5L7FA 2K2GA 2YB9A 1ZP5A 2XS4A 3DTKA 1KUHA 4FXQA 4WF6A 2V4BA 4DD8A 1BQOA 2OI0A 1IAAA 1A85A 4I35A 3V96B 1CAQA 3O2XA 1KUKA 2RJQA 2E2DA 1BKCE 3LILA 1Y93A 1UMSA 1IAGA 3TT4A 2WO9A 1G05A 1MMPA 4WKEA 4A7BA 2O3EA 1BQQM 1TVIA 2OY2A 3DTIA 1K7IA 2MZEA 3B2ZA 2OVXA 1Q3AA 1Y0VA 1JIZA 3O64A 3AYKA 3F18A 1D8FA 1ZXVA 1J7NA 5BOYA 3KECA 3LIRA 2J83A 3RTSA 3AIGA 1IADA 2OY4A 3EHXA 3HY9A 5I2ZA 3LJTA 4GR0A 3NX7A 1GE6A 3F17A 4GR3A 5I43A 1CGEA 1QIBA 1C8TA 4HX3A 3KHIA 2Z2DA 3AYUA 3TVCA 4JP4A 3VTGA 1KUFA 1ATLA 3RTTA 3KRYA 4H2EA 5I0LA 1OZ9A 1K7GA 4JPAA 3TS4A 1GO7P 3SHIA 3DPFA 1OS9A 1Y8JA 3LE9A 3I7IA 2AIGP 3LEAA 1OMJA 1FLSA 3Q2HA 456CA 1EAKA 1QIAA 2X7MA 1R55A 2D1OA 3I7GA 2OW0A 3UVCA 3HDAP 2W12A 1IAEA 1R1HA 1QJJA 1BUVM
chains in the Genus database with same CATH topology
2CKIA 1HOVA 4GQLA 3F1AA 1JANA 1I76A 1K7QA 3LGPA 4CTHA 1DTHA 1AYKA 4ZR5A 4WK7A 4DV8A 3MA2A 4H76A 1ZXCA 4DF9A 2PJTA 2OZRA 3P1VA 4PKQA 1B8YA 2JIHA 2Y6CA 1CGFA 4I03A 3LIKA 1ASTA 3F16A 1SU3A 2FV9A 2E3XA 4PKVA 1XUCA 2ERPA 2W13A 1CQRA 2JT6A 1XFUA 5BPAA 1GXDA 2CLTA 1R1JA 5LABA 4PKRA 4H3XA 4FXYP 2AYKA 3BA0A 3EHYA 1BUDA 1XFWA 4FU4A 3N2VA 1ZVXA 1JAPA 1Z3JA 3U1RA 1CIZA 1XFVA 2W14A 3B8ZA 4L7AA 2YIGA 1UMTA 1QJIA 2EROA 1UEAA 1C3IA 1XFXA 2QPJA 3DWBA 1IABA 1OO9A 2J0TA 2OXZA 2DDFA 3DTEA 1GE5A 2OXUA 1IACA 2SRTA 4QKZA 1KUIA 1RM8A 4H1QA 1PWVA 1AF0A 1S4BP 3K7LA 1GO8P 2Y6DA 5D1UA 3ELMA 2MZHA 2X3CA 1G9KA 1DMTA 4GWNA 1BM6A 3G42A 1R1IA 1YQYA 2K9CA 3Q2GA 4XCTA 5B5PA 1SRPA 4PKTA 3B92A 2OW2A 1OM7A 3KMCA 1JJ9A 4IN9A 5CZMA 1ROSA 1YP1A 3OHLA 1JKYA 1ND1A 3CKIA 3HBVP 1JK3A 1OM8A 1BKCI 1SLMA 3KEKA 3LQ0A 3P24A 1D7XA 1L6JA 2N8RA 1HY7A 1UTZA 1SLNA 4GUYA 1GKCA 1USNA 3USNA 4JQGA 3ZUKA 3WV1A 1AKLA 5I12A 1OM6A 5I3MA 1MMBA 1C7KA 3K7NA 2JSDA 2RJPA 4L19A 2FV5A 830CA 1O0QA 2WOAA 4EFSA 1BKCA 4PKSA 5BOTA 3L0VA 5D1SA 4HMAA 1RMZA 1BIWA 3LK8A 1YCMA 5D1TA 2I47A 4L6TA 2JT5A 2WO8A 1XFYA 1XFZA 3L0TA 1PWUA 2DW1A 3DSLA 4AXQA 4GWMA 3ZVSA 4R3VA 4XBHA 4J4MA 1JH1A 4Q1LA 3HYGA 1BSWA 1WNIA 3HY7A 4AUOA 1YOUA 1G12A 1CGLA 1PWPA 1HTDA 4JA1A 2HU6A 3TSKA 4WZVA 1I1IP 1G49A 4IUWA 4AIGA 3EDIA 