1UEAA

Mmp-3/timp-1 complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
168
structure length
168
Chain Sequence
b'FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLOPROTEINASE-3
publication title Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (metalloprotease/inhibitor)
total genus 43
structure length 168
sequence length 168
chains with identical sequence C
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1997-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1ueaA00
3B2ZA 1UMTA 2MZIA 4GF1A 1BUDA 1CAQA 1IAEA 2L0RA 1MMQA 4J4MA 4XM6A 1GO7P 2OW1A 4I03A 1A85A 2DDFA 4PKRA 1ZTQA 2K9CA 4DD8A 3LGPA 1Z3JA 5BPAA 1SLMA 1RMZA 1R55A 1Y0VA 4ZR5A 1EAKA 3LKAA 3HB2P 3ZVSA 1FM1A 2X3CA 3DSLA 5D1UA 5I4OA 1JAQA 4PKVA 1CGLA 2PJTA 1XFVA 3VTGA 1GKDA 1CK7A 3RTTA 4GR3A 1UMSA 2DW1A 4WKEA 1IACA 5CUHA 3I7GA 1R1IA 1KAPP 4HMAA 2MZEA 1PWUA 3EDHA 3O2XA 2O3EA 3Q2HA 1AYKA 1XFXA 3LE9A 456CA 2XS4A 2POJA 2HU6A 3LJGA 4AIGA 1MMRA 1YCMA 1G9KA 1K7GA 3UVCA 1BKCE 4PKQA 2J0TA 2RJPA 4WZVA 4H49A 2Y6DA 4IN9A 1D8MA 1R1JA 3ZUKA 4QKZA 1XFUA 3KHIA 1R1HA 3F17A 2X3AA 2YIGA 1YQYA 2OW9A 2A8HA 2I47A 3EHXA 2YB9A 4IUWA 4PKSA 1QJJA 2W0DA 1SLNA 1BKCA 1JANA 2AYKA 3LMCA 2V4BA 4L19A 1OM7A 4R3VA 3N2UA 1CQRA 4A7BA 5B5PA 5JMYA 4I35A 1PWVA 3Q2GA 2JT5A 3CKIA 1UTZA 2E2DA 1BIWA 3KEJA 3DWBA 4GQLA 3SHIA 1FLSA 2AIGP 3LQ0A 1JIWP 2EROA 3EHYA 1CIZA 1OO9A 3HY7A 4DPEA 4H82A 5I2ZA 1IABA 1JJ9A 5D2BA 1JAPA 3KEKA 2CLTA 3EDIA 3P24A 4XM7A 1K7QA 2FV5A 5D7WA 1OM8A 1HTDA 1I76A 4GR0A 1ZS0A 3KMEA 3ELMA 2OXWA 3TSKA 3MA2A 1O0TA 2D1OA 2DW2A 1S4BP 5I43A 4G0DA 4XM8A 1OM6A 3OHOA 2JIHA 2N8RA 1DTHA 2SRTA 4AUOA 2OW0A 1JK3A 4H30A 966CA 1UEAA 4JIJA 3LJZA 1KUGA 3EDGA 2QPJA 1ZXCA 3NX7A 4FXYP 2RJQA 5H8XA 1A86A 4H1QA 1MMPA 3EWJA 1GO8P 4ILWD 5BOTA 1QJIA 3VI1A 3V96B 1YOUA 3E8RA 5L79A 1ASTA 3K7LA 2K2GA 3LQBA 4PKTA 5D1SA 4PKUA 4FXQA 3HYGA 1ND1A 3LUNA 4WKIA 2OVZA 1J7NA 2CKIA 1EB6A 2W13A 1OS2A 3HDBA 3F18A 1B3DA 2TCLA 1ZP5A 3HDAP 1JIZA 3WV2A 1KUHA 4H2EA 1QIAA 3AIGA 1IADA 1XUCA 3TVCA 2MZHA 4H76A 4FVLA 1G05A 1EUBA 1SMPA 3BA0A 4PKWA 4JQGA 1MMBA 1JAOA 4DF9A 1GKCA 3F19A 2Y6CA 3N2VA 2DDYA 1ROSA 3LEAA 1RM8A 3LILA 5B5OA 3AYUA 1QUAA 4L63A 2E3XA 2JT6A 4JP4A 3KECA 3KMCA 3HY9A 5L7FA 4WK7A 1AF0A 2MLRA 2OW2A 1CGEA 3TT4A 1UTTA 4ON1A 2D1NA 3P1VA 2W14A 4HX3A 1C8TA 2X3BA 1QICA 2ERPA 1OS9A 2FV9A 3WV3A 1FBLA 1QIBA 3AYKA 1GE5A 1CGFA 5I12A 5I0LA 1GXDA 1GE6A 1KUFA 3L0TA 5D1TA 5LABA 2JNPA 3LJTA 1HY7A 1KUKA 4Q1LA 1GE7A 1WNIA 3LIRA 3DPFA 1JKYA 1ZXVA 1IAAA 2WO8A 4FU4A 3KWVC 1D7XA 1KUIA 3OHLA 3HBVP 1OMJA 3U1RA 4AYKA 5BOYA 3HBUP 3F15A 1BUVM 4A3WA 1DMTA 5D3CA 2OXZA 1C7KA 2ERQA 1BM6A 1Q3AA 1CXVA 2JSDA 1XUDA 5CZMA 1D8FA 3DNGA 1HOVA 3LK8A 4AXQA 5I3MA 1BZSA 4GWNA 1PWPA 1XFYA 4DV8A 3DL1A 4JPAA 1SATA 1G49A 1B8YA 4EFSA 2OVXA 4GUYA 