5LABA

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor nngh
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Macrophage metalloelastase
publication title First-principles calculation of pseudo-contact shifts in a paramagnetic metalloprotein
rcsb
source organism Homo sapiens
total genus 47
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5labA00
2MLRA 2DDFA 4WZVA 2YB9A 3HDBA 3KRYA 3O2XA 4H30A 3HBUP 1R54A 1Y0VA 3KEJA 1G4KA 1KBCA 1JAOA 1KAPP 3KHIA 4A3WA 1CGEA 1R55A 1QJJA 1R1JA 3LJZA 4XBHA 5CZMA 2CKIA 2EROA 4ILWD 2OY2A 4GR3A 4H82A 3HBVP 2USNA 1G05A 3ELMA 4ZR5A 5L7FA 4G0DA 4WF6A 1YOUA 1BKCI 5BOYA 4PKUA 1O0TA 3L0TA 1I1IP 3KWVC 1D8MA 1SRPA 2JNPA 1GO7P 2OW9A 4GUYA 1ZXVA 3B92A 5I4OA 4XCTA 3BA0A 2D1OA 1BM6A 1QIBA 2KRJA 4DD8A 2Z2DA 1ND1A 2X7MA 3OHOA 5LABA 1SU3A 3F1AA 1GKDA 3B2ZA 4XM8A 1JH1A 5D3CA 1HTDA 4EFSA 4XM6A 2J0TA 3HDAP 966CA 2E2DA 3DL1A 3LIKA 1SMPA 1BKCE 1CIZA 2AIGP 3ZUKA 3HYGA 2JT5A 5B5OA 2QPJA 1ROSA 3F18A 1AKLA 4QKZA 3AYUA 1UMTA 2X3CA 3EDGA 1DMTA 4L19A 1JIZA 4JIJA 5I2ZA 2WO8A 1O0QA 1C3IA 2I47A 1Q3AA 4GR0A 1PWUA 3ZVSA 2E3XA 4DV8A 1HY7A 2X3AA 1B3DA 2JIHA 4IJOA 1SATA 1R1IA 5H8XA 5CUHA 3USNA 3K7LA 1CGLA 1CGFA 4GQLA 4AYKA 1G12A 3HB2P 4DF9A 1OM7A 1BQQM 1IAGA 1JKYA 5JMYA 1UEAA 1A86A 2Y6DA 4PKQA 3V96B 3ZXHA 2CLTA 1G49A 2POJA 3TT4A 1OO9A 4PKTA 1XFWA 4H1QA 1BSWA 1XUCA 1K7IA 1FBLA 1KUGA 5D1TA 4I35A 4XM7A 3K7NA 4GWMA 1D7XA 4GR8A 4L6TA 1XFUA 1CAQA 1K7QA 2W13A 4CTHA 2D1NA 5I0LA 3LKAA 1IABA 1GE6A 1CK7A 1SLNA 1XFYA 2FV9A 3E8RA 4WKEA 5D1SA 2TCLA 3F15A 1AF0A 3P1VA 4HX3A 1L6JA 1ATLA 3GBOA 2OXZA 3N2VA 1IAAA 5CXAA 2MLSA 3F19A 3L0VA 1IADA 5BOTA 4R3VA 2W12A 3TS4A 5L79A 1I76A 2MZEA 5I3MA 2OXUA 3LJGA 3EHXA 1XUDA 2ERPA 3Q2GA 3EDZA 1MMBA 1BQOA 2W15A 3LEAA 1ZP5A 4H84A 1CXVA 1K7GA 2JSDA 1HV5A 2X3BA 1AYKA 3EDHA 1GO8P 3LMCA 1OM6A 1BIWA 1DTHA 3VTGA 4A7BA 3EHYA 1PWPA 1XFZA 4J4MA 3F17A 1UTZA 1D5JA 2L0RA 2DW2A 1QJIA 1RMZA 4AUOA 4PKRA 3G42A 1PWQA 2WO9A 2RJQA 4FXYP 4PKVA 3VI1A 4GF1A 1H71P 2FV5A 1RM8A 3LUNA 1QIAA 1YP1A 3LE9A 1J7NA 1D8FA 4AIGA 5B5PA 1IACA 1BUDA 1WNIA 1EB6A 4PKWA 1OM8A 1XURA 1C7KA 1ZS0A 3RTSA 1MNCA 3MA2A 4H49A 1XFXA 4L63A 3LGPA 3DNGA 2JT6A 1GE5A 3WV2A 3DPEA 3KMEA 1UTTA 1FLSA 3LUMA 1GXDA 1MMPA 4I03A 5D7WA 4HMAA 4FXQA 3AIGA 4JA1A 1KUHA 2DW1A 1EAKA 2OZRA 5D2BA 3LQBA 5I12A 1ZTQA 1MMRA 2SRTA 1PWWA 2A8HA 2DDYA 3NX7A 1KUFA 2AYKA 1ZVXA 3P24A 3N2UA 2XS3A 1R1HA 