4PKWA 3N2UA 4PKUA 2MZIA 2W15A 1KAPP 1FBLA 4XM8A 3DPEA 1I73A 3DL1A 966CA 2OW1A 1CXVA 4FVLA 3HBUP 3LMCA 3VI1A 2POJA 1QUAA 3KEJA 1JAQA 5D2BA 4ILWD 1O0TA 5L79A 3EDGA 1HV5A 3G5CA 1H71P 1OS2A 3EDZA 1ZS0A 2OXWA 3F19A 4H30A 4AYKA 2DW2A 1BZSA 4WKIA 2L0RA 1JIWP 1SATA 1G4KA 4GR8A 4H82A 1KUGA 1QICA 1D5JA 1SMPA 5B5OA 1CK7A 3KMEA 5D3CA 2DW0A 3WV3A 3WV2A 2ERQA 2YUFA 3E8RA 2O36A 2MLSA 5CXAA 4GF1A 4IJOA 5CUHA 4DPEA 4H49A 3F15A 4G9LA 4ON1A 1FM1A 2TCLA 4L63A 3HDBA 1HFCA 2A8HA 1MMQA 3EDHA 2MLRA 2DDYA 5I4OA 2D1NA 2OVZA 1D8MA 1XUDA 1EUBA 2XS3A 1R54A 1MNCA 1HFSA 4A3WA 5JMYA 5H8XA 4XM6A 3ZXHA 3LJZA 2JNPA 1KBCA 3KWVC 3LUNA 3OHOA 3LKAA 1PWWA 1GE7A 1GKDA 2KRJA 2OW9A 3DNGA 1PWQA 1B3DA 2W0DA 2USNA 3HB2P 3LJGA 1JAOA 5D7WA 4G0DA 1EB6A 4JIJA 1ZTQA 3LUMA 1A86A 1UTTA 3LQBA 3EWJA 2X3BA 2X3AA 1MMRA 4XM7A 1XURA 4H84A 3GBOA 5L7FA 2K2GA 2YB9A 1ZP5A 2XS4A 3DTKA 1KUHA 4FXQA 4WF6A 2V4BA 4DD8A 1BQOA 2OI0A 1IAAA 1A85A 4I35A 3V96B 1CAQA 3O2XA 1KUKA 2RJQA 2E2DA 1BKCE 3LILA 1Y93A 1UMSA 1IAGA 3TT4A 2WO9A 1G05A 1MMPA 4WKEA 4A7BA 2O3EA 1BQQM 2OY2A 3DTIA 1K7IA 2MZEA 3B2ZA 2OVXA 1Q3AA 1Y0VA 1JIZA 3O64A 3AYKA 3F18A 1D8FA 1ZXVA 1J7NA 5BOYA 3KECA 3LIRA 2J83A 3RTSA 3AIGA 1IADA 2OY4A 3EHXA 3HY9A 5I2ZA 3LJTA 4GR0A 3NX7A 1GE6A 3F17A 4GR3A 5I43A 1CGEA 1QIBA 1C8TA 4HX3A 3KHIA 2Z2DA 3AYUA 3TVCA 4JP4A 3VTGA 1KUFA 1ATLA 3RTTA 3KRYA 4H2EA 5I0LA 1K7GA 4JPAA 3TS4A 1GO7P 3SHIA 3DPFA 1OS9A 1Y8JA 3LE9A 3I7IA 2AIGP 3LEAA 1OMJA 1FLSA 3Q2HA 456CA 1EAKA 1QIAA 2X7MA 1R55A 2D1OA 3I7GA 2OW0A 3UVCA 3HDAP 2W12A 1IAEA 1R1HA 1QJJA 1BUVM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKI A;  1HOV A;  4GQL A;  3F1A A;  1JAN A;  1I76 A;  1K7Q A;  3LGP A;  4CTH A;  1DTH A;  1AYK A;  4ZR5 A;  4WK7 A;  4DV8 A;  3MA2 A;  4H76 A;  1ZXC A;  4DF9 A;  2PJT A;  2OZR A;  3P1V A;  4PKQ A;  1B8Y A;  2JIH A;  2Y6C A;  1CGF A;  4I03 A;  3LIK A;  1AST A;  3F16 A;  1SU3 A;  2FV9 A;  2E3X A;  4PKV A;  1XUC A;  2ERP A;  2W13 A;  1CQR A;  2JT6 A;  1XFU A;  5BPA A;  1GXD A;  2CLT A;  1R1J A;  5LAB A;  4PKR A;  4H3X A;  4FXY P;  2AYK A;  3BA0 A;  3EHY A;  