1HV5A 2X7MA 1I1IP 3TS4A 1Y8JA 1C3IA 3F1AA 3WV1A 1BKCI 1BQOA 3LIKA 4XCTA 830CA 1K7IA 5CXAA 1ATLA 4GWMA 2W15A 3DPEA 2OZRA 1YP1A 2MLSA 4G9LA 4CTHA 2OY2A 1USNA 2KRJA 1L6JA 1I73A 3RTSA 3L0VA 1AKLA 1XFZA 2Z2DA 3G5CA 1XFWA 3KRYA 3USNA 2OXUA 4IJOA 1SU3A 1D5JA 3GBOA 3I7IA 1KBCA 1BSWA 4H84A 3G42A 4JA1A 2W12A 4GR8A 1JH1A 2DW0A 1MNCA 1PWWA 1G4KA 1HFCA 3B8ZA 2J83A 3B92A 3O64A 1HFSA 4WF6A 4XBHA 2OI0A 1IAGA 1XURA 2O36A 1Y93A 3EDZA 2OY4A 1O0QA 1SRPA 1H71P 2XS3A 3K7NA 1R54A 1G12A 3LUMA 4H3XA 3F16A 1PWQA 1BQQM 2WOAA 4L6TA 3ZXHA 2WO9A 1ZVXA 2USNA
chains in the Genus database with same CATH superfamily
3B2ZA 1UMTA 2MZIA 4GF1A 1BUDA 1CAQA 1IAEA 2L0RA 1MMQA 4J4MA 4XM6A 1GO7P 2OW1A 4I03A 1A85A 2DDFA 4PKRA 1ZTQA 2K9CA 4DD8A 3LGPA 1Z3JA 5BPAA 1SLMA 1RMZA 1XAXA 1R55A 1Y0VA 4ZR5A 1EAKA 3LKAA 1XM5A 3HB2P 3ZVSA 1FM1A 2X3CA 3DSLA 5D1UA 5I4OA 1JAQA 4PKVA 1CGLA 2PJTA 1XFVA 3VTGA 1GKDA 4L7AA 1CK7A 3RTTA 4GR3A 1UMSA 2DW1A 4WKEA 1IACA 5CUHA 3I7GA 1R1IA 1KAPP 4HMAA 2MZEA 1PWUA 3EDHA 3O2XA 2O3EA 3Q2HA 1AYKA 1OZ9A 1XFXA 3LE9A 456CA 2XS4A 2POJA 2HU6A 3LJGA 4AIGA 1MMRA 1YCMA 1G9KA 1K7GA 3UVCA 1BKCE 4PKQA 2J0TA 2RJPA 4WZVA 4H49A 2Y6DA 4IN9A 1D8MA 1R1JA 3ZUKA 4QKZA 1XFUA 3KHIA 1R1HA 3F17A 2X3AA 2YIGA 1YQYA 2OW9A 2A8HA 2I47A 3EHXA 2YB9A 4IUWA 4PKSA 1QJJA 2W0DA 1SLNA 1BKCA 1JANA 2AYKA 3LMCA 2V4BA 4L19A 1OM7A 4R3VA 3N2UA 1CQRA 4A7BA 5B5PA 5JMYA 4I35A 1PWVA 3Q2GA 2JT5A 3CKIA 1UTZA 2E2DA 1BIWA 3KEJA 3DWBA 4GQLA 3SHIA 1FLSA 2AIGP 3LQ0A 1JIWP 2EROA 3EHYA 1CIZA 1OO9A 3HY7A 4DPEA 4H82A 5I2ZA 1IABA 1JJ9A 5D2BA 1JAPA 3KEKA 2CLTA 3EDIA 3P24A 4XM7A 1K7QA 2FV5A 5D7WA 1OM8A 1HTDA 1I76A 4GR0A 1ZS0A 3KMEA 3ELMA 2OXWA 3TSKA 3MA2A 1O0TA 2D1OA 2DW2A 1S4BP 5I43A 4G0DA 4XM8A 1OM6A 3OHOA 2JIHA 2N8RA 1DTHA 2SRTA 4AUOA 2OW0A 1JK3A 4H30A 966CA 1UEAA 4JIJA 3LJZA 1KUGA 3EDGA 2QPJA 1ZXCA 3NX7A 4FXYP 2RJQA 5H8XA 1A86A 4H1QA 1MMPA 3EWJA 1GO8P 4ILWD 5BOTA 1QJIA 3VI1A 3V96B 1YOUA 3E8RA 5L79A 1ASTA 3K7LA 1TVIA 2K2GA 3LQBA 4PKTA 5D1SA 4PKUA 4FXQA 3HYGA 1ND1A 3LUNA 4WKIA 2OVZA 1J7NA 2CKIA 1EB6A 2W13A 1OS2A 3HDBA 3F18A 1B3DA 2TCLA 1ZP5A 3HDAP 1JIZA 3WV2A 1KUHA 4H2EA 1QIAA 3AIGA 1IADA 1XUCA 3TVCA 2MZHA 4H76A 4FVLA 1G05A 1EUBA 1SMPA 3BA0A 4PKWA 4JQGA 1MMBA 1JAOA 4DF9A 1GKCA 3F19A 2Y6CA 3N2VA 2DDYA 1ROSA 3LEAA 1RM8A 3LILA 5B5OA 3AYUA 1QUAA 4L63A 2E3XA 2JT6A 4JP4A 3KECA 3KMCA 3HY9A 5L7FA 4WK7A 1AF0A 2MLRA 2OW2A 1CGEA 3TT4A 1UTTA 4ON1A 2D1NA 3P1VA 2W14A 4HX3A 1C8TA 2X3BA 1QICA 2ERPA 1OS9A 2FV9A 3WV3A 1FBLA 1QIBA 3AYKA 1GE5A 1CGFA 5I12A 5I0LA 1GXDA 1GE6A 1KUFA 3L0TA 5D1TA 5LABA 2JNPA 3LJTA 1HY7A 1KUKA 4Q1LA 1GE7A 1WNIA 3DTKA 3LIRA 3DPFA 1JKYA 1ZXVA 1IAAA 2WO8A 4FU4A 3KWVC 1D7XA 1KUIA 3OHLA 3HBVP 1OMJA 3U1RA 4AYKA 5BOYA 3HBUP 3F15A 1BUVM 4A3WA 1DMTA 5D3CA 2OXZA 1C7KA 2ERQA 1BM6A 1Q3AA 1CXVA 