4JP4A 2K2GA 2N8RA 3UVCA 2RJPA 2OY4A 5D1UA 4DPEA 4ON1A 2PJTA 2YIGA 3U1RA 3WV1A 2WOAA 1G9KA 1Y8JA 4WK7A 3Q2HA 1CQRA 2K9CA 2V4BA 3LK8A 3I7IA 3HY9A 3HY7A 5BPAA 2HU6A 2OVZA 2OI0A 1XFVA 1FM1A 1ASTA 1UMSA 3KEKA 1JK3A 4AXQA 2OW2A 1B8YA 3LJTA 2ERQA 3KECA 2MZHA 1YQYA 1BZSA 4FU4A 3OHLA 1SLMA 3TSKA 4H76A 2OVXA 3LILA 1QICA 3O64A 1PWVA 2DW0A 1JIWP 1USNA 1I73A 1EUBA 1A85A 1KUIA 1HOVA 3RTTA 4WKIA 1JAPA 1OMJA 1JJ9A 2OXWA 3DSLA 830CA 1ZXCA 3F16A 2W0DA 1OS2A 4H2EA 1GKCA 3EWJA 1GE7A 2W14A 3LQ0A 3LIRA 1MMQA 1BKCA 3WV3A 1HFSA 1KUKA 4Q1LA 3DWBA 2O36A 4GWNA 2OW1A 1BUVM 4FVLA 1QUAA 456CA 2OW0A 3I7GA 1OS9A 2XS4A 4IUWA 1Z3JA 3DPFA 4JQGA 3B8ZA 4JPAA 4PKSA 3TVCA 4H3XA 1IAEA 3CKIA 1C8TA 1YCMA 1HFCA 2J83A 3SHIA 3AYKA 1Y93A 1JANA 4G9LA 4IN9A 5I43A 2MZIA 1S4BP 3G5CA 2O3EA 3EDIA 1JAQA 3KMCA 2Y6CA
chains in the Genus database with same CATH superfamily
2MLRA 2DDFA 4WZVA 2YB9A 3HDBA 3KRYA 3O2XA 4H30A 3HBUP 1R54A 1Y0VA 3KEJA 1G4KA 1KBCA 1JAOA 1KAPP 3KHIA 4A3WA 1CGEA 1R55A 1QJJA 1R1JA 1XM5A 3LJZA 4XBHA 5CZMA 2CKIA 2EROA 4ILWD 2OY2A 4GR3A 4H82A 3HBVP 2USNA 1G05A 3ELMA 4ZR5A 5L7FA 4G0DA 4WF6A 1YOUA 1BKCI 5BOYA 4PKUA 1O0TA 3L0TA 1I1IP 3KWVC 1D8MA 1SRPA 2JNPA 1GO7P 2OW9A 4GUYA 1ZXVA 3B92A 5I4OA 4XCTA 3BA0A 2D1OA 1BM6A 1QIBA 2KRJA 4DD8A 2Z2DA 1ND1A 2X7MA 3OHOA 5LABA 1SU3A 3F1AA 1GKDA 3B2ZA 4XM8A 1JH1A 5D3CA 1HTDA 4EFSA 4XM6A 2J0TA 3HDAP 966CA 2E2DA 3DL1A 3LIKA 1SMPA 1BKCE 1CIZA 2AIGP 3ZUKA 3HYGA 2JT5A 5B5OA 2QPJA 1ROSA 3F18A 1AKLA 4QKZA 3AYUA 1UMTA 2X3CA 3EDGA 1DMTA 4L19A 1JIZA 4JIJA 5I2ZA 2WO8A 1O0QA 1C3IA 2I47A 1Q3AA 4GR0A 1PWUA 3ZVSA 2E3XA 4DV8A 1HY7A 2X3AA 1B3DA 1OZ9A 2JIHA 4IJOA 1SATA 1R1IA 5H8XA 5CUHA 3USNA 3K7LA 1CGLA 1CGFA 4GQLA 4AYKA 1G12A 3HB2P 4DF9A 1OM7A 1BQQM 1IAGA 1JKYA 5JMYA 1UEAA 1A86A 3DTEA 2Y6DA 4PKQA 3V96B 3ZXHA 2CLTA 1G49A 2POJA 3TT4A 1OO9A 4PKTA 1XFWA 4H1QA 1BSWA 1XUCA 1K7IA 1FBLA 1KUGA 5D1TA 4I35A 4XM7A 3K7NA 4GWMA 1D7XA 4GR8A 4L6TA 1XFUA 1CAQA 1K7QA 2W13A 4CTHA 2D1NA 5I0LA 3LKAA 1IABA 1GE6A 1CK7A 1SLNA 1XFYA 2FV9A 3E8RA 4WKEA 5D1SA 2TCLA 3F15A 1AF0A 3P1VA 4HX3A 1L6JA 1ATLA 3GBOA 2OXZA 3N2VA 1IAAA 5CXAA 2MLSA 3F19A 3L0VA 1IADA 5BOTA 4R3VA 2W12A 3TS4A 5L79A 1I76A 2MZEA 5I3MA 2OXUA 3LJGA 3EHXA 1XUDA 2ERPA 3Q2GA 3EDZA 1MMBA 1BQOA 2W15A 3LEAA 1ZP5A 4H84A 1CXVA 1K7GA 2JSDA 1HV5A 2X3BA 1AYKA 3EDHA 1GO8P 3LMCA 1OM6A 1BIWA 1DTHA 3VTGA 4A7BA 3EHYA 1PWPA 1XFZA 4J4MA 