1UEAA

Mmp-3/timp-1 complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
168
structure length
168
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (metalloprotease/inhibitor)
molecule keywords MATRIX METALLOPROTEINASE-3
publication title Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 168
sequence length 168
chains with identical sequence C
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1997-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1ueaA00
1OMJA 1MMQA 4GQLA 1SLMA 2WO8A 1FM1A 5BOTA 1ZXCA 1AKLA 3LQ0A 3ZVSA 1BQOA 3F1AA 1BIWA 4H30A 1QIBA 1R1HA 3SHIA 1B8YA 3AYUA 2DW0A 3EHYA 3OHLA 1YOUA 3HYGA 4DPEA 1Y93A 3TT4A 3MA2A 1ATLA 2OY2A 1KUKA 4R3VA 830CA 4AXQA 1YCMA 1BUDA 1SRPA 1XFXA 1BQQM 1JANA 3HBUP 4H84A 1MMRA 1BSWA 3HBVP 2J0TA 2D1OA 1CGLA 3LMCA 2Y6CA 3HY7A 1ZS0A 4GR8A 1K7GA 1CGEA 1XFVA 1XUDA 2I47A 3HDAP 1R55A 2W12A 5I3MA 2MLSA 2JT5A 1OO9A 2DW1A 1B3DA 2RJPA 5H8XA 1PWQA 2OXWA 1JH1A 4JP4A 3LILA 2MZIA 4ILWD 3F17A 4H82A 3KHIA 4ON1A 1OS2A 1O0TA 5I0LA 4XM6A 1USNA 1XUCA 2D1NA 4H49A 4GR3A 3OHOA 1A85A 3Q2HA 4GR0A 1EB6A 4WKIA 1AYKA 1KUGA 3O2XA 1R1JA 1K7IA 2YB9A 2Y6DA 4JIJA 3DSLA 1HV5A 1SU3A 2OZRA 3B92A 3K7NA 1HFSA 5I4OA 1DMTA 1XFZA 1Y8JA 1D5JA 3N2VA 4H1QA 4Q1LA 2RJQA 2WO9A 1IAEA 1SATA 2AYKA 2OW9A 1GO7P 2POJA 1H71P 4L63A 5LABA 2WOAA 1KUHA 1FBLA 4PKWA 4CTHA 5L79A 3F18A 4AYKA 4XBHA 2J83A 5D2BA 3USNA 1IADA 1YQYA 2OI0A 4IN9A 3LE9A 2QPJA 3GBOA 1JIZA 4PKSA 1JKYA 1MNCA 5I43A 4AUOA 4EFSA 2XS4A 5JMYA 2OW2A 1YP1A 1JK3A 2OVZA 3HDBA 4I35A 1D8MA 1K7QA 2OVXA 1J7NA 3P24A 3NX7A 1BKCA 3O64A 4WZVA 1PWUA 1OM7A 3G5CA 1HTDA 2W15A 5I12A 2N8RA 1BUVM 4PKUA 4XM8A 3KMCA 4J4MA 1RMZA 1XURA 1QUAA 1JAQA 3BA0A 1G49A 3LQBA 2V4BA 1CQRA 5CXAA 1ZTQA 1UTZA 1G9KA 2O3EA 2X7MA 4DF9A 1Q3AA 2FV5A 4IUWA 1JIWP 4HX3A 4G9LA 1GKDA 4WK7A 4XCTA 3WV3A 1PWWA 2PJTA 2DW2A 3RTTA 3F15A 4A7BA 2CKIA 3ZXHA 4FXQA 2Z2DA 2ERPA 1KBCA 1WNIA 1UMTA 3WV1A 1CK7A 3LUNA 1DTHA 3TVCA 4WKEA 3F19A 1EAKA 3B8ZA 4JQGA 3VTGA 5I2ZA 1QIAA 456CA 1IAGA 4WF6A 3AIGA 4QKZA 1GE6A 1R54A 1CXVA 1GE5A 3G42A 1UMSA 1D7XA 1O0QA 2X3CA 4GUYA 1ROSA 4G0DA 2MZEA 3LKAA 3TS4A 1PWVA 2HU6A 2E2DA 2TCLA 966CA 3L0VA 3K7LA 2DDYA 1JJ9A 2O36A 4GWMA 1QICA 4I03A 1XFUA 2EROA 4ZR5A 1MMPA 3N2UA 3VI1A 1PWPA 1G4KA 3HY9A 1MMBA 3WV2A 2X3BA 5D1TA 1ZP5A 2AIGP 1FLSA 1IAAA 4PKVA 3KEKA 1OM6A 3LIKA 3LJZA 5BOYA 1SLNA 1A86A 3LIRA 2E3XA 1C8TA 1RM8A 1OS9A 1XFWA 1I1IP 1R1IA 2SRTA 1ASTA 3LEAA 4H2EA 1BZSA 1I73A 5D1SA 3LGPA 3EDHA 3KMEA 4L6TA 3LK8A 2JSDA 2K2GA 3ZUKA 1BM6A 5CUHA 4GF1A 3DWBA 2W13A 1D8FA 3V96B 1HOVA 1I76A 3DPFA 3EDZA 1ZVXA 4FXYP 2MZHA 4A3WA 1S4BP 1C7KA 5B5OA 1EUBA 1HFCA 4L19A 5D3CA 1XFYA 4DV8A 1OM8A 3ELMA 1C3IA 2YIGA 1HY7A 3UVCA 3L0TA 5D7WA 1Y0VA 3EDGA 4IJOA 2OW0A 2OY4A 1CGFA 1L6JA 3P1VA 2OXUA 4XM7A 2JT6A 