2JSDA 1XUDA 5CZMA 1D8FA 3DNGA 1HOVA 2YUFA 3LK8A 4AXQA 5I3MA 1BZSA 4GWNA 1PWPA 1XFYA 4DV8A 3DL1A 3DTIA 4JPAA 1SATA 1G49A 1B8YA 4EFSA 2OVXA 4GUYA 1HV5A 2X7MA 1I1IP 3TS4A 1Y8JA 1C3IA 3F1AA 3WV1A 3LIKA 1BKCI 1BQOA 4XCTA 830CA 3DTEA 1K7IA 5CXAA 1ATLA 4GWMA 2W15A 3DPEA 2OZRA 1YP1A 2MLSA 4G9LA 4CTHA 2OY2A 1USNA 2KRJA 1L6JA 1I73A 3RTSA 3L0VA 1AKLA 1XFZA 2Z2DA 3G5CA 1XFWA 3KRYA 3USNA 2OXUA 4IJOA 1SU3A 1D5JA 3GBOA 3I7IA 1KBCA 1BSWA 4H84A 3G42A 4JA1A 2W12A 4GR8A 1JH1A 2DW0A 1MNCA 1PWWA 1G4KA 1HFCA 3B8ZA 2J83A 3B92A 3O64A 1HFSA 4WF6A 4XBHA 2OI0A 1IAGA 1XURA 2O36A 1Y93A 3EDZA 2OY4A 1O0QA 1SRPA 1H71P 2XS3A 3K7NA 1R54A 1G12A 3LUMA 4H3XA 3F16A 1PWQA 1BQQM 2WOAA 4L6TA 3ZXHA 2WO9A 1ZVXA 2USNA
chains in the Genus database with same CATH topology
3B2ZA 1UMTA 2MZIA 4GF1A 1BUDA 1CAQA 1IAEA 2L0RA 1MMQA 4J4MA 4XM6A 1GO7P 2OW1A 4I03A 1A85A 2DDFA 4PKRA 1ZTQA 2K9CA 4DD8A 3LGPA 1Z3JA 5BPAA 1SLMA 1RMZA 1R55A 1Y0VA 4ZR5A 1EAKA 3LKAA 3HB2P 3ZVSA 1FM1A 2X3CA 3DSLA 5D1UA 5I4OA 1JAQA 4PKVA 1CGLA 2PJTA 1XFVA 3VTGA 1GKDA 4L7AA 1CK7A 3RTTA 4GR3A 1UMSA 2DW1A 4WKEA 1IACA 5CUHA 3I7GA 1R1IA 1KAPP 4HMAA 2MZEA 1PWUA 3EDHA 3O2XA 2O3EA 3Q2HA 1AYKA 1XFXA 3LE9A 456CA 2XS4A 2POJA 2HU6A 3LJGA 4AIGA 1MMRA 1YCMA 1G9KA 1K7GA 3UVCA 1BKCE 4PKQA 2J0TA 2RJPA 4WZVA 4H49A 2Y6DA 4IN9A 1D8MA 1R1JA 3ZUKA 4QKZA 1XFUA 3KHIA 1R1HA 3F17A 2X3AA 2YIGA 1YQYA 2OW9A 2A8HA 2I47A 3EHXA 2YB9A 4IUWA 4PKSA 1QJJA 2W0DA 1SLNA 1BKCA 1JANA 2AYKA 3LMCA 2V4BA 4L19A 1OM7A 4R3VA 3N2UA 1CQRA 4A7BA 5B5PA 5JMYA 4I35A 1PWVA 3Q2GA 2JT5A 3CKIA 1UTZA 2E2DA 1BIWA 3KEJA 3DWBA 4GQLA 3SHIA 1FLSA 2AIGP 3LQ0A 1JIWP 2EROA 3EHYA 1CIZA 1OO9A 3HY7A 4DPEA 4H82A 5I2ZA 1IABA 1JJ9A 5D2BA 1JAPA 3KEKA 2CLTA 3EDIA 3P24A 4XM7A 1K7QA 2FV5A 5D7WA 1OM8A 1HTDA 1I76A 4GR0A 1ZS0A 3KMEA 3ELMA 2OXWA 3TSKA 3MA2A 1O0TA 2D1OA 2DW2A 1S4BP 5I43A 4G0DA 4XM8A 1OM6A 3OHOA 2JIHA 2N8RA 1DTHA 2SRTA 4AUOA 2OW0A 1JK3A 4H30A 966CA 1UEAA 4JIJA 3LJZA 1KUGA 3EDGA 2QPJA 1ZXCA 3NX7A 4FXYP 2RJQA 5H8XA 1A86A 4H1QA 1MMPA 3EWJA 1GO8P 4ILWD 5BOTA 1QJIA 3VI1A 3V96B 1YOUA 3E8RA 5L79A 1ASTA 3K7LA 2K2GA 3LQBA 4PKTA 5D1SA 4PKUA 4FXQA 3HYGA 1ND1A 3LUNA 4WKIA 2OVZA 1J7NA 2CKIA 1EB6A 2W13A 1OS2A 3HDBA 3F18A 1B3DA 2TCLA 1ZP5A 3HDAP 1JIZA 3WV2A 1KUHA 4H2EA 1QIAA 3AIGA 1IADA 1XUCA 3TVCA 2MZHA 4H76A 4FVLA 1G05A 1EUBA 1SMPA 3BA0A 4PKWA 4JQGA 1MMBA 1JAOA 4DF9A 1GKCA 3F19A 2Y6CA 3N2VA 2DDYA 1ROSA 3LEAA 1RM8A 3LILA 5B5OA 3AYUA 1QUAA 4L63A 2E3XA 2JT6A 4JP4A 3KECA 3KMCA 3HY9A 5L7FA 4WK7A 1AF0A 2MLRA 2OW2A 1CGEA 3TT4A 1UTTA 4ON1A 2D1NA 3P1VA 2W14A 4HX3A 1C8TA 2X3BA 1QICA 2ERPA 1OS9A 2FV9A 3WV3A 1FBLA 1QIBA 3AYKA 1GE5A 1CGFA 5I12A 5I0LA 1GXDA 1GE6A 1KUFA 3L0TA 5D1TA 5LABA 2JNPA 3LJTA 1HY7A 1KUKA 4Q1LA 1GE7A 1WNIA 3DTKA 3LIRA 3DPFA 1JKYA 1ZXVA 1IAAA 2WO8A 4FU4A 