3F17A 1UTZA 1D5JA 2L0RA 2DW2A 1QJIA 1RMZA 4AUOA 4PKRA 3G42A 1PWQA 2WO9A 2RJQA 4FXYP 4PKVA 3VI1A 4GF1A 1H71P 2FV5A 1RM8A 3LUNA 1QIAA 1YP1A 3LE9A 2YUFA 1J7NA 1D8FA 4AIGA 5B5PA 1IACA 1BUDA 1XAXA 1WNIA 1EB6A 4PKWA 1OM8A 1XURA 1C7KA 1ZS0A 3RTSA 1MNCA 3MA2A 4H49A 1XFXA 4L63A 3LGPA 3DNGA 2JT6A 1GE5A 3WV2A 3DPEA 3KMEA 1UTTA 1FLSA 3LUMA 1GXDA 1MMPA 4I03A 5D7WA 4HMAA 4FXQA 3AIGA 4JA1A 1KUHA 2DW1A 1EAKA 2OZRA 5D2BA 3LQBA 5I12A 1ZTQA 1MMRA 2SRTA 1PWWA 2A8HA 2DDYA 3NX7A 1KUFA 2AYKA 1ZVXA 3P24A 3N2UA 2XS3A 1R1HA 4JP4A 2K2GA 2N8RA 3UVCA 2RJPA 2OY4A 5D1UA 4DPEA 4ON1A 2PJTA 2YIGA 3U1RA 3WV1A 2WOAA 1G9KA 1Y8JA 4WK7A 3Q2HA 1CQRA 2K9CA 2V4BA 3LK8A 3I7IA 3HY9A 3HY7A 5BPAA 2HU6A 2OVZA 2OI0A 1XFVA 1FM1A 1ASTA 1UMSA 3KEKA 1JK3A 4AXQA 2OW2A 1B8YA 3LJTA 2ERQA 3KECA 2MZHA 1YQYA 1BZSA 4FU4A 3OHLA 1SLMA 3TSKA 4H76A 2OVXA 3LILA 1QICA 3O64A 1PWVA 2DW0A 1JIWP 1USNA 1I73A 1EUBA 1A85A 1KUIA 1HOVA 3RTTA 4WKIA 1JAPA 1OMJA 3DTKA 1JJ9A 2OXWA 3DSLA 830CA 1ZXCA 3F16A 2W0DA 1OS2A 4H2EA 1GKCA 3EWJA 1GE7A 2W14A 3LQ0A 3LIRA 1MMQA 1BKCA 1TVIA 3WV3A 1HFSA 1KUKA 4Q1LA 3DWBA 2O36A 4GWNA 2OW1A 1BUVM 4FVLA 1QUAA 456CA 2OW0A 3I7GA 1OS9A 2XS4A 4IUWA 1Z3JA 3DPFA 4JQGA 3B8ZA 4JPAA 4PKSA 3TVCA 4H3XA 1IAEA 3CKIA 1C8TA 1YCMA 1HFCA 2J83A 3SHIA 3AYKA 1Y93A 1JANA 4G9LA 4IN9A 5I43A 3DTIA 2MZIA 1S4BP 3G5CA 2O3EA 3EDIA 4L7AA 1JAQA 3KMCA 2Y6CA
chains in the Genus database with same CATH topology
2MLRA 2DDFA 4WZVA 2YB9A 3HDBA 3KRYA 3O2XA 4H30A 3HBUP 1R54A 1Y0VA 3KEJA 1G4KA 1KBCA 1JAOA 1KAPP 3KHIA 4A3WA 1CGEA 1R55A 1QJJA 1R1JA 3LJZA 4XBHA 5CZMA 2CKIA 2EROA 4ILWD 2OY2A 4GR3A 4H82A 3HBVP 2USNA 1G05A 3ELMA 4ZR5A 5L7FA 4G0DA 4WF6A 1YOUA 1BKCI 5BOYA 4PKUA 1O0TA 3L0TA 1I1IP 3KWVC 1D8MA 1SRPA 2JNPA 1GO7P 2OW9A 4GUYA 1ZXVA 3B92A 5I4OA 4XCTA 3BA0A 2D1OA 1BM6A 1QIBA 2KRJA 4DD8A 2Z2DA 1ND1A 2X7MA 3OHOA 5LABA 1SU3A 3F1AA 1GKDA 3B2ZA 4XM8A 1JH1A 5D3CA 1HTDA 4EFSA 4XM6A 2J0TA 3HDAP 966CA 2E2DA 3DL1A 3LIKA 1SMPA 1BKCE 1CIZA 2AIGP 3ZUKA 3HYGA 2JT5A 5B5OA 2QPJA 1ROSA 3F18A 1AKLA 4QKZA 3AYUA 1UMTA 2X3CA 3EDGA 1DMTA 4L19A 1JIZA 4JIJA 5I2ZA 2WO8A 1O0QA 1C3IA 2I47A 1Q3AA 4GR0A 1PWUA 3ZVSA 2E3XA 4DV8A 1HY7A 2X3AA 1B3DA 2JIHA 4IJOA 1SATA 1R1IA 5H8XA 5CUHA 3USNA 3K7LA 1CGLA 1CGFA 4GQLA 4AYKA 1G12A 3HB2P 4DF9A 1OM7A 1BQQM 1IAGA 1JKYA 5JMYA 1UEAA 1A86A 3DTEA 2Y6DA 4PKQA 3V96B 3ZXHA 2CLTA 1G49A 2POJA 3TT4A 1OO9A 4PKTA 1XFWA 4H1QA 1BSWA 