1BUD A;  1XFW A;  4FU4 A;  3N2V A;  1ZVX A;  1JAP A;  1Z3J A;  3U1R A;  1CIZ A;  1XFV A;  2W14 A;  3B8Z A;  2YIG A;  1UMT A;  1QJI A;  2ERO A;  1UEA A;  1C3I A;  1XFX A;  2QPJ A;  3DWB A;  1IAB A;  1OO9 A;  2J0T A;  2OXZ A;  2DDF A;  1GE5 A;  2OXU A;  1IAC A;  2SRT A;  4QKZ A;  1KUI A;  1RM8 A;  4H1Q A;  1PWV A;  1AF0 A;  1S4B P;  3K7L A;  1GO8 P;  2Y6D A;  5D1U A;  3ELM A;  2MZH A;  2X3C A;  1G9K A;  1DMT A;  4GWN A;  1BM6 A;  3G42 A;  1R1I A;  1YQY A;  2K9C A;  3Q2G A;  4XCT A;  5B5P A;  1SRP A;  4PKT A;  3B92 A;  2OW2 A;  1OM7 A;  3KMC A;  1JJ9 A;  4IN9 A;  5CZM A;  1ROS A;  1YP1 A;  3OHL A;  1JKY A;  1ND1 A;  3CKI A;  3HBV P;  1JK3 A;  1OM8 A;  1BKC I;  1SLM A;  3KEK A;  3LQ0 A;  3P24 A;  1D7X A;  1L6J A;  2N8R A;  1HY7 A;  1UTZ A;  1SLN A;  4GUY A;  1GKC A;  1USN A;  3USN A;  4JQG A;  3ZUK A;  3WV1 A;  1AKL A;  5I12 A;  1OM6 A;  5I3M A;  1MMB A;  1C7K A;  3K7N A;  2JSD A;  2RJP A;  4L19 A;  2FV5 A;  830C A;  1O0Q A;  2WOA A;  4EFS A;  1BKC A;  4PKS A;  5BOT A;  3L0V A;  5D1S A;  4HMA A;  1RMZ A;  1BIW A;  3LK8 A;  1YCM A;  5D1T A;  2I47 A;  4L6T A;  2JT5 A;  2WO8 A;  1XFY A;  1XFZ A;  3L0T A;  1PWU A;  2DW1 A;  3DSL A;  4AXQ A;  4GWM A;  3ZVS A;  4R3V A;  4XBH A;  4J4M A;  1JH1 A;  4Q1L A;  3HYG A;  1BSW A;  1WNI A;  3HY7 A;  4AUO A;  1YOU A;  1G12 A;  1CGL A;  1PWP A;  1HTD A;  4JA1 A;  2HU6 A;  3TSK A;  4WZV A;  1I1I P;  1G49 A;  4IUW A;  4AIG A;  3EDI A;  4PKW A;  3N2U A;  4PKU A;  2MZI A;  2W15 A;  1KAP P;  1FBL A;  4XM8 A;  3DPE A;  1I73 A;  3DL1 A;  966C A;  2OW1 A;  1CXV A;  4FVL A;  3HBU P;  3LMC A;  3VI1 A;  2POJ A;  1QUA A;  3KEJ A;  1JAQ A;  5D2B A;  4ILW D;  1O0T A;  5L79 A;  3EDG A;  1HV5 A;  3G5C A;  1H71 P;  1OS2 A;  3EDZ A;  1ZS0 A;  2OXW A;  3F19 A;  4H30 A;  4AYK A;  2DW2 A;  1BZS A;  4WKI A;  2L0R A;  1JIW P;  1SAT A;  1G4K A;  4GR8 A;  4H82 A;  1KUG A;  1QIC A;  1D5J A;  1SMP A;  5B5O A;  1CK7 A;  3KME A;  5D3C A;  2DW0 A;  3WV3 A;  3WV2 A;  2ERQ A;  3E8R A;  2O36 A;  2MLS A;  5CXA A;  4GF1 A;  4IJO A;  5CUH A;  4DPE A;  4H49 A;  3F15 