3KWVC 1D7XA 1KUIA 3OHLA 3HBVP 1OMJA 3U1RA 4AYKA 5BOYA 3HBUP 3F15A 1BUVM 4A3WA 1DMTA 5D3CA 2OXZA 1C7KA 2ERQA 1BM6A 1Q3AA 1CXVA 2JSDA 1XUDA 5CZMA 1D8FA 3DNGA 1HOVA 2YUFA 3LK8A 4AXQA 5I3MA 1BZSA 4GWNA 1PWPA 1XFYA 4DV8A 3DL1A 3DTIA 4JPAA 1SATA 1G49A 1B8YA 4EFSA 2OVXA 4GUYA 1HV5A 2X7MA 1I1IP 3TS4A 1Y8JA 1C3IA 3F1AA 3WV1A 1BKCI 1BQOA 3LIKA 4XCTA 830CA 3DTEA 1K7IA 5CXAA 1ATLA 4GWMA 2W15A 3DPEA 2OZRA 1YP1A 2MLSA 4G9LA 4CTHA 2OY2A 1USNA 2KRJA 1L6JA 1I73A 3RTSA 3L0VA 1AKLA 1XFZA 2Z2DA 3G5CA 1XFWA 3KRYA 3USNA 2OXUA 4IJOA 1SU3A 1D5JA 3GBOA 3I7IA 1KBCA 1BSWA 4H84A 3G42A 4JA1A 2W12A 4GR8A 1JH1A 2DW0A 1MNCA 1PWWA 1G4KA 1HFCA 3B8ZA 2J83A 3B92A 3O64A 1HFSA 4WF6A 4XBHA 2OI0A 1IAGA 1XURA 2O36A 1Y93A 3EDZA 2OY4A 1O0QA 1SRPA 1H71P 2XS3A 3K7NA 1R54A 1G12A 3LUMA 4H3XA 3F16A 1PWQA 1BQQM 2WOAA 4L6TA 3ZXHA 2WO9A 1ZVXA 2USNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2Z A;  1UMT A;  2MZI A;  4GF1 A;  1BUD A;  1CAQ A;  1IAE A;  2L0R A;  1MMQ A;  4J4M A;  4XM6 A;  1GO7 P;  2OW1 A;  4I03 A;  1A85 A;  2DDF A;  4PKR A;  1ZTQ A;  2K9C A;  4DD8 A;  3LGP A;  1Z3J A;  5BPA A;  1SLM A;  1RMZ A;  1R55 A;  1Y0V A;  4ZR5 A;  1EAK A;  3LKA A;  3HB2 P;  3ZVS A;  1FM1 A;  2X3C A;  3DSL A;  5D1U A;  5I4O A;  1JAQ A;  4PKV A;  1CGL A;  2PJT A;  1XFV A;  3VTG A;  1GKD A;  1CK7 A;  3RTT A;  4GR3 A;  1UMS A;  2DW1 A;  4WKE A;  1IAC A;  5CUH A;  3I7G A;  1R1I A;  1KAP P;  4HMA A;  2MZE A;  1PWU A;  3EDH A;  3O2X A;  2O3E A;  3Q2H A;  1AYK A;  1XFX A;  3LE9 A;  456C A;  2XS4 A;  2POJ A;  2HU6 A;  3LJG A;  4AIG A;  1MMR A;  1YCM A;  1G9K A;  1K7G A;  3UVC A;  1BKC E;  4PKQ A;  2J0T A;  2RJP A;  4WZV A;  4H49 A;  2Y6D A;  4IN9 A;  1D8M A;  1R1J A;  3ZUK A;  4QKZ A;  1XFU A;  3KHI A;  1R1H A;  3F17 A;  2X3A A;  2YIG A;  1YQY A;  2OW9 A;  2A8H A;  2I47 A;  3EHX A;  2YB9 A;  4IUW A;  4PKS A;  1QJJ A;  2W0D A;  1SLN A;  1BKC A;  1JAN A;  2AYK A;  3LMC A;  2V4B A;  4L19 A;  1OM7 A;  4R3V A;  3N2U A;  1CQR A;  4A7B A;  5B5P A;  5JMY A;  4I35 A;  1PWV A;  3Q2G A;  2JT5 A;  3CKI A;  1UTZ A;  2E2D A;  1BIW A;  3KEJ A;  3DWB A;  4GQL A;  3SHI A;  1FLS A;  2AIG P;  3LQ0 A;  1JIW P;  2ERO A;  3EHY A;  1CIZ A;  1OO9 A;  3HY7 A;  4DPE A;  4H82 A;  5I2Z A;  1IAB A;  1JJ9 A;  5D2B A;  1JAP A;  3KEK A;  2CLT A;  3EDI A;  3P24 A;  4XM7 A;  1K7Q A;  2FV5 A;  5D7W A;  1OM8 A;  1HTD A;  1I76 A;  4GR0 A;  1ZS0 A;  3KME A;  3ELM A;  2OXW A;  3TSK A;  3MA2 A;  1O0T A;  2D1O A;  2DW2 A;  1S4B P;  5I43 A;  4G0D A;  4XM8 A;  1OM6 A;  3OHO A;  2JIH A;  2N8R A;  1DTH A;  2SRT A;  4AUO A;  2OW0 A;  1JK3 A;  4H30 A;  966C A;  1UEA A;  4JIJ A;  3LJZ A;  1KUG A;  3EDG A;  2QPJ A;  1ZXC A;  3NX7 A;  4FXY P;  2RJQ A;  5H8X A;  1A86 A;  4H1Q A;  1MMP A;  3EWJ A;  1GO8 P;  4ILW D;  5BOT