1GO8P 3DPEA 2MLRA 3LJTA 1ZXVA 1BKCI 3LJGA 2W0DA 3EWJA 4JA1A 5B5PA 2FV9A 2DDFA 4H76A 1IABA 3CKIA 1JAPA 3U1RA 2JIHA 4HMAA 2OXZA 1KAPP 3KECA 1GXDA 5CZMA 1BKCE 3KWVC 2W14A 1KUFA 3AYKA 4FU4A 4H3XA 1KUIA 3F16A 4PKQA 2KRJA 4FVLA 5BPAA 2ERQA 3DL1A 2X3AA 1G12A 1GE7A 1QJJA 1JAOA 2JNPA 3TSKA 3KRYA 2XS3A 1QJIA 4DD8A 3B2ZA 1SMPA 1CAQA 1UTTA 5D1UA 3RTSA 3E8RA 1Z3JA 1CIZA 2USNA 3KEJA 3LUMA 3Q2GA 1UEAA 2A8HA 3I7IA 3HB2P 1IACA 4AIGA 3EDIA 2CLTA 3DNGA 4JPAA 5L7FA 2L0RA 1ND1A 4PKRA 4PKTA 4GWNA 1GKCA 1AF0A 2K9CA 3EHXA 2OW1A 3I7GA 1G05A
chains in the Genus database with same CATH superfamily
1OZ9A 1OMJA 1MMQA 4GQLA 1SLMA 2WO8A 1FM1A 4L7AA 5BOTA 1ZXCA 1AKLA 3LQ0A 3ZVSA 1BQOA 3F1AA 1BIWA 4H30A 1QIBA 1R1HA 3SHIA 1B8YA 3AYUA 2DW0A 3EHYA 3OHLA 1YOUA 3HYGA 4DPEA 1Y93A 3TT4A 3MA2A 1ATLA 2OY2A 1KUKA 4R3VA 830CA 4AXQA 1YCMA 1BUDA 1SRPA 1XFXA 1BQQM 1JANA 3HBUP 4H84A 1MMRA 1BSWA 3HBVP 2J0TA 2D1OA 1CGLA 3LMCA 2Y6CA 3HY7A 1ZS0A 4GR8A 1K7GA 1CGEA 1XFVA 1XUDA 2I47A 3HDAP 1R55A 2W12A 5I3MA 2MLSA 2JT5A 1OO9A 2DW1A 1B3DA 2RJPA 5H8XA 1PWQA 2OXWA 1JH1A 4JP4A 3LILA 2MZIA 4ILWD 3F17A 4H82A 3KHIA 4ON1A 1OS2A 1O0TA 5I0LA 4XM6A 1USNA 1XUCA 2D1NA 4H49A 4GR3A 3OHOA 1A85A 3Q2HA 4GR0A 1EB6A 4WKIA 1AYKA 1KUGA 3O2XA 1R1JA 1K7IA 3DTKA 2YB9A 2Y6DA 4JIJA 3DSLA 1HV5A 1SU3A 2OZRA 3B92A 3K7NA 1HFSA 5I4OA 1DMTA 1XFZA 1Y8JA 1D5JA 3N2VA 4H1QA 4Q1LA 2RJQA 2WO9A 1IAEA 1SATA 2AYKA 2OW9A 1GO7P 2POJA 1H71P 4L63A 5LABA 2WOAA 1KUHA 1FBLA 4PKWA 4CTHA 5L79A 3F18A 4AYKA 4XBHA 2J83A 5D2BA 3USNA 1IADA 1YQYA 2OI0A 4IN9A 3LE9A 2YUFA 2QPJA 3GBOA 1JIZA 4PKSA 1JKYA 1MNCA 5I43A 4AUOA 4EFSA 2XS4A 5JMYA 2OW2A 1YP1A 1JK3A 2OVZA 3HDBA 4I35A 1D8MA 1K7QA 2OVXA 1J7NA 3P24A 3NX7A 1TVIA 1BKCA 3O64A 4WZVA 1PWUA 1OM7A 3G5CA 1HTDA 2W15A 5I12A 2N8RA 1BUVM 4PKUA 4XM8A 3KMCA 4J4MA 1RMZA 1XURA 1QUAA 1JAQA 3BA0A 1G49A 3LQBA 2V4BA 1CQRA 5CXAA 1ZTQA 1UTZA 1G9KA 2O3EA 2X7MA 4DF9A 1Q3AA 2FV5A 4IUWA 1JIWP 4HX3A 4G9LA 1GKDA 1XAXA 4WK7A 4XCTA 3WV3A 1PWWA 2PJTA 2DW2A 3RTTA 3F15A 4A7BA 2CKIA 3ZXHA 4FXQA 2Z2DA 2ERPA 1KBCA 1WNIA 1UMTA 3WV1A 1CK7A 3LUNA 1DTHA 3TVCA 4WKEA 3F19A 1EAKA 3B8ZA 4JQGA 3VTGA 5I2ZA 1QIAA 456CA 1IAGA 4WF6A 3AIGA 4QKZA 1GE6A 1R54A 1CXVA 1GE5A 3G42A 1UMSA 1D7XA 1O0QA 2X3CA 4GUYA 1ROSA 4G0DA 2MZEA 3LKAA 3TS4A 1PWVA 2HU6A 2E2DA 2TCLA 966CA 3L0VA 3K7LA 2DDYA 1JJ9A 2O36A 4GWMA 1QICA 4I03A 1XFUA 2EROA 4ZR5A 1MMPA 3N2UA 3VI1A 1PWPA 1G4KA 3HY9A 1MMBA 3WV2A 2X3BA 5D1TA 1ZP5A 2AIGP 1FLSA 1IAAA 4PKVA 3KEKA 1OM6A 3LIKA 3LJZA 5BOYA 1SLNA 1A86A 3LIRA 2E3XA 1C8TA 1RM8A 1OS9A 1XFWA 1I1IP 1R1IA 2SRTA 1ASTA 3LEAA 4H2EA 1BZSA 1I73A 5D1SA 3LGPA 3EDHA 3KMEA 4L6TA 3LK8A 2JSDA 2K2GA 3ZUKA 1BM6A 5CUHA 4GF1A 3DWBA 2W13A 1D8FA 3V96B 1HOVA 1I76A 3DPFA 3EDZA 1ZVXA 4FXYP 2MZHA 4A3WA 1S4BP 1C7KA 5B5OA 1EUBA 1HFCA 4L19A 