A;  4G9L A;  4ON1 A;  1FM1 A;  2TCL A;  4L63 A;  3HDB A;  1HFC A;  2A8H A;  1MMQ A;  3EDH A;  2MLR A;  2DDY A;  5I4O A;  2D1N A;  2OVZ A;  1D8M A;  1XUD A;  1EUB A;  2XS3 A;  1R54 A;  1MNC A;  1HFS A;  4A3W A;  5JMY A;  5H8X A;  4XM6 A;  3ZXH A;  3LJZ A;  2JNP A;  1KBC A;  3KWV C;  3LUN A;  3OHO A;  3LKA A;  1PWW A;  1GE7 A;  1GKD A;  2KRJ A;  2OW9 A;  3DNG A;  1PWQ A;  1B3D A;  2W0D A;  2USN A;  3HB2 P;  3LJG A;  1JAO A;  5D7W A;  4G0D A;  1EB6 A;  4JIJ A;  1ZTQ A;  3LUM A;  1A86 A;  1UTT A;  3LQB A;  3EWJ A;  2X3B A;  2X3A A;  1MMR A;  4XM7 A;  1XUR A;  4H84 A;  3GBO A;  5L7F A;  2K2G A;  2YB9 A;  1ZP5 A;  2XS4 A;  1KUH A;  4FXQ A;  4WF6 A;  2V4B A;  4DD8 A;  1BQO A;  2OI0 A;  1IAA A;  1A85 A;  4I35 A;  3V96 B;  1CAQ A;  3O2X A;  1KUK A;  2RJQ A;  2E2D A;  1BKC E;  3LIL A;  1Y93 A;  1UMS A;  1IAG A;  3TT4 A;  2WO9 A;  1G05 A;  1MMP A;  4WKE A;  4A7B A;  2O3E A;  1BQQ M;  2OY2 A;  1K7I A;  2MZE A;  3B2Z A;  2OVX A;  1Q3A A;  1Y0V A;  1JIZ A;  3O64 A;  3AYK A;  3F18 A;  1D8F A;  1ZXV A;  1J7N A;  5BOY A;  3KEC A;  3LIR A;  2J83 A;  3RTS A;  3AIG A;  1IAD A;  2OY4 A;  3EHX A;  3HY9 A;  5I2Z A;  3LJT A;  4GR0 A;  3NX7 A;  1GE6 A;  3F17 A;  4GR3 A;  5I43 A;  1CGE A;  1QIB A;  1C8T A;  4HX3 A;  3KHI A;  2Z2D A;  3AYU A;  3TVC A;  4JP4 A;  3VTG A;  1KUF A;  1ATL A;  3RTT A;  3KRY A;  4H2E A;  5I0L A;  1K7G A;  4JPA A;  3TS4 A;  1GO7 P;  3SHI A;  3DPF A;  1OS9 A;  1Y8J A;  3LE9 A;  3I7I A;  2AIG P;  3LEA A;  1OMJ A;  1FLS A;  3Q2H A;  456C A;  1EAK A;  1QIA A;  2X7M A;  1R55 A;  2D1O A;  3I7G A;  2OW0 A;  3UVC A;  3HDA P;  2W12 A;  1IAE A;  1R1H A;  1QJJ A;  1BUV M; 
#chains in the Genus database with same CATH topology
 2CKI A;  1HOV A;  4GQL A;  3F1A A;  1JAN A;  1I76 A;  1K7Q A;  3LGP A;  4CTH A;  1DTH A;  1AYK A;  4ZR5 A;  4WK7 A;  4DV8 A;  3MA2 A;  4H76 A;  1ZXC A;  4DF9 A;  2PJT A;  2OZR A;  3P1V A;  4PKQ A;  1B8Y A;  2JIH A;  2Y6C A;  1CGF A;  4I03 A;  3LIK A;  1AST A;  3F16 A;  1SU3 A;  2FV9 A;  2E3X A;  4PKV A;  1XUC A;  2ERP A;  2W13 A;  1CQR A;  2JT6 