A;  1QJI A;  3VI1 A;  3V96 B;  1YOU A;  3E8R A;  5L79 A;  1AST A;  3K7L A;  2K2G A;  3LQB A;  4PKT A;  5D1S A;  4PKU A;  4FXQ A;  3HYG A;  1ND1 A;  3LUN A;  4WKI A;  2OVZ A;  1J7N A;  2CKI A;  1EB6 A;  2W13 A;  1OS2 A;  3HDB A;  3F18 A;  1B3D A;  2TCL A;  1ZP5 A;  3HDA P;  1JIZ A;  3WV2 A;  1KUH A;  4H2E A;  1QIA A;  3AIG A;  1IAD A;  1XUC A;  3TVC A;  2MZH A;  4H76 A;  4FVL A;  1G05 A;  1EUB A;  1SMP A;  3BA0 A;  4PKW A;  4JQG A;  1MMB A;  1JAO A;  4DF9 A;  1GKC A;  3F19 A;  2Y6C A;  3N2V A;  2DDY A;  1ROS A;  3LEA A;  1RM8 A;  3LIL A;  5B5O A;  3AYU A;  1QUA A;  4L63 A;  2E3X A;  2JT6 A;  4JP4 A;  3KEC A;  3KMC A;  3HY9 A;  5L7F A;  4WK7 A;  1AF0 A;  2MLR A;  2OW2 A;  1CGE A;  3TT4 A;  1UTT A;  4ON1 A;  2D1N A;  3P1V A;  2W14 A;  4HX3 A;  1C8T A;  2X3B A;  1QIC A;  2ERP A;  1OS9 A;  2FV9 A;  3WV3 A;  1FBL A;  1QIB A;  3AYK A;  1GE5 A;  1CGF A;  5I12 A;  5I0L A;  1GXD A;  1GE6 A;  1KUF A;  3L0T A;  5D1T A;  5LAB A;  2JNP A;  3LJT A;  1HY7 A;  1KUK A;  4Q1L A;  1GE7 A;  1WNI A;  3LIR A;  3DPF A;  1JKY A;  1ZXV A;  1IAA A;  2WO8 A;  4FU4 A;  3KWV C;  1D7X A;  1KUI A;  3OHL A;  3HBV P;  1OMJ A;  3U1R A;  4AYK A;  5BOY A;  3HBU P;  3F15 A;  1BUV M;  4A3W A;  1DMT A;  5D3C A;  2OXZ A;  1C7K A;  2ERQ A;  1BM6 A;  1Q3A A;  1CXV A;  2JSD A;  1XUD A;  5CZM A;  1D8F A;  3DNG A;  1HOV A;  3LK8 A;  4AXQ A;  5I3M A;  1BZS A;  4GWN A;  1PWP A;  1XFY A;  4DV8 A;  3DL1 A;  4JPA A;  1SAT A;  1G49 A;  1B8Y A;  4EFS A;  2OVX A;  4GUY A;  1HV5 A;  2X7M A;  1I1I P;  3TS4 A;  1Y8J A;  1C3I A;  3F1A A;  3WV1 A;  1BKC I;  1BQO A;  3LIK A;  4XCT A;  830C A;  1K7I A;  5CXA A;  1ATL A;  4GWM A;  2W15 A;  3DPE A;  2OZR A;  1YP1 A;  2MLS A;  4G9L A;  4CTH A;  2OY2 A;  1USN A;  2KRJ A;  1L6J A;  1I73 A;  3RTS A;  3L0V A;  1AKL A;  1XFZ A;  2Z2D A;  3G5C A;  1XFW A;  3KRY A;  3USN A;  2OXU A;  4IJO A;  1SU3 A;  1D5J A;  3GBO A;  3I7I A;  1KBC A;  1BSW A;  4H84 A;  3G42 A;  4JA1 A;  2W12 A;  4GR8 A;  1JH1 A;  2DW0 A;  1MNC A;  1PWW A;  1G4K A;  1HFC A;  3B8Z A;  2J83 A;  3B92 A;  3O64 A;  1HFS A;  4WF6 A;  4XBH A;  2OI0 A;  1IAG A;  1XUR A;  2O36 A;  1Y93 A;  3EDZ A;  2OY4 A;  1O0Q A;  1SRP A;  1H71 P;  2XS3 A;  3K7N A;  1R54 A;  1G12 A;  3LUM A;  4H3X A;  3F16 A;  1PWQ A;  1BQQ M;  2WOA A;  4L6T A;  3ZXH A;  2WO9 A;  1ZVX A;  2USN A; 
#chains in the Genus database with same CATH topology