5D3CA 1XFYA 4DV8A 1OM8A 3DTEA 3ELMA 1C3IA 2YIGA 1HY7A 3UVCA 3L0TA 1XM5A 5D7WA 1Y0VA 3EDGA 4IJOA 2OW0A 2OY4A 1CGFA 1L6JA 3P1VA 2OXUA 4XM7A 2JT6A 1GO8P 3DPEA 2MLRA 3LJTA 1ZXVA 1BKCI 3LJGA 2W0DA 3EWJA 4JA1A 5B5PA 2FV9A 2DDFA 4H76A 1IABA 3CKIA 1JAPA 3U1RA 2JIHA 4HMAA 2OXZA 1KAPP 3KECA 1GXDA 5CZMA 1BKCE 3KWVC 2W14A 1KUFA 3AYKA 4FU4A 4H3XA 1KUIA 3F16A 4PKQA 2KRJA 4FVLA 5BPAA 2ERQA 3DL1A 2X3AA 1G12A 1GE7A 1QJJA 1JAOA 2JNPA 3TSKA 3KRYA 2XS3A 1QJIA 4DD8A 3DTIA 3B2ZA 1SMPA 1CAQA 1UTTA 5D1UA 3RTSA 3E8RA 1Z3JA 1CIZA 2USNA 3KEJA 3LUMA 3Q2GA 1UEAA 2A8HA 3I7IA 3HB2P 1IACA 4AIGA 3EDIA 2CLTA 3DNGA 4JPAA 5L7FA 2L0RA 1ND1A 4PKRA 4PKTA 4GWNA 1GKCA 1AF0A 2K9CA 3EHXA 2OW1A 3I7GA 1G05A
chains in the Genus database with same CATH topology
1OMJA 1MMQA 4GQLA 1SLMA 2WO8A 1FM1A 4L7AA 5BOTA 1ZXCA 1AKLA 3LQ0A 3ZVSA 1BQOA 3F1AA 1BIWA 4H30A 1QIBA 1R1HA 3SHIA 1B8YA 3AYUA 2DW0A 3EHYA 3OHLA 1YOUA 3HYGA 4DPEA 1Y93A 3TT4A 3MA2A 1ATLA 2OY2A 1KUKA 4R3VA 830CA 4AXQA 1YCMA 1BUDA 1SRPA 1XFXA 1BQQM 1JANA 3HBUP 4H84A 1MMRA 1BSWA 3HBVP 2J0TA 2D1OA 1CGLA 3LMCA 2Y6CA 3HY7A 1ZS0A 4GR8A 1K7GA 1CGEA 1XFVA 1XUDA 2I47A 3HDAP 1R55A 2W12A 5I3MA 2MLSA 2JT5A 1OO9A 2DW1A 1B3DA 2RJPA 5H8XA 1PWQA 2OXWA 1JH1A 4JP4A 3LILA 2MZIA 4ILWD 3F17A 4H82A 3KHIA 4ON1A 1OS2A 1O0TA 5I0LA 4XM6A 1USNA 1XUCA 2D1NA 4H49A 4GR3A 3OHOA 1A85A 3Q2HA 4GR0A 1EB6A 4WKIA 1AYKA 1KUGA 3O2XA 1R1JA 1K7IA 3DTKA 2YB9A 2Y6DA 4JIJA 3DSLA 1HV5A 1SU3A 2OZRA 3B92A 3K7NA 1HFSA 5I4OA 1DMTA 1XFZA 1Y8JA 1D5JA 3N2VA 4H1QA 4Q1LA 2RJQA 2WO9A 1IAEA 1SATA 2AYKA 2OW9A 1GO7P 2POJA 1H71P 4L63A 5LABA 2WOAA 1KUHA 1FBLA 4PKWA 4CTHA 5L79A 3F18A 4AYKA 4XBHA 2J83A 5D2BA 3USNA 1IADA 1YQYA 2OI0A 4IN9A 3LE9A 2YUFA 2QPJA 3GBOA 1JIZA 4PKSA 1JKYA 1MNCA 5I43A 4AUOA 4EFSA 2XS4A 5JMYA 2OW2A 1YP1A 1JK3A 2OVZA 3HDBA 4I35A 1D8MA 1K7QA 2OVXA 1J7NA 3P24A 3NX7A 1BKCA 3O64A 4WZVA 1PWUA 1OM7A 3G5CA 1HTDA 2W15A 5I12A 2N8RA 1BUVM 4PKUA 4XM8A 3KMCA 4J4MA 1RMZA 1XURA 1QUAA 1JAQA 3BA0A 1G49A 3LQBA 2V4BA 1CQRA 5CXAA 1ZTQA 1UTZA 1G9KA 2O3EA 2X7MA 4DF9A 1Q3AA 2FV5A 4IUWA 1JIWP 4HX3A 4G9LA 1GKDA 4WK7A 4XCTA 3WV3A 1PWWA 2PJTA 2DW2A 3RTTA 3F15A 4A7BA 2CKIA 3ZXHA 4FXQA 2Z2DA 2ERPA 1KBCA 1WNIA 1UMTA 3WV1A 1CK7A 3LUNA 1DTHA 3TVCA 4WKEA 3F19A 1EAKA 3B8ZA 4JQGA 3VTGA 5I2ZA 1QIAA 456CA 1IAGA 4WF6A 3AIGA 4QKZA 1GE6A 1R54A 1CXVA 1GE5A 3G42A 1UMSA 1D7XA 1O0QA 2X3CA 4GUYA 1ROSA 4G0DA 2MZEA 3LKAA 3TS4A 1PWVA 2HU6A 2E2DA 2TCLA 966CA 3L0VA 3K7LA 2DDYA 1JJ9A 2O36A 4GWMA 1QICA 4I03A 1XFUA 2EROA 4ZR5A 1MMPA 3N2UA 3VI1A 1PWPA 1G4KA 3HY9A 1MMBA 3WV2A 2X3BA 5D1TA 1ZP5A 2AIGP 1FLSA 1IAAA 4PKVA 3KEKA 1OM6A 3LIKA 3LJZA 5BOYA 1SLNA 1A86A 3LIRA 2E3XA 1C8TA 1RM8A 1OS9A 1XFWA 1I1IP 1R1IA 2SRTA 1ASTA 3LEAA 4H2EA 1BZSA 1I73A 5D1SA 3LGPA 3EDHA 3KMEA 4L6TA 3LK8A 2JSDA 2K2GA 