A;  1XFU A;  5BPA A;  1GXD A;  2CLT A;  1R1J A;  5LAB A;  4PKR A;  4H3X A;  4FXY P;  2AYK A;  1XAX A;  3BA0 A;  3EHY A;  1BUD A;  1XFW A;  4FU4 A;  3N2V A;  1ZVX A;  1JAP A;  1Z3J A;  3U1R A;  1CIZ A;  1XFV A;  2W14 A;  3B8Z A;  4L7A A;  2YIG A;  1UMT A;  1QJI A;  2ERO A;  1UEA A;  1C3I A;  1XFX A;  2QPJ A;  3DWB A;  1IAB A;  1OO9 A;  2J0T A;  2OXZ A;  2DDF A;  3DTE A;  1GE5 A;  2OXU A;  1IAC A;  2SRT A;  4QKZ A;  1KUI A;  1RM8 A;  4H1Q A;  1PWV A;  1AF0 A;  1S4B P;  3K7L A;  1GO8 P;  2Y6D A;  5D1U A;  3ELM A;  2MZH A;  2X3C A;  1G9K A;  1DMT A;  4GWN A;  1BM6 A;  3G42 A;  1R1I A;  1YQY A;  2K9C A;  3Q2G A;  4XCT A;  5B5P A;  1SRP A;  4PKT A;  3B92 A;  2OW2 A;  1OM7 A;  3KMC A;  1JJ9 A;  4IN9 A;  5CZM A;  1ROS A;  1YP1 A;  3OHL A;  1JKY A;  1ND1 A;  3CKI A;  3HBV P;  1JK3 A;  1OM8 A;  1BKC I;  1SLM A;  3KEK A;  3LQ0 A;  3P24 A;  1D7X A;  1L6J A;  2N8R A;  1HY7 A;  1UTZ A;  1SLN A;  4GUY A;  1GKC A;  1USN A;  3USN A;  4JQG A;  3ZUK A;  3WV1 A;  1AKL A;  5I12 A;  1OM6 A;  1XM5 A;  5I3M A;  1MMB A;  1C7K A;  3K7N A;  2JSD A;  2RJP A;  4L19 A;  2FV5 A;  830C A;  1O0Q A;  2WOA A;  4EFS A;  1BKC A;  4PKS A;  5BOT A;  3L0V A;  5D1S A;  4HMA A;  1RMZ A;  1BIW A;  3LK8 A;  1YCM A;  5D1T A;  2I47 A;  4L6T A;  2JT5 A;  2WO8 A;  1XFY A;  1XFZ A;  3L0T A;  1PWU A;  2DW1 A;  3DSL A;  4AXQ A;  4GWM A;  3ZVS A;  4R3V A;  4XBH A;  4J4M A;  1JH1 A;  4Q1L A;  3HYG A;  1BSW A;  1WNI A;  3HY7 A;  4AUO A;  1YOU A;  1G12 A;  1CGL A;  1PWP A;  1HTD A;  4JA1 A;  2HU6 A;  3TSK A;  4WZV A;  1I1I P;  1G49 A;  4IUW A;  4AIG A;  3EDI A;  4PKW A;  3N2U A;  4PKU A;  2MZI A;  2W15 A;  1KAP P;  1FBL A;  4XM8 A;  3DPE A;  1I73 A;  3DL1 A;  966C A;  2OW1 A;  1CXV A;  4FVL A;  3HBU P;  3LMC A;  3VI1 A;  2POJ A;  1QUA A;  3KEJ A;  1JAQ A;  5D2B A;  4ILW D;  1O0T A;  5L79 A;  3EDG A;  1HV5 A;  3G5C A;  1H71 P;  1OS2 A;  3EDZ A;  1ZS0 A;  2OXW A;  3F19 A;  4H30 A;  4AYK A;  2DW2 A;  1BZS A;  4WKI A;  2L0R A;  1JIW P;  1SAT A;  1G4K A;  4GR8 A;  4H82 A;  1KUG A;  1QIC A;  1D5J A;  1SMP A;  5B5O A;  