 3B2Z A;  1UMT A;  2MZI A;  4GF1 A;  1BUD A;  1CAQ A;  1IAE A;  2L0R A;  1MMQ A;  4J4M A;  4XM6 A;  1GO7 P;  2OW1 A;  4I03 A;  1A85 A;  2DDF A;  4PKR A;  1ZTQ A;  2K9C A;  4DD8 A;  3LGP A;  1Z3J A;  5BPA A;  1SLM A;  1RMZ A;  1XAX A;  1R55 A;  1Y0V A;  4ZR5 A;  1EAK A;  3LKA A;  1XM5 A;  3HB2 P;  3ZVS A;  1FM1 A;  2X3C A;  3DSL A;  5D1U A;  5I4O A;  1JAQ A;  4PKV A;  1CGL A;  2PJT A;  1XFV A;  3VTG A;  1GKD A;  4L7A A;  1CK7 A;  3RTT A;  4GR3 A;  1UMS A;  2DW1 A;  4WKE A;  1IAC A;  5CUH A;  3I7G A;  1R1I A;  1KAP P;  4HMA A;  2MZE A;  1PWU A;  3EDH A;  3O2X A;  2O3E A;  3Q2H A;  1AYK A;  1OZ9 A;  1XFX A;  3LE9 A;  456C A;  2XS4 A;  2POJ A;  2HU6 A;  3LJG A;  4AIG A;  1MMR A;  1YCM A;  1G9K A;  1K7G A;  3UVC A;  1BKC E;  4PKQ A;  2J0T A;  2RJP A;  4WZV A;  4H49 A;  2Y6D A;  4IN9 A;  1D8M A;  1R1J A;  3ZUK A;  4QKZ A;  1XFU A;  3KHI A;  1R1H A;  3F17 A;  2X3A A;  2YIG A;  1YQY A;  2OW9 A;  2A8H A;  2I47 A;  3EHX A;  2YB9 A;  4IUW A;  4PKS A;  1QJJ A;  2W0D A;  1SLN A;  1BKC A;  1JAN A;  2AYK A;  3LMC A;  2V4B A;  4L19 A;  1OM7 A;  4R3V A;  3N2U A;  1CQR A;  4A7B A;  5B5P A;  5JMY A;  4I35 A;  1PWV A;  3Q2G A;  2JT5 A;  3CKI A;  1UTZ A;  2E2D A;  1BIW A;  3KEJ A;  3DWB A;  4GQL A;  3SHI A;  1FLS A;  2AIG P;  3LQ0 A;  1JIW P;  2ERO A;  3EHY A;  1CIZ A;  1OO9 A;  3HY7 A;  4DPE A;  4H82 A;  5I2Z A;  1IAB A;  1JJ9 A;  5D2B A;  1JAP A;  3KEK A;  2CLT A;  3EDI A;  3P24 A;  4XM7 A;  1K7Q A;  2FV5 A;  5D7W A;  1OM8 A;  1HTD A;  1I76 A;  4GR0 A;  1ZS0 A;  3KME A;  3ELM A;  2OXW A;  3TSK A;  3MA2 A;  1O0T A;  2D1O A;  2DW2 A;  1S4B P;  5I43 A;  4G0D A;  4XM8 A;  1OM6 A;  3OHO A;  2JIH A;  2N8R A;  1DTH A;  2SRT A;  4AUO A;  2OW0 A;  1JK3 A;  4H30 A;  966C A;  1UEA A;  4JIJ A;  3LJZ A;  1KUG A;  3EDG A;  2QPJ A;  1ZXC A;  3NX7 A;  4FXY P;  2RJQ A;  5H8X A;  1A86 A;  4H1Q A;  1MMP A;  3EWJ A;  1GO8 P;  4ILW D;  5BOT A;  1QJI A;  3VI1 A;  3V96 B;  1YOU A;  3E8R A;  5L79 A;  1AST A;  3K7L A;  1TVI A;  2K2G A;  3LQB A;  4PKT A;  5D1S A;  4PKU A;  4FXQ A;  3HYG A;  1ND1 A;  3LUN A;  4WKI A;  2OVZ A;  1J7N A;  2CKI A;  1EB6 A;  2W13 A;  1OS2 A;  3HDB A;  3F18 A;  1B3D A;  2TCL A;  1ZP5 A;  3HDA P;  1JIZ A;  3WV2 A;  1KUH A;  4H2E A;  1QIA A;  3AIG A;  1IAD A;  1XUC A;  3TVC A;  2MZH A;  4H76 A;  4FVL A;  1G05 A;  1EUB A;  1SMP A;  3BA0 A;  4PKW A;  4JQG A;  1MMB A;  1JAO A;  4DF9 A;  1GKC A;  3F19 A;  2Y6C A;  3N2V A;  2DDY A;  1ROS A;  3LEA A;  1RM8 A;  3LIL A;  5B5O A;  3AYU A;  1QUA A;  4L63 A;  2E3X A;  2JT6 A;  4JP4 A;  3KEC A;  3KMC A;  3HY9 A;  5L7F A;  4WK7 A;  1AF0 A;  2MLR A;  2OW2 A;  1CGE A;  3TT4 A;  1UTT A;  4ON1 A;  2D1N A;  3P1V A;  2W14 A;  4HX3 A;  1C8T A;  2X3B A;  1QIC A;  2ERP A;  1OS9 A;  2FV9 A;  3WV3 A;  1FBL A;  1QIB A;  3AYK A;  1GE5 A;  1CGF A;  5I12 A;  5I0L A;  1GXD A;  1GE6 A;  1KUF A;  3L0T A;  5D1T A;  5LAB A;  2JNP A;  3LJT A;  1HY7 A;  1KUK A;  4Q1L A;  1GE7 A;  1WNI A;  3DTK A;  3LIR A;  3DPF A;  1JKY A;  1ZXV A;  1IAA A;  2WO8 A;  4FU4 A;  3KWV C;  1D7X A;  1KUI A;  3OHL A;  3HBV P;  1OMJ A;  3U1R A;  4AYK A;  5BOY A;  3HBU P;  3F15 A;  