3ZUKA 1BM6A 5CUHA 4GF1A 3DWBA 2W13A 1D8FA 3V96B 1HOVA 1I76A 3DPFA 3EDZA 1ZVXA 4FXYP 2MZHA 4A3WA 1S4BP 1C7KA 5B5OA 1EUBA 1HFCA 4L19A 5D3CA 1XFYA 4DV8A 1OM8A 3DTEA 3ELMA 1C3IA 2YIGA 1HY7A 3UVCA 3L0TA 5D7WA 1Y0VA 3EDGA 4IJOA 2OW0A 2OY4A 1CGFA 1L6JA 3P1VA 2OXUA 4XM7A 2JT6A 1GO8P 3DPEA 2MLRA 3LJTA 1ZXVA 1BKCI 3LJGA 2W0DA 3EWJA 4JA1A 5B5PA 2FV9A 2DDFA 4H76A 1IABA 3CKIA 1JAPA 3U1RA 2JIHA 4HMAA 2OXZA 1KAPP 3KECA 1GXDA 5CZMA 1BKCE 3KWVC 2W14A 1KUFA 3AYKA 4FU4A 4H3XA 1KUIA 3F16A 4PKQA 2KRJA 4FVLA 5BPAA 2ERQA 3DL1A 2X3AA 1G12A 1GE7A 1QJJA 1JAOA 2JNPA 3TSKA 3KRYA 2XS3A 1QJIA 4DD8A 3DTIA 3B2ZA 1SMPA 1CAQA 1UTTA 5D1UA 3RTSA 3E8RA 1Z3JA 1CIZA 2USNA 3KEJA 3LUMA 3Q2GA 1UEAA 2A8HA 3I7IA 3HB2P 1IACA 4AIGA 3EDIA 2CLTA 3DNGA 4JPAA 5L7FA 2L0RA 1ND1A 4PKRA 4PKTA 4GWNA 1GKCA 1AF0A 2K9CA 3EHXA 2OW1A 3I7GA 1G05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMJ A;  1MMQ A;  4GQL A;  1SLM A;  2WO8 A;  1FM1 A;  5BOT A;  1ZXC A;  1AKL A;  3LQ0 A;  3ZVS A;  1BQO A;  3F1A A;  1BIW A;  4H30 A;  1QIB A;  1R1H A;  3SHI A;  1B8Y A;  3AYU A;  2DW0 A;  3EHY A;  3OHL A;  1YOU A;  3HYG A;  4DPE A;  1Y93 A;  3TT4 A;  3MA2 A;  1ATL A;  2OY2 A;  1KUK A;  4R3V A;  830C A;  4AXQ A;  1YCM A;  1BUD A;  1SRP A;  1XFX A;  1BQQ M;  1JAN A;  3HBU P;  4H84 A;  1MMR A;  1BSW A;  3HBV P;  2J0T A;  2D1O A;  1CGL A;  3LMC A;  2Y6C A;  3HY7 A;  1ZS0 A;  4GR8 A;  1K7G A;  1CGE A;  1XFV A;  1XUD A;  2I47 A;  3HDA P;  1R55 A;  2W12 A;  5I3M A;  2MLS A;  2JT5 A;  1OO9 A;  2DW1 A;  1B3D A;  2RJP A;  5H8X A;  1PWQ A;  2OXW A;  1JH1 A;  4JP4 A;  3LIL A;  2MZI A;  4ILW D;  3F17 A;  4H82 A;  3KHI A;  4ON1 A;  1OS2 A;  1O0T A;  5I0L A;  4XM6 A;  1USN A;  1XUC A;  2D1N A;  4H49 A;  4GR3 A;  3OHO A;  1A85 A;  3Q2H A;  4GR0 A;  1EB6 A;  4WKI A;  1AYK A;  1KUG A;  3O2X A;  1R1J A;  1K7I A;  2YB9 A;  2Y6D A;  4JIJ A;  3DSL A;  1HV5 A;  1SU3 A;  2OZR A;  3B92 A;  3K7N A;  1HFS A;  5I4O A;  1DMT A;  1XFZ A;  1Y8J A;  1D5J A;  3N2V A;  4H1Q A;  4Q1L A;  2RJQ A;  2WO9 A;  1IAE A;  1SAT A;  2AYK A;  2OW9 A;  1GO7 P;  2POJ A;  1H71 P;  4L63 A;  5LAB A;  2WOA A;  1KUH A;  1FBL A;  4PKW A;  4CTH A;  5L79 A;  3F18 A;  4AYK A;  4XBH A;  2J83 A;  5D2B A;  3USN A;  1IAD A;  1YQY A;  2OI0 A;  4IN9 A;  3LE9 A;  2QPJ A;  3GBO A;  1JIZ A;  4PKS A;  1JKY A;  1MNC A;  5I43 A;  4AUO A;  4EFS A;  2XS4 A;  5JMY A;  2OW2 A;  1YP1 A;  1JK3 A;  2OVZ A;  3HDB A;  4I35 A;  1D8M A;  1K7Q A;  2OVX A;  1J7N A;  3P24 A;  3NX7 A;  1BKC A;  3O64 A;  4WZV A;  1PWU A;  1OM7 A;  3G5C A;  1HTD A;  2W15 A;  5I12 A;  2N8R A;  1BUV M;  4PKU A;  4XM8 A;  3KMC A;  4J4M A;  1RMZ A;  1XUR A;  1QUA A;  1JAQ A;  3BA0 A;  1G49 A;  3LQB A;  2V4B A;  1CQR A;  5CXA A;  1ZTQ A;  1UTZ A;  1G9K A;  2O3E A;  2X7M A;  4DF9 