1CK7 A;  3KME A;  5D3C A;  2DW0 A;  3WV3 A;  3WV2 A;  2ERQ A;  2YUF A;  3E8R A;  2O36 A;  2MLS A;  5CXA A;  4GF1 A;  4IJO A;  5CUH A;  4DPE A;  4H49 A;  3F15 A;  4G9L A;  4ON1 A;  1FM1 A;  2TCL A;  4L63 A;  3HDB A;  1HFC A;  2A8H A;  1MMQ A;  3EDH A;  2MLR A;  2DDY A;  5I4O A;  2D1N A;  2OVZ A;  1D8M A;  1XUD A;  1EUB A;  2XS3 A;  1R54 A;  1MNC A;  1HFS A;  4A3W A;  5JMY A;  5H8X A;  4XM6 A;  3ZXH A;  3LJZ A;  2JNP A;  1KBC A;  3KWV C;  3LUN A;  3OHO A;  3LKA A;  1PWW A;  1GE7 A;  1GKD A;  2KRJ A;  2OW9 A;  3DNG A;  1PWQ A;  1B3D A;  2W0D A;  2USN A;  3HB2 P;  3LJG A;  1JAO A;  5D7W A;  4G0D A;  1EB6 A;  4JIJ A;  1ZTQ A;  3LUM A;  1A86 A;  1UTT A;  3LQB A;  3EWJ A;  2X3B A;  2X3A A;  1MMR A;  4XM7 A;  1XUR A;  4H84 A;  3GBO A;  5L7F A;  2K2G A;  2YB9 A;  1ZP5 A;  2XS4 A;  3DTK A;  1KUH A;  4FXQ A;  4WF6 A;  2V4B A;  4DD8 A;  1BQO A;  2OI0 A;  1IAA A;  1A85 A;  4I35 A;  3V96 B;  1CAQ A;  3O2X A;  1KUK A;  2RJQ A;  2E2D A;  1BKC E;  3LIL A;  1Y93 A;  1UMS A;  1IAG A;  3TT4 A;  2WO9 A;  1G05 A;  1MMP A;  4WKE A;  4A7B A;  2O3E A;  1BQQ M;  1TVI A;  2OY2 A;  3DTI A;  1K7I A;  2MZE A;  3B2Z A;  2OVX A;  1Q3A A;  1Y0V A;  1JIZ A;  3O64 A;  3AYK A;  3F18 A;  1D8F A;  1ZXV A;  1J7N A;  5BOY A;  3KEC A;  3LIR A;  2J83 A;  3RTS A;  3AIG A;  1IAD A;  2OY4 A;  3EHX A;  3HY9 A;  5I2Z A;  3LJT A;  4GR0 A;  3NX7 A;  1GE6 A;  3F17 A;  4GR3 A;  5I43 A;  1CGE A;  1QIB A;  1C8T A;  4HX3 A;  3KHI A;  2Z2D A;  3AYU A;  3TVC A;  4JP4 A;  3VTG A;  1KUF A;  1ATL A;  3RTT A;  3KRY A;  4H2E A;  5I0L A;  1OZ9 A;  1K7G A;  4JPA A;  3TS4 A;  1GO7 P;  3SHI A;  3DPF A;  1OS9 A;  1Y8J A;  3LE9 A;  3I7I A;  2AIG P;  3LEA A;  1OMJ A;  1FLS A;  3Q2H A;  456C A;  1EAK A;  1QIA A;  2X7M A;  1R55 A;  2D1O A;  3I7G A;  2OW0 A;  3UVC A;  3HDA P;  2W12 A;  1IAE A;  1R1H A;  1QJJ A;  1BUV M; 
#chains in the Genus database with same CATH homology