1BUV M;  4A3W A;  1DMT A;  5D3C A;  2OXZ A;  1C7K A;  2ERQ A;  1BM6 A;  1Q3A A;  1CXV A;  2JSD A;  1XUD A;  5CZM A;  1D8F A;  3DNG A;  1HOV A;  2YUF A;  3LK8 A;  4AXQ A;  5I3M A;  1BZS A;  4GWN A;  1PWP A;  1XFY A;  4DV8 A;  3DL1 A;  3DTI A;  4JPA A;  1SAT A;  1G49 A;  1B8Y A;  4EFS A;  2OVX A;  4GUY A;  1HV5 A;  2X7M A;  1I1I P;  3TS4 A;  1Y8J A;  1C3I A;  3F1A A;  3WV1 A;  3LIK A;  1BKC I;  1BQO A;  4XCT A;  830C A;  3DTE A;  1K7I A;  5CXA A;  1ATL A;  4GWM A;  2W15 A;  3DPE A;  2OZR A;  1YP1 A;  2MLS A;  4G9L A;  4CTH A;  2OY2 A;  1USN A;  2KRJ A;  1L6J A;  1I73 A;  3RTS A;  3L0V A;  1AKL A;  1XFZ A;  2Z2D A;  3G5C A;  1XFW A;  3KRY A;  3USN A;  2OXU A;  4IJO A;  1SU3 A;  1D5J A;  3GBO A;  3I7I A;  1KBC A;  1BSW A;  4H84 A;  3G42 A;  4JA1 A;  2W12 A;  4GR8 A;  1JH1 A;  2DW0 A;  1MNC A;  1PWW A;  1G4K A;  1HFC A;  3B8Z A;  2J83 A;  3B92 A;  3O64 A;  1HFS A;  4WF6 A;  4XBH A;  2OI0 A;  1IAG A;  1XUR A;  2O36 A;  1Y93 A;  3EDZ A;  2OY4 A;  1O0Q A;  1SRP A;  1H71 P;  2XS3 A;  3K7N A;  1R54 A;  1G12 A;  3LUM A;  4H3X A;  3F16 A;  1PWQ A;  1BQQ M;  2WOA A;  4L6T A;  3ZXH A;  2WO9 A;  1ZVX A;  2USN A; 
#chains in the Genus database with same CATH homology
 3B2Z A;  1UMT A;  2MZI A;  4GF1 A;  1BUD A;  1CAQ A;  1IAE A;  2L0R A;  1MMQ A;  4J4M A;  4XM6 A;  1GO7 P;  2OW1 A;  4I03 A;  1A85 A;  2DDF A;  4PKR A;  1ZTQ A;  2K9C A;  4DD8 A;  3LGP A;  1Z3J A;  5BPA A;  1SLM A;  1RMZ A;  1R55 A;  1Y0V A;  4ZR5 A;  1EAK A;  3LKA A;  3HB2 P;  3ZVS A;  1FM1 A;  2X3C A;  3DSL A;  5D1U A;  5I4O A;  1JAQ A;  4PKV A;  1CGL A;  2PJT A;  1XFV A;  3VTG A;  1GKD A;  4L7A A;  1CK7 A;  3RTT A;  4GR3 A;  1UMS A;  2DW1 A;  4WKE A;  1IAC A;  5CUH A;  3I7G A;  1R1I A;  1KAP P;  4HMA A;  2MZE A;  1PWU A;  3EDH A;  3O2X A;  2O3E A;  3Q2H A;  1AYK A;  1XFX A;  3LE9 A;  456C A;  2XS4 A;  2POJ A;  2HU6 A;  3LJG A;  4AIG A;  1MMR A;  1YCM A;  1G9K A;  1K7G A;  3UVC A;  1BKC E;  4PKQ A;  2J0T A;  2RJP A;  4WZV A;  4H49 A;  2Y6D A;  4IN9 A;  1D8M A;  1R1J A;  3ZUK A;  4QKZ A;  1XFU A;  3KHI A;  1R1H A;  3F17 A;  2X3A A;  2YIG A;  1YQY A;  2OW9 A;  2A8H A;  2I47 A;  3EHX A;  2YB9 A;  4IUW A;  4PKS A;  1QJJ A;  2W0D A;  1SLN A;  1BKC A;  1JAN A;  2AYK A;  3LMC A;  2V4B A;  4L19 A;  1OM7 A;  4R3V A;  3N2U A;  1CQR A;  4A7B A;  5B5P A;  5JMY A;  4I35 A;  1PWV A;  3Q2G A;  2JT5 A;  3CKI A;  1UTZ A;  2E2D A;  1BIW A;  3KEJ A;  3DWB A;  4GQL A;  3SHI A;  1FLS A;  2AIG P;  3LQ0 A;  1JIW P;  2ERO A;  3EHY A;  1CIZ A;  1OO9 A;  3HY7 A;  4DPE A;  4H82 A;  5I2Z A;  1IAB A;  1JJ9 A;  5D2B A;  1JAP A;  3KEK A;  2CLT A;  3EDI A;  3P24 A;  4XM7 A;  1K7Q A;  2FV5 A;  5D7W A;  1OM8 A;  1HTD A;  1I76 A;  4GR0 A;  1ZS0 A;  3KME A;  3ELM A;  2OXW A;  3TSK A;  3MA2 A;  