A;  1Q3A A;  2FV5 A;  4IUW A;  1JIW P;  4HX3 A;  4G9L A;  1GKD A;  4WK7 A;  4XCT A;  3WV3 A;  1PWW A;  2PJT A;  2DW2 A;  3RTT A;  3F15 A;  4A7B A;  2CKI A;  3ZXH A;  4FXQ A;  2Z2D A;  2ERP A;  1KBC A;  1WNI A;  1UMT A;  3WV1 A;  1CK7 A;  3LUN A;  1DTH A;  3TVC A;  4WKE A;  3F19 A;  1EAK A;  3B8Z A;  4JQG A;  3VTG A;  5I2Z A;  1QIA A;  456C A;  1IAG A;  4WF6 A;  3AIG A;  4QKZ A;  1GE6 A;  1R54 A;  1CXV A;  1GE5 A;  3G42 A;  1UMS A;  1D7X A;  1O0Q A;  2X3C A;  4GUY A;  1ROS A;  4G0D A;  2MZE A;  3LKA A;  3TS4 A;  1PWV A;  2HU6 A;  2E2D A;  2TCL A;  966C A;  3L0V A;  3K7L A;  2DDY A;  1JJ9 A;  2O36 A;  4GWM A;  1QIC A;  4I03 A;  1XFU A;  2ERO A;  4ZR5 A;  1MMP A;  3N2U A;  3VI1 A;  1PWP A;  1G4K A;  3HY9 A;  1MMB A;  3WV2 A;  2X3B A;  5D1T A;  1ZP5 A;  2AIG P;  1FLS A;  1IAA A;  4PKV A;  3KEK A;  1OM6 A;  3LIK A;  3LJZ A;  5BOY A;  1SLN A;  1A86 A;  3LIR A;  2E3X A;  1C8T A;  1RM8 A;  1OS9 A;  1XFW A;  1I1I P;  1R1I A;  2SRT A;  1AST A;  3LEA A;  4H2E A;  1BZS A;  1I73 A;  5D1S A;  3LGP A;  3EDH A;  3KME A;  4L6T A;  3LK8 A;  2JSD A;  2K2G A;  3ZUK A;  1BM6 A;  5CUH A;  4GF1 A;  3DWB A;  2W13 A;  1D8F A;  3V96 B;  1HOV A;  1I76 A;  3DPF A;  3EDZ A;  1ZVX A;  4FXY P;  2MZH A;  4A3W A;  1S4B P;  1C7K A;  5B5O A;  1EUB A;  1HFC A;  4L19 A;  5D3C A;  1XFY A;  4DV8 A;  1OM8 A;  3ELM A;  1C3I A;  2YIG A;  1HY7 A;  3UVC A;  3L0T A;  5D7W A;  1Y0V A;  3EDG A;  4IJO A;  2OW0 A;  2OY4 A;  1CGF A;  1L6J A;  3P1V A;  2OXU A;  4XM7 A;  2JT6 A;  1GO8 P;  3DPE A;  2MLR A;  3LJT A;  1ZXV A;  1BKC I;  3LJG A;  2W0D A;  3EWJ A;  4JA1 A;  5B5P A;  2FV9 A;  2DDF A;  4H76 A;  1IAB A;  3CKI A;  1JAP A;  3U1R A;  2JIH A;  4HMA A;  2OXZ A;  1KAP P;  3KEC A;  1GXD A;  5CZM A;  1BKC E;  3KWV C;  2W14 A;  1KUF A;  3AYK A;  4FU4 A;  4H3X A;  1KUI A;  3F16 A;  4PKQ A;  2KRJ A;  4FVL A;  5BPA A;  2ERQ A;  3DL1 A;  2X3A A;  1G12 A;  1GE7 A;  1QJJ A;  1JAO A;  2JNP A;  3TSK A;  3KRY A;  2XS3 A;  1QJI A;  4DD8 A;  3B2Z A;  1SMP A;  1CAQ A;  1UTT A;  5D1U A;  3RTS A;  3E8R A;  1Z3J A;  1CIZ A;  2USN A;  3KEJ A;  3LUM A;  3Q2G A;  1UEA A;  2A8H A;  3I7I A;  3HB2 P;  1IAC A;  4AIG A;  3EDI A;  2CLT A;  3DNG A;  4JPA A;  5L7F A;  2L0R A;  1ND1 A;  4PKR A;  4PKT A;  4GWN A;  1GKC A;  1AF0 A;  2K9C A;  3EHX A;  2OW1 A;  3I7G A;  1G05 A; 
#chains in the Genus database with same CATH topology