1XUCA 1K7IA 1FBLA 1KUGA 5D1TA 4I35A 4XM7A 3K7NA 4GWMA 1D7XA 4GR8A 4L6TA 1XFUA 1CAQA 1K7QA 2W13A 4CTHA 2D1NA 5I0LA 3LKAA 1IABA 1GE6A 1CK7A 1SLNA 1XFYA 2FV9A 3E8RA 4WKEA 5D1SA 2TCLA 3F15A 1AF0A 3P1VA 4HX3A 1L6JA 1ATLA 3GBOA 2OXZA 3N2VA 1IAAA 5CXAA 2MLSA 3F19A 3L0VA 1IADA 5BOTA 4R3VA 2W12A 3TS4A 5L79A 1I76A 2MZEA 5I3MA 2OXUA 3LJGA 3EHXA 1XUDA 2ERPA 3Q2GA 3EDZA 1MMBA 1BQOA 2W15A 3LEAA 1ZP5A 4H84A 1CXVA 1K7GA 2JSDA 1HV5A 2X3BA 1AYKA 3EDHA 1GO8P 3LMCA 1OM6A 1BIWA 1DTHA 3VTGA 4A7BA 3EHYA 1PWPA 1XFZA 4J4MA 3F17A 1UTZA 1D5JA 2L0RA 2DW2A 1QJIA 1RMZA 4AUOA 4PKRA 3G42A 1PWQA 2WO9A 2RJQA 4FXYP 4PKVA 3VI1A 4GF1A 1H71P 2FV5A 1RM8A 3LUNA 1QIAA 1YP1A 3LE9A 2YUFA 1J7NA 1D8FA 4AIGA 5B5PA 1IACA 1BUDA 1WNIA 1EB6A 4PKWA 1OM8A 1XURA 1C7KA 1ZS0A 3RTSA 1MNCA 3MA2A 4H49A 1XFXA 4L63A 3LGPA 3DNGA 2JT6A 1GE5A 3WV2A 3DPEA 3KMEA 1UTTA 1FLSA 3LUMA 1GXDA 1MMPA 4I03A 5D7WA 4HMAA 4FXQA 3AIGA 4JA1A 1KUHA 2DW1A 1EAKA 2OZRA 5D2BA 3LQBA 5I12A 1ZTQA 1MMRA 2SRTA 1PWWA 2A8HA 2DDYA 3NX7A 1KUFA 2AYKA 1ZVXA 3P24A 3N2UA 2XS3A 1R1HA 4JP4A 2K2GA 2N8RA 3UVCA 2RJPA 2OY4A 5D1UA 4DPEA 4ON1A 2PJTA 2YIGA 3U1RA 3WV1A 2WOAA 1G9KA 1Y8JA 4WK7A 3Q2HA 1CQRA 2K9CA 2V4BA 3LK8A 3I7IA 3HY9A 3HY7A 5BPAA 2HU6A 2OVZA 2OI0A 1XFVA 1FM1A 1ASTA 1UMSA 3KEKA 1JK3A 4AXQA 2OW2A 1B8YA 3LJTA 2ERQA 3KECA 2MZHA 1YQYA 1BZSA 4FU4A 3OHLA 1SLMA 3TSKA 4H76A 2OVXA 3LILA 1QICA 3O64A 1PWVA 2DW0A 1JIWP 1USNA 1I73A 1EUBA 1A85A 1KUIA 1HOVA 3RTTA 4WKIA 1JAPA 1OMJA 3DTKA 1JJ9A 2OXWA 3DSLA 830CA 1ZXCA 3F16A 2W0DA 1OS2A 4H2EA 1GKCA 3EWJA 1GE7A 2W14A 3LQ0A 3LIRA 1MMQA 1BKCA 3WV3A 1HFSA 1KUKA 4Q1LA 3DWBA 2O36A 4GWNA 2OW1A 1BUVM 4FVLA 1QUAA 456CA 2OW0A 3I7GA 1OS9A 2XS4A 4IUWA 1Z3JA 3DPFA 4JQGA 3B8ZA 4JPAA 4PKSA 3TVCA 4H3XA 1IAEA 3CKIA 1C8TA 1YCMA 1HFCA 2J83A 3SHIA 3AYKA 1Y93A 1JANA 4G9LA 4IN9A 5I43A 3DTIA 2MZIA 1S4BP 3G5CA 2O3EA 3EDIA 4L7AA 1JAQA 3KMCA 2Y6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLR A;  2DDF A;  4WZV A;  2YB9 A;  3HDB A;  3KRY A;  3O2X A;  4H30 A;  3HBU P;  1R54 A;  1Y0V A;  3KEJ A;  1G4K A;  1KBC A;  1JAO A;  1KAP P;  3KHI A;  4A3W A;  1CGE A;  1R55 A;  1QJJ A;  1R1J A;  3LJZ A;  4XBH A;  5CZM A;  2CKI A;  2ERO A;  4ILW D;  2OY2 A;  4GR3 A;  4H82 A;  3HBV P;  2USN A;  1G05 A;  3ELM A;  4ZR5 A;  5L7F A;  4G0D A;  4WF6 A;  1YOU A;  1BKC I;  5BOY A;  4PKU A;  1O0T A;  3L0T A;  1I1I P;  3KWV C;  1D8M A;  1SRP