 2CKI A;  1HOV A;  4GQL A;  3F1A A;  1JAN A;  1I76 A;  1K7Q A;  3LGP A;  4CTH A;  1DTH A;  1AYK A;  4ZR5 A;  4WK7 A;  4DV8 A;  3MA2 A;  4H76 A;  1ZXC A;  4DF9 A;  2PJT A;  2OZR A;  3P1V A;  4PKQ A;  1B8Y A;  2JIH A;  2Y6C A;  1CGF A;  4I03 A;  3LIK A;  1AST A;  3F16 A;  1SU3 A;  2FV9 A;  2E3X A;  4PKV A;  1XUC A;  2ERP A;  2W13 A;  1CQR A;  2JT6 A;  1XFU A;  5BPA A;  1GXD A;  2CLT A;  1R1J A;  5LAB A;  4PKR A;  4H3X A;  4FXY P;  2AYK A;  3BA0 A;  3EHY A;  1BUD A;  1XFW A;  4FU4 A;  3N2V A;  1ZVX A;  1JAP A;  1Z3J A;  3U1R A;  1CIZ A;  1XFV A;  2W14 A;  3B8Z A;  4L7A A;  2YIG A;  1UMT A;  1QJI A;  2ERO A;  1UEA A;  1C3I A;  1XFX A;  2QPJ A;  3DWB A;  1IAB A;  1OO9 A;  2J0T A;  2OXZ A;  2DDF A;  3DTE A;  1GE5 A;  2OXU A;  1IAC A;  2SRT A;  4QKZ A;  1KUI A;  1RM8 A;  4H1Q A;  1PWV A;  1AF0 A;  1S4B P;  3K7L A;  1GO8 P;  2Y6D A;  5D1U A;  3ELM A;  2MZH A;  2X3C A;  1G9K A;  1DMT A;  4GWN A;  1BM6 A;  3G42 A;  1R1I A;  1YQY A;  2K9C A;  3Q2G A;  4XCT A;  5B5P A;  1SRP A;  4PKT A;  3B92 A;  2OW2 A;  1OM7 A;  3KMC A;  1JJ9 A;  4IN9 A;  5CZM A;  1ROS A;  1YP1 A;  3OHL A;  1JKY A;  1ND1 A;  3CKI A;  3HBV P;  1JK3 A;  1OM8 A;  1BKC I;  1SLM A;  3KEK A;  3LQ0 A;  3P24 A;  1D7X A;  1L6J A;  2N8R A;  1HY7 A;  1UTZ A;  1SLN A;  4GUY A;  1GKC A;  1USN A;  3USN A;  4JQG A;  3ZUK A;  3WV1 A;  1AKL A;  5I12 A;  1OM6 A;  5I3M A;  1MMB A;  1C7K A;  3K7N A;  2JSD A;  2RJP A;  4L19 A;  2FV5 A;  830C A;  1O0Q A;  2WOA A;  4EFS A;  1BKC A;  4PKS A;  5BOT A;  3L0V A;  5D1S A;  4HMA A;  1RMZ A;  1BIW A;  3LK8 A;  1YCM A;  5D1T A;  2I47 A;  4L6T A;  2JT5 A;  2WO8 A;  1XFY A;  1XFZ A;  3L0T A;  1PWU A;  2DW1 A;  3DSL A;  4AXQ A;  4GWM A;  3ZVS A;  4R3V A;  4XBH A;  4J4M A;  1JH1 A;  4Q1L A;  3HYG A;  1BSW A;  1WNI A;  3HY7 A;  4AUO A;  1YOU A;  1G12 A;  1CGL A;  1PWP A;  1HTD A;  4JA1 A;  2HU6 A;  3TSK A;  4WZV A;  1I1I P;  1G49 A;  4IUW A;  4AIG A;  3EDI A;  4PKW A;  3N2U A;  4PKU A;  2MZI A;  2W15 A;  1KAP P;  1FBL A;  4XM8 A;  3DPE A;  1I73 A;  3DL1 A;  966C A;  2OW1 A;  1CXV A;  4FVL A;  3HBU P;  3LMC A;  3VI1 A;  2POJ A;  1QUA A;  3KEJ A;  1JAQ A;  5D2B A;  4ILW D;  1O0T A;  5L79 A;  3EDG A;  1HV5 A;  3G5C A;  1H71 P;  1OS2 A;  3EDZ A;  1ZS0 A;  2OXW A;  3F19 A;  4H30 A;  4AYK A;  2DW2 A;  1BZS A;  4WKI A;  2L0R A;  1JIW P;  1SAT A;  1G4K A;  4GR8 A;  4H82 A;  1KUG A;  1QIC A;  1D5J A;  1SMP A;  5B5O A;  1CK7 A;  3KME A;  5D3C A;  2DW0 A;  3WV3 A;  3WV2 A;  2ERQ A;  2YUF A;  3E8R A;  2O36 A;  2MLS A;  5CXA A;  4GF1 A;  4IJO A;  5CUH A;  4DPE A;  4H49 A;  3F15 A;  4G9L A;  4ON1 A;  1FM1 A;  2TCL A;  4L63 A;  3HDB A;  1HFC A;  2A8H A;  1MMQ A;  3EDH A;  2MLR A;  2DDY A;  5I4O A;  2D1N A;  2OVZ A;  1D8M A;  1XUD A;  1EUB A;  2XS3 A;  1R54 A;  1MNC A;  1HFS A;  4A3W A;  5JMY A;  5H8X A;  4XM6 A;  3ZXH A;  3LJZ A;  2JNP A;  1KBC A;  3KWV C;  3LUN A;  3OHO A;  3LKA A;  1PWW A;  1GE7 A;  1GKD A;  2KRJ A;  2OW9 A;  3DNG A;  1PWQ A;  1B3D A;  2W0D A;  2USN A;  3HB2 P;  3LJG A;  1JAO A;  5D7W A;  4G0D A;  1EB6 A;  4JIJ A;  1ZTQ A;  3LUM A;  1A86 A;  1UTT A;  3LQB A;  3EWJ A;  2X3B A;  2X3A A;  1MMR A;  4XM7 A;  1XUR A;  4H84 A;  3GBO A;  5L7F A;  2K2G A;  2YB9 A;  1ZP5 A;  2XS4 A;  3DTK A;  1KUH A;  4FXQ A;  4WF6 A;  2V4B A;  4DD8 A;  1BQO A;  2OI0 A;  1IAA A;  1A85 A;  4I35 A;  3V96 B;  1CAQ A;  3O2X A;  1KUK A;  2RJQ A;  2E2D A;  1BKC E;  3LIL A;  1Y93 A;  1UMS A;  1IAG A;  3TT4 A;  2WO9 A;  1G05 A;  1MMP A;  4WKE A;  4A7B A;  2O3E A;  1BQQ M;  2OY2 A;  3DTI A;  1K7I A;  2MZE A;  3B2Z A;  2OVX A;  1Q3A A;  1Y0V A;  1JIZ A;  3O64 A;  3AYK A;  3F18 A;  1D8F A;  1ZXV A;  1J7N A;  5BOY A;  3KEC A;  3LIR A;  2J83 A;  3RTS A;  3AIG A;  1IAD A;  2OY4 A;  3EHX A;  3HY9 A;  5I2Z A;  3LJT A;  4GR0 A;  3NX7 A;  1GE6 A;  3F17 A;  4GR3 A;  5I43 A;  1CGE A;  1QIB A;  1C8T A;  4HX3 A;  3KHI A;  2Z2D A;  3AYU A;  3TVC A;  4JP4 A;  3VTG A;  1KUF A;  1ATL A;  3RTT A;  3KRY A;  4H2E A;  5I0L A;  1K7G A;  4JPA A;  3TS4 A;  1GO7 P;  3SHI A;  3DPF A;  1OS9 A;  1Y8J A;  3LE9 A;  3I7I A;  2AIG P;  3LEA A;  1OMJ A;  1FLS A;  3Q2H A;  456C A;  1EAK A;  1QIA A;  2X7M A;  1R55 A;  2D1O A;  3I7G A;  2OW0 A;  3UVC A;  3HDA P;  2W12 A;  1IAE A;  1R1H A;  1QJJ A;  1BUV M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...