 1OZ9 A;  1OMJ A;  1MMQ A;  4GQL A;  1SLM A;  2WO8 A;  1FM1 A;  4L7A A;  5BOT A;  1ZXC A;  1AKL A;  3LQ0 A;  3ZVS A;  1BQO A;  3F1A A;  1BIW A;  4H30 A;  1QIB A;  1R1H A;  3SHI A;  1B8Y A;  3AYU A;  2DW0 A;  3EHY A;  3OHL A;  1YOU A;  3HYG A;  4DPE A;  1Y93 A;  3TT4 A;  3MA2 A;  1ATL A;  2OY2 A;  1KUK A;  4R3V A;  830C A;  4AXQ A;  1YCM A;  1BUD A;  1SRP A;  1XFX A;  1BQQ M;  1JAN A;  3HBU P;  4H84 A;  1MMR A;  1BSW A;  3HBV P;  2J0T A;  2D1O A;  1CGL A;  3LMC A;  2Y6C A;  3HY7 A;  1ZS0 A;  4GR8 A;  1K7G A;  1CGE A;  1XFV A;  1XUD A;  2I47 A;  3HDA P;  1R55 A;  2W12 A;  5I3M A;  2MLS A;  2JT5 A;  1OO9 A;  2DW1 A;  1B3D A;  2RJP A;  5H8X A;  1PWQ A;  2OXW A;  1JH1 A;  4JP4 A;  3LIL A;  2MZI A;  4ILW D;  3F17 A;  4H82 A;  3KHI A;  4ON1 A;  1OS2 A;  1O0T A;  5I0L A;  4XM6 A;  1USN A;  1XUC A;  2D1N A;  4H49 A;  4GR3 A;  3OHO A;  1A85 A;  3Q2H A;  4GR0 A;  1EB6 A;  4WKI A;  1AYK A;  1KUG A;  3O2X A;  1R1J A;  1K7I A;  3DTK A;  2YB9 A;  2Y6D A;  4JIJ A;  3DSL A;  1HV5 A;  1SU3 A;  2OZR A;  3B92 A;  3K7N A;  1HFS A;  5I4O A;  1DMT A;  1XFZ A;  1Y8J A;  1D5J A;  3N2V A;  4H1Q A;  4Q1L A;  2RJQ A;  2WO9 A;  1IAE A;  1SAT A;  2AYK A;  2OW9 A;  1GO7 P;  2POJ A;  1H71 P;  4L63 A;  5LAB A;  2WOA A;  1KUH A;  1FBL A;  4PKW A;  4CTH A;  5L79 A;  3F18 A;  4AYK A;  4XBH A;  2J83 A;  5D2B A;  3USN A;  1IAD A;  1YQY A;  2OI0 A;  4IN9 A;  3LE9 A;  2YUF A;  2QPJ A;  3GBO A;  1JIZ A;  4PKS A;  1JKY A;  1MNC A;  5I43 A;  4AUO A;  4EFS A;  2XS4 A;  5JMY A;  2OW2 A;  1YP1 A;  1JK3 A;  2OVZ A;  3HDB A;  4I35 A;  1D8M A;  1K7Q A;  2OVX A;  1J7N A;  3P24 A;  3NX7 A;  1TVI A;  1BKC A;  3O64 A;  4WZV A;  1PWU A;  1OM7 A;  3G5C A;  1HTD A;  2W15 A;  5I12 A;  2N8R A;  1BUV M;  4PKU A;  4XM8 A;  3KMC A;  4J4M A;  1RMZ A;  1XUR A;  1QUA A;  1JAQ A;  3BA0 A;  1G49 A;  3LQB A;  2V4B A;  1CQR A;  5CXA A;  1ZTQ A;  1UTZ A;  1G9K A;  2O3E A;  2X7M A;  4DF9 A;  1Q3A A;  2FV5 A;  4IUW A;  1JIW P;  4HX3 A;  4G9L A;  1GKD A;  1XAX A;  4WK7 A;  4XCT A;  3WV3 A;  1PWW A;  2PJT A;  2DW2 A;  3RTT A;  3F15 A;  4A7B A;  2CKI A;  3ZXH A;  4FXQ A;  2Z2D A;  2ERP A;  1KBC A;  1WNI A;  1UMT A;  3WV1 A;  1CK7 A;  3LUN A;  1DTH A;  3TVC A;  4WKE A;  3F19 A;  1EAK A;  3B8Z A;  4JQG A;  3VTG A;  5I2Z A;  1QIA A;  456C A;  1IAG A;  4WF6 A;  3AIG A;  4QKZ A;  1GE6 A;  1R54 A;  1CXV A;  1GE5 A;  3G42 A;  1UMS A;  1D7X A;  1O0Q A;  2X3C A;  4GUY A;  1ROS A;  4G0D A;  2MZE A;  3LKA A;  3TS4 A;  1PWV A;  2HU6 A;  2E2D A;  2TCL A;  966C A;  3L0V A;  3K7L A;  2DDY A;  1JJ9 A;  2O36 A;  4GWM A;  1QIC A;  4I03 A;  1XFU A;  2ERO A;  4ZR5 A;  1MMP A;  3N2U A;  3VI1 A;  1PWP A;  1G4K A;  3HY9 A;  1MMB A;  3WV2 A;  2X3B A;  5D1T A;  1ZP5 A;  2AIG P;  1FLS A;  1IAA A;  4PKV A;  3KEK A;  1OM6 A;  3LIK A;  3LJZ A;  5BOY A;  1SLN A;  1A86 A;  3LIR A;  2E3X A;  1C8T A;  1RM8 A;  1OS9 A;  1XFW A;  1I1I P;  1R1I A;  2SRT A;  1AST A;  3LEA A;  4H2E A;  1BZS A;  1I73 A;  5D1S A;  3LGP A;  3EDH A;  3KME A;  4L6T A;  3LK8 A;  2JSD A;  2K2G A;  3ZUK A;  1BM6 A;  5CUH A;  4GF1 A;  3DWB A;  2W13 A;  1D8F A;  3V96 B;  1HOV A;  1I76 A;  3DPF A;  3EDZ A;  1ZVX A;  4FXY P;  2MZH A;  4A3W A;  1S4B P;  1C7K A;  5B5O A;  1EUB A;  1HFC A;  4L19 A;  5D3C A;  1XFY A;  4DV8 A;  1OM8 A;  3DTE A;  3ELM A;  1C3I A;  2YIG A;  1HY7 A;  3UVC A;  3L0T A;  1XM5 A;  5D7W A;  1Y0V A;  3EDG A;  4IJO A;  2OW0 A;  2OY4 A;  1CGF A;  1L6J A;  3P1V A;  2OXU A;  4XM7 A;  2JT6 A;  1GO8 P;  3DPE A;  2MLR A;  3LJT A;  1ZXV A;  1BKC I;  3LJG A;  2W0D A;  3EWJ A;  4JA1 A;  5B5P A;  2FV9 A;  2DDF A;  4H76 A;  1IAB A;  3CKI A;  1JAP A;  3U1R A;  2JIH A;  4HMA A;  2OXZ A;  1KAP P;  3KEC A;  1GXD A;  5CZM A;  1BKC E;  3KWV C;  2W14 A;  1KUF A;  3AYK A;  4FU4 A;  4H3X A;  1KUI A;  3F16 A;  4PKQ A;  2KRJ A;  4FVL A;  5BPA A;  2ERQ A;  3DL1 A;  2X3A A;  1G12 A;  1GE7 A;  1QJJ A;  1JAO A;  2JNP A;  3TSK A;  3KRY A;  2XS3 A;  1QJI A;  4DD8 A;  3DTI A;  3B2Z A;  1SMP A;  1CAQ A;  1UTT A;  5D1U A;  3RTS A;  3E8R A;  1Z3J A;  1CIZ A;  2USN A;  3KEJ A;  3LUM A;  3Q2G A;  1UEA A;  2A8H A;  3I7I A;  3HB2 P;  1IAC A;  4AIG A;  3EDI A;  2CLT A;  3DNG A;  4JPA A;  5L7F A;  2L0R A;  1ND1 A;  4PKR A;  4PKT A;  4GWN A;  1GKC A;  1AF0 A;  2K9C A;  3EHX A;  2OW1 A;  3I7G A;  1G05 A; 
#chains in the Genus database with same CATH homology
 1OMJ A;  1MMQ A;  4GQL A;  1SLM A;  2WO8 A;  1FM1 A;  4L7A A;  5BOT A;  1ZXC A;  1AKL A;  3LQ0 A;  3ZVS A;  1BQO A;  3F1A A;  1BIW A;  4H30 A;  1QIB A;  1R1H A;  3SHI A;  1B8Y A;  3AYU A;  2DW0 A;  3EHY A;  3OHL A;  1YOU A;  3HYG A;  4DPE A;  1Y93 A;  3TT4 A;  3MA2 A;  1ATL A;  2OY2 A;  1KUK A;  4R3V A;  830C A;  4AXQ A;  1YCM A;  1BUD A;  1SRP A;  1XFX A;  1BQQ M;  1JAN A;  3HBU P;  4H84 A;  1MMR A;  1BSW A;  3HBV P;  2J0T A;  2D1O A;  1CGL A;  3LMC A;  2Y6C A;  3HY7 A;  1ZS0 A;  4GR8 A;  1K7G A;  1CGE A;  1XFV A;  1XUD A;  2I47 A;  3HDA P;  1R55 A;  2W12 A;  5I3M A;  2MLS A;  2JT5 A;  1OO9 A;  2DW1 A;  1B3D A;  2RJP A;  5H8X A;  1PWQ A;  2OXW A;  1JH1 A;  4JP4 A;  3LIL A;  2MZI A;  4ILW D;  3F17 A;  4H82 A;  3KHI A;  4ON1 A;  1OS2 A;  1O0T A;  5I0L A;  4XM6 A;  1USN A;  1XUC A;  2D1N A;  4H49 A;  4GR3 A;  3OHO A;  1A85 A;  3Q2H A;  4GR0 A;  1EB6 A;  4WKI A;  1AYK A;  1KUG A;  3O2X A;  1R1J A;  1K7I A;  3DTK A;  2YB9 A;  2Y6D A;  4JIJ A;  3DSL A;  1HV5 A;  1SU3 A;  2OZR A;  3B92 A;  3K7N A;  1HFS A;  5I4O A;  1DMT A;  1XFZ A;  1Y8J A;  1D5J A;  3N2V A;  4H1Q A;  4Q1L A;  2RJQ A;  2WO9 A;  1IAE A;  1SAT A;  2AYK A;  2OW9 A;  1GO7 P;  2POJ A;  1H71 P;  4L63 A;  5LAB A;  2WOA A;  1KUH A;  1FBL A;  4PKW A;  4CTH A;  5L79 A;  3F18 A;  4AYK A;  4XBH A;  2J83 A;  5D2B A;  3USN A;  1IAD A;  1YQY A;  2OI0 A;  4IN9 A;  3LE9 A;  2YUF A;  2QPJ A;  3GBO A;  1JIZ A;  4PKS A;  1JKY A;  1MNC A;  5I43 A;  4AUO A;  4EFS A;  2XS4 A;  5JMY A;  2OW2 A;  1YP1 A;  1JK3 A;  2OVZ A;  