A;  2JNP A;  1GO7 P;  2OW9 A;  4GUY A;  1ZXV A;  3B92 A;  5I4O A;  4XCT A;  3BA0 A;  2D1O A;  1BM6 A;  1QIB A;  2KRJ A;  4DD8 A;  2Z2D A;  1ND1 A;  2X7M A;  3OHO A;  5LAB A;  1SU3 A;  3F1A A;  1GKD A;  3B2Z A;  4XM8 A;  1JH1 A;  5D3C A;  1HTD A;  4EFS A;  4XM6 A;  2J0T A;  3HDA P;  966C A;  2E2D A;  3DL1 A;  3LIK A;  1SMP A;  1BKC E;  1CIZ A;  2AIG P;  3ZUK A;  3HYG A;  2JT5 A;  5B5O A;  2QPJ A;  1ROS A;  3F18 A;  1AKL A;  4QKZ A;  3AYU A;  1UMT A;  2X3C A;  3EDG A;  1DMT A;  4L19 A;  1JIZ A;  4JIJ A;  5I2Z A;  2WO8 A;  1O0Q A;  1C3I A;  2I47 A;  1Q3A A;  4GR0 A;  1PWU A;  3ZVS A;  2E3X A;  4DV8 A;  1HY7 A;  2X3A A;  1B3D A;  2JIH A;  4IJO A;  1SAT A;  1R1I A;  5H8X A;  5CUH A;  3USN A;  3K7L A;  1CGL A;  1CGF A;  4GQL A;  4AYK A;  1G12 A;  3HB2 P;  4DF9 A;  1OM7 A;  1BQQ M;  1IAG A;  1JKY A;  5JMY A;  1UEA A;  1A86 A;  2Y6D A;  4PKQ A;  3V96 B;  3ZXH A;  2CLT A;  1G49 A;  2POJ A;  3TT4 A;  1OO9 A;  4PKT A;  1XFW A;  4H1Q A;  1BSW A;  1XUC A;  1K7I A;  1FBL A;  1KUG A;  5D1T A;  4I35 A;  4XM7 A;  3K7N A;  4GWM A;  1D7X A;  4GR8 A;  4L6T A;  1XFU A;  1CAQ A;  1K7Q A;  2W13 A;  4CTH A;  2D1N A;  5I0L A;  3LKA A;  1IAB A;  1GE6 A;  1CK7 A;  1SLN A;  1XFY A;  2FV9 A;  3E8R A;  4WKE A;  5D1S A;  2TCL A;  3F15 A;  1AF0 A;  3P1V A;  4HX3 A;  1L6J A;  1ATL A;  3GBO A;  2OXZ A;  3N2V A;  1IAA A;  5CXA A;  2MLS A;  3F19 A;  3L0V A;  1IAD A;  5BOT A;  4R3V A;  2W12 A;  3TS4 A;  5L79 A;  1I76 A;  2MZE A;  5I3M A;  2OXU A;  3LJG A;  3EHX A;  1XUD A;  2ERP A;  3Q2G A;  3EDZ A;  1MMB A;  1BQO A;  2W15 A;  3LEA A;  1ZP5 A;  4H84 A;  1CXV A;  1K7G A;  2JSD A;  1HV5 A;  2X3B A;  1AYK A;  3EDH A;  1GO8 P;  3LMC A;  1OM6 A;  1BIW A;  1DTH A;  3VTG A;  4A7B A;  3EHY A;  1PWP A;  1XFZ A;  4J4M A;  3F17 A;  1UTZ A;  1D5J A;  2L0R A;  2DW2 A;  1QJI A;  1RMZ A;  4AUO A;  4PKR A;  3G42 A;  1PWQ A;  2WO9 A;  2RJQ A;  4FXY P;  4PKV A;  3VI1 A;  4GF1 A;  1H71 P;  2FV5 A;  1RM8 A;  3LUN A;  1QIA A;  1YP1 A;  3LE9 A;  1J7N A;  1D8F A;  4AIG A;  5B5P A;  1IAC A;  1BUD A;  1WNI A;  1EB6 A;  4PKW A;  1OM8 A;  1XUR A;  1C7K A;  1ZS0 A;  3RTS A;  1MNC A;  3MA2 A;  4H49 A;  1XFX A;  4L63 A;  3LGP A;  3DNG A;  2JT6 A;  1GE5 A;  3WV2 A;  3DPE A;  3KME A;  1UTT A;  1FLS A;  3LUM A;  1GXD A;  1MMP A;  4I03 A;  5D7W A;  4HMA A;  4FXQ A;  3AIG A;  4JA1 A;  1KUH A;  2DW1 A;  1EAK A;  