1O0T A;  2D1O A;  2DW2 A;  1S4B P;  5I43 A;  4G0D A;  4XM8 A;  1OM6 A;  3OHO A;  2JIH A;  2N8R A;  1DTH A;  2SRT A;  4AUO A;  2OW0 A;  1JK3 A;  4H30 A;  966C A;  1UEA A;  4JIJ A;  3LJZ A;  1KUG A;  3EDG A;  2QPJ A;  1ZXC A;  3NX7 A;  4FXY P;  2RJQ A;  5H8X A;  1A86 A;  4H1Q A;  1MMP A;  3EWJ A;  1GO8 P;  4ILW D;  5BOT A;  1QJI A;  3VI1 A;  3V96 B;  1YOU A;  3E8R A;  5L79 A;  1AST A;  3K7L A;  2K2G A;  3LQB A;  4PKT A;  5D1S A;  4PKU A;  4FXQ A;  3HYG A;  1ND1 A;  3LUN A;  4WKI A;  2OVZ A;  1J7N A;  2CKI A;  1EB6 A;  2W13 A;  1OS2 A;  3HDB A;  3F18 A;  1B3D A;  2TCL A;  1ZP5 A;  3HDA P;  1JIZ A;  3WV2 A;  1KUH A;  4H2E A;  1QIA A;  3AIG A;  1IAD A;  1XUC A;  3TVC A;  2MZH A;  4H76 A;  4FVL A;  1G05 A;  1EUB A;  1SMP A;  3BA0 A;  4PKW A;  4JQG A;  1MMB A;  1JAO A;  4DF9 A;  1GKC A;  3F19 A;  2Y6C A;  3N2V A;  2DDY A;  1ROS A;  3LEA A;  1RM8 A;  3LIL A;  5B5O A;  3AYU A;  1QUA A;  4L63 A;  2E3X A;  2JT6 A;  4JP4 A;  3KEC A;  3KMC A;  3HY9 A;  5L7F A;  4WK7 A;  1AF0 A;  2MLR A;  2OW2 A;  1CGE A;  3TT4 A;  1UTT A;  4ON1 A;  2D1N A;  3P1V A;  2W14 A;  4HX3 A;  1C8T A;  2X3B A;  1QIC A;  2ERP A;  1OS9 A;  2FV9 A;  3WV3 A;  1FBL A;  1QIB A;  3AYK A;  1GE5 A;  1CGF A;  5I12 A;  5I0L A;  1GXD A;  1GE6 A;  1KUF A;  3L0T A;  5D1T A;  5LAB A;  2JNP A;  3LJT A;  1HY7 A;  1KUK A;  4Q1L A;  1GE7 A;  1WNI A;  3DTK A;  3LIR A;  3DPF A;  1JKY A;  1ZXV A;  1IAA A;  2WO8 A;  4FU4 A;  3KWV C;  1D7X A;  1KUI A;  3OHL A;  3HBV P;  1OMJ A;  3U1R A;  4AYK A;  5BOY A;  3HBU P;  3F15 A;  1BUV M;  4A3W A;  1DMT A;  5D3C A;  2OXZ A;  1C7K A;  2ERQ A;  1BM6 A;  1Q3A A;  1CXV A;  2JSD A;  1XUD A;  5CZM A;  1D8F A;  3DNG A;  1HOV A;  2YUF A;  3LK8 A;  4AXQ A;  5I3M A;  1BZS A;  4GWN A;  1PWP A;  1XFY A;  4DV8 A;  3DL1 A;  3DTI A;  4JPA A;  1SAT A;  1G49 A;  1B8Y A;  4EFS A;  2OVX A;  4GUY A;  1HV5 A;  2X7M A;  1I1I P;  3TS4 A;  1Y8J A;  1C3I A;  3F1A A;  3WV1 A;  1BKC I;  1BQO A;  3LIK A;  4XCT A;  830C A;  3DTE A;  1K7I A;  5CXA A;  1ATL A;  4GWM A;  2W15 A;  3DPE A;  2OZR A;  1YP1 A;  2MLS A;  4G9L A;  4CTH A;  2OY2 A;  1USN A;  2KRJ A;  1L6J A;  1I73 A;  3RTS A;  3L0V A;  1AKL A;  1XFZ A;  2Z2D A;  3G5C A;  1XFW A;  3KRY A;  3USN A;  2OXU A;  4IJO A;  1SU3 A;  1D5J A;  3GBO A;  3I7I A;  1KBC A;  1BSW A;  4H84 A;  3G42 A;  4JA1 A;  2W12 A;  4GR8 A;  1JH1 A;  2DW0 A;  1MNC A;  1PWW A;  1G4K A;  1HFC A;  3B8Z A;  2J83 A;  3B92 A;  3O64 A;  1HFS A;  4WF6 A;  4XBH A;  2OI0 A;  1IAG A;  1XUR A;  2O36 A;  1Y93 A;  3EDZ A;  2OY4 A;  1O0Q A;  1SRP A;  1H71 P;  2XS3 A;  3K7N A;  1R54 A;  1G12 A;  3LUM A;  4H3X A;  3F16 A;  1PWQ A;  1BQQ M;  2WOA A;  4L6T A;  3ZXH A;  2WO9 A;  1ZVX A;  2USN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...