3HDB A;  4I35 A;  1D8M A;  1K7Q A;  2OVX A;  1J7N A;  3P24 A;  3NX7 A;  1BKC A;  3O64 A;  4WZV A;  1PWU A;  1OM7 A;  3G5C A;  1HTD A;  2W15 A;  5I12 A;  2N8R A;  1BUV M;  4PKU A;  4XM8 A;  3KMC A;  4J4M A;  1RMZ A;  1XUR A;  1QUA A;  1JAQ A;  3BA0 A;  1G49 A;  3LQB A;  2V4B A;  1CQR A;  5CXA A;  1ZTQ A;  1UTZ A;  1G9K A;  2O3E A;  2X7M A;  4DF9 A;  1Q3A A;  2FV5 A;  4IUW A;  1JIW P;  4HX3 A;  4G9L A;  1GKD A;  4WK7 A;  4XCT A;  3WV3 A;  1PWW A;  2PJT A;  2DW2 A;  3RTT A;  3F15 A;  4A7B A;  2CKI A;  3ZXH A;  4FXQ A;  2Z2D A;  2ERP A;  1KBC A;  1WNI A;  1UMT A;  3WV1 A;  1CK7 A;  3LUN A;  1DTH A;  3TVC A;  4WKE A;  3F19 A;  1EAK A;  3B8Z A;  4JQG A;  3VTG A;  5I2Z A;  1QIA A;  456C A;  1IAG A;  4WF6 A;  3AIG A;  4QKZ A;  1GE6 A;  1R54 A;  1CXV A;  1GE5 A;  3G42 A;  1UMS A;  1D7X A;  1O0Q A;  2X3C A;  4GUY A;  1ROS A;  4G0D A;  2MZE A;  3LKA A;  3TS4 A;  1PWV A;  2HU6 A;  2E2D A;  2TCL A;  966C A;  3L0V A;  3K7L A;  2DDY A;  1JJ9 A;  2O36 A;  4GWM A;  1QIC A;  4I03 A;  1XFU A;  2ERO A;  4ZR5 A;  1MMP A;  3N2U A;  3VI1 A;  1PWP A;  1G4K A;  3HY9 A;  1MMB A;  3WV2 A;  2X3B A;  5D1T A;  1ZP5 A;  2AIG P;  1FLS A;  1IAA A;  4PKV A;  3KEK A;  1OM6 A;  3LIK A;  3LJZ A;  5BOY A;  1SLN A;  1A86 A;  3LIR A;  2E3X A;  1C8T A;  1RM8 A;  1OS9 A;  1XFW A;  1I1I P;  1R1I A;  2SRT A;  1AST A;  3LEA A;  4H2E A;  1BZS A;  1I73 A;  5D1S A;  3LGP A;  3EDH A;  3KME A;  4L6T A;  3LK8 A;  2JSD A;  2K2G A;  3ZUK A;  1BM6 A;  5CUH A;  4GF1 A;  3DWB A;  2W13 A;  1D8F A;  3V96 B;  1HOV A;  1I76 A;  3DPF A;  3EDZ A;  1ZVX A;  4FXY P;  2MZH A;  4A3W A;  1S4B P;  1C7K A;  5B5O A;  1EUB A;  1HFC A;  4L19 A;  5D3C A;  1XFY A;  4DV8 A;  1OM8 A;  3DTE A;  3ELM A;  1C3I A;  2YIG A;  1HY7 A;  3UVC A;  3L0T A;  5D7W A;  1Y0V A;  3EDG A;  4IJO A;  2OW0 A;  2OY4 A;  1CGF A;  1L6J A;  3P1V A;  2OXU A;  4XM7 A;  2JT6 A;  1GO8 P;  3DPE A;  2MLR A;  3LJT A;  1ZXV A;  1BKC I;  3LJG A;  2W0D A;  3EWJ A;  4JA1 A;  5B5P A;  2FV9 A;  2DDF A;  4H76 A;  1IAB A;  3CKI A;  1JAP A;  3U1R A;  2JIH A;  4HMA A;  2OXZ A;  1KAP P;  3KEC A;  1GXD A;  5CZM A;  1BKC E;  3KWV C;  2W14 A;  1KUF A;  3AYK A;  4FU4 A;  4H3X A;  1KUI A;  3F16 A;  4PKQ A;  2KRJ A;  4FVL A;  5BPA A;  2ERQ A;  3DL1 A;  2X3A A;  1G12 A;  1GE7 A;  1QJJ A;  1JAO A;  2JNP A;  3TSK A;  3KRY A;  2XS3 A;  1QJI A;  4DD8 A;  3DTI A;  3B2Z A;  1SMP A;  1CAQ A;  1UTT A;  5D1U A;  3RTS A;  3E8R A;  1Z3J A;  1CIZ A;  2USN A;  3KEJ A;  3LUM A;  3Q2G A;  1UEA A;  2A8H A;  3I7I A;  3HB2 P;  1IAC A;  4AIG A;  3EDI A;  2CLT A;  3DNG A;  4JPA A;  5L7F A;  2L0R A;  1ND1 A;  4PKR A;  4PKT A;  4GWN A;  1GKC A;  1AF0 A;  2K9C A;  3EHX A;  2OW1 A;  3I7G A;  1G05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...