2OZR A;  5D2B A;  3LQB A;  5I12 A;  1ZTQ A;  1MMR A;  2SRT A;  1PWW A;  2A8H A;  2DDY A;  3NX7 A;  1KUF A;  2AYK A;  1ZVX A;  3P24 A;  3N2U A;  2XS3 A;  1R1H A;  4JP4 A;  2K2G A;  2N8R A;  3UVC A;  2RJP A;  2OY4 A;  5D1U A;  4DPE A;  4ON1 A;  2PJT A;  2YIG A;  3U1R A;  3WV1 A;  2WOA A;  1G9K A;  1Y8J A;  4WK7 A;  3Q2H A;  1CQR A;  2K9C A;  2V4B A;  3LK8 A;  3I7I A;  3HY9 A;  3HY7 A;  5BPA A;  2HU6 A;  2OVZ A;  2OI0 A;  1XFV A;  1FM1 A;  1AST A;  1UMS A;  3KEK A;  1JK3 A;  4AXQ A;  2OW2 A;  1B8Y A;  3LJT A;  2ERQ A;  3KEC A;  2MZH A;  1YQY A;  1BZS A;  4FU4 A;  3OHL A;  1SLM A;  3TSK A;  4H76 A;  2OVX A;  3LIL A;  1QIC A;  3O64 A;  1PWV A;  2DW0 A;  1JIW P;  1USN A;  1I73 A;  1EUB A;  1A85 A;  1KUI A;  1HOV A;  3RTT A;  4WKI A;  1JAP A;  1OMJ A;  1JJ9 A;  2OXW A;  3DSL A;  830C A;  1ZXC A;  3F16 A;  2W0D A;  1OS2 A;  4H2E A;  1GKC A;  3EWJ A;  1GE7 A;  2W14 A;  3LQ0 A;  3LIR A;  1MMQ A;  1BKC A;  3WV3 A;  1HFS A;  1KUK A;  4Q1L A;  3DWB A;  2O36 A;  4GWN A;  2OW1 A;  1BUV M;  4FVL A;  1QUA A;  456C A;  2OW0 A;  3I7G A;  1OS9 A;  2XS4 A;  4IUW A;  1Z3J A;  3DPF A;  4JQG A;  3B8Z A;  4JPA A;  4PKS A;  3TVC A;  4H3X A;  1IAE A;  3CKI A;  1C8T A;  1YCM A;  1HFC A;  2J83 A;  3SHI A;  3AYK A;  1Y93 A;  1JAN A;  4G9L A;  4IN9 A;  5I43 A;  2MZI A;  1S4B P;  3G5C A;  2O3E A;  3EDI A;  1JAQ A;  3KMC A;  2Y6C A; 
#chains in the Genus database with same CATH topology
 2MLR A;  2DDF A;  4WZV A;  2YB9 A;  3HDB A;  3KRY A;  3O2X A;  4H30 A;  3HBU P;  1R54 A;  1Y0V A;  3KEJ A;  1G4K A;  1KBC A;  1JAO A;  1KAP P;  3KHI A;  4A3W A;  1CGE A;  1R55 A;  1QJJ A;  1R1J A;  1XM5 A;  3LJZ A;  4XBH A;  5CZM A;  2CKI A;  2ERO A;  4ILW D;  2OY2 A;  4GR3 A;  4H82 A;  3HBV P;  2USN A;  1G05 A;  3ELM A;  4ZR5 A;  5L7F A;  4G0D A;  4WF6 A;  1YOU A;  1BKC I;  5BOY A;  4PKU A;  1O0T A;  3L0T A;  1I1I P;  3KWV C;  1D8M A;  1SRP A;  2JNP A;  1GO7 P;  2OW9 A;  4GUY A;  1ZXV A;  3B92 A;  5I4O A;  4XCT A;  3BA0 A;  2D1O A;  1BM6 A;  1QIB A;  2KRJ A;  4DD8 A;  2Z2D A;  1ND1 A;  2X7M A;  3OHO A;  5LAB A;  1SU3 A;  3F1A A;  1GKD A;  3B2Z A;  4XM8 A;  1JH1 A;  5D3C A;  1HTD A;  4EFS A;  4XM6 A;  2J0T A;  3HDA P;  966C A;  2E2D A;  3DL1 A;  3LIK A;  1SMP A;  1BKC E;  1CIZ A;  2AIG P;  3ZUK A;  3HYG A;  2JT5 A;  5B5O A;  2QPJ A;  1ROS A;  3F18 A;  1AKL A;  4QKZ A;  3AYU A;  1UMT A;  2X3C A;  3EDG A;  1DMT A;  4L19 A;  1JIZ A;  4JIJ A;  5I2Z A;  2WO8 A;  1O0Q A;  1C3I A;  2I47 A;  1Q3A A;  4GR0 A;  1PWU A;  3ZVS A;  2E3X A;  4DV8 A;  1HY7 A;  2X3A A;  1B3D A;  1OZ9 A;  2JIH A;  4IJO A;  1SAT A;  1R1I A;  5H8X A;  5CUH A;  3USN A;  3K7L A;  1CGL A;  1CGF A;  4GQL A;  4AYK A;  1G12 A;  3HB2 P;  4DF9 A;  1OM7 A;  1BQQ M;  1IAG A;  1JKY A;  5JMY A;  1UEA A;  1A86 A;  3DTE A;  2Y6D A;  4PKQ A;  3V96 B;  3ZXH A;  2CLT A;  1G49 A;  2POJ A;  3TT4 A;  1OO9 A;  4PKT A;  1XFW A;  4H1Q A;  1BSW A;  1XUC A;  1K7I A;  1FBL A;  1KUG A;  5D1T A;  4I35 A;  4XM7 A;  3K7N A;  4GWM A;  1D7X A;  4GR8 A;  4L6T A;  1XFU A;  1CAQ A;  1K7Q A;  2W13 A;  4CTH A;  2D1N A;  5I0L A;  3LKA A;  1IAB A;  1GE6 A;  1CK7 A;  1SLN A;  1XFY A;  2FV9 A;  3E8R A;  4WKE A;  5D1S A;  2TCL A;  3F15 A;  1AF0 A;  3P1V A;  4HX3 A;  1L6J A;  1ATL A;  3GBO A;  2OXZ A;  3N2V A;  1IAA A;  5CXA A;  2MLS A;  3F19 A;  3L0V A;  1IAD A;  5BOT A;  4R3V A;  2W12 A;  3TS4 A;  5L79 A;  1I76 A;  2MZE A;  5I3M A;  2OXU A;  3LJG A;  3EHX A;  1XUD A;  2ERP A;  3Q2G A;  3EDZ A;  1MMB A;  1BQO A;  2W15 A;  3LEA A;  1ZP5 A;  4H84 A;  1CXV A;  1K7G A;  2JSD A;  1HV5 A;  2X3B A;  1AYK A;  3EDH A;  1GO8 P;  3LMC A;  1OM6 A;  1BIW A;  1DTH A;  3VTG A;  4A7B A;  3EHY A;  1PWP A;  1XFZ A;  4J4M A;  3F17 A;  1UTZ A;  1D5J A;  2L0R A;  2DW2 A;  1QJI A;  1RMZ A;  4AUO A;  4PKR A;  3G42 A;  1PWQ A;  2WO9 A;  2RJQ A;  4FXY P;  4PKV A;  3VI1 A;  4GF1 A;  1H71 P;  2FV5 A;  1RM8 A;  3LUN A;  1QIA A;  1YP1 A;  3LE9 A;  2YUF A;  1J7N A;  1D8F A;  4AIG A;  5B5P A;  1IAC A;  1BUD A;  1XAX A;  1WNI A;  1EB6 A;  4PKW A;  1OM8 A;  1XUR A;  1C7K A;  1ZS0 A;  3RTS A;  1MNC A;  3MA2 A;  4H49 A;  1XFX A;  4L63 A;  3LGP A;  3DNG A;  2JT6 A;  1GE5 A;  3WV2 A;  3DPE A;  3KME A;  1UTT A;  1FLS A;  3LUM A;  1GXD A;  1MMP A;  4I03 A;  5D7W A;  4HMA A;  4FXQ A;  3AIG A;  4JA1 A;  1KUH A;  2DW1 A;  1EAK A;  2OZR A;  5D2B A;  3LQB A;  5I12 A;  1ZTQ A;  1MMR A;  2SRT A;  1PWW A;  2A8H A;  2DDY A;  3NX7 A;  1KUF A;  2AYK A;  1ZVX A;  3P24 A;  3N2U A;  2XS3 A;  1R1H A;  4JP4 A;  2K2G A;  2N8R A;  3UVC A;  2RJP A;  2OY4 A;  5D1U A;  4DPE A;  4ON1 A;  2PJT A;  2YIG A;  3U1R A;  3WV1 A;  2WOA A;  1G9K A;  1Y8J A;  4WK7 A;  3Q2H A;  1CQR A;  2K9C A;  2V4B A;  3LK8 A;  3I7I A;  3HY9 A;  3HY7 A;  5BPA A;  2HU6 A;  2OVZ A;  2OI0 A;  1XFV A;  1FM1 A;  1AST A;  1UMS A;  3KEK A;  1JK3 A;  4AXQ A;  2OW2 A;  1B8Y A;  3LJT A;  2ERQ A;  3KEC A;  2MZH A;  1YQY A;  1BZS A;  4FU4 A;  3OHL A;  1SLM A;  3TSK A;  4H76 A;  2OVX A;  3LIL A;  1QIC A;  3O64 A;  1PWV A;  2DW0 A;  1JIW P;  1USN A;  1I73 A;  1EUB A;  1A85 A;  1KUI A;  1HOV A;  3RTT A;  4WKI A;  1JAP A;  1OMJ A;  3DTK A;  1JJ9 A;  2OXW A;  3DSL A;  830C A;  1ZXC A;  3F16 A;  2W0D A;  1OS2 A;  4H2E A;  1GKC A;  3EWJ A;  1GE7 A;  2W14 A;  3LQ0 A;  3LIR A;  1MMQ A;  1BKC A;  1TVI A;  3WV3 A;  1HFS A;  1KUK A;  4Q1L A;  3DWB A;  2O36 A;  4GWN A;  2OW1 A;  1BUV M;  4FVL A;  1QUA A;  456C A;  2OW0 A;  3I7G A;  1OS9 A;  2XS4 A;  4IUW A;  1Z3J A;  3DPF A;  4JQG A;  3B8Z A;  4JPA A;  4PKS A;  3TVC A;  4H3X A;  1IAE A;  3CKI A;  1C8T A;  1YCM A;  1HFC A;  2J83 A;  3SHI A;  3AYK A;  1Y93 A;  1JAN A;  4G9L A;  4IN9 A;  5I43 A;  3DTI A;  2MZI A;  1S4B P;  3G5C A;  2O3E A;  3EDI A;  4L7A A;  1JAQ A;  3KMC A;  2Y6C A; 
#chains in the Genus database with same CATH homology
 2MLR A;  2DDF A;  4WZV A;  2YB9 A;  3HDB A;  3KRY A;  3O2X A;  4H30 A;  3HBU P;  1R54 A;  1Y0V A;  3KEJ A;  1G4K A;  1KBC A;  1JAO A;  1KAP P;  3KHI A;  4A3W A;  1CGE A;  1R55 A;  1QJJ A;  1R1J A;  3LJZ A;  4XBH A;  5CZM A;  2CKI A;  2ERO A;  4ILW D;  2OY2 A;  4GR3 A;  4H82 A;  3HBV P;  2USN A;  1G05 A;  3ELM A;  4ZR5 A;  5L7F A;  4G0D A;  4WF6 A;  1YOU A;  1BKC I;  5BOY A;  4PKU A;  1O0T A;  3L0T A;  1I1I P;  3KWV C;  1D8M A;  1SRP A;  2JNP A;  1GO7 P;  2OW9 A;  4GUY A;  1ZXV A;  3B92 A;  5I4O A;  4XCT A;  3BA0 A;  2D1O A;  1BM6 A;  1QIB A;  2KRJ A;  4DD8 A;  2Z2D A;  1ND1 A;  2X7M A;  3OHO A;  5LAB A;  1SU3 A;  3F1A A;  1GKD A;  3B2Z A;  4XM8 A;  1JH1 A;  5D3C A;  1HTD A;  4EFS A;  4XM6 A;  2J0T A;  3HDA P;  966C A;  2E2D A;  3DL1 A;  3LIK A;  1SMP A;  1BKC E;  1CIZ A;  2AIG P;  3ZUK A;  3HYG A;  2JT5 A;  5B5O A;  2QPJ A;  1ROS A;  3F18 A;  1AKL A;  4QKZ A;  3AYU A;  1UMT A;  2X3C A;  3EDG A;  1DMT A;  4L19 A;  1JIZ A;  4JIJ A;  5I2Z A;  2WO8 A;  1O0Q A;  1C3I A;  2I47 A;  1Q3A A;  4GR0 A;  1PWU A;  3ZVS A;  2E3X A;  4DV8 A;  1HY7 A;  2X3A A;  1B3D A;  2JIH A;  4IJO A;  1SAT A;  1R1I A;  5H8X A;  5CUH A;  3USN A;  3K7L A;  1CGL A;  1CGF A;  4GQL A;  4AYK A;  1G12 A;  3HB2 P;  4DF9 A;  1OM7 A;  1BQQ M;  1IAG A;  1JKY A;  5JMY A;  1UEA A;  1A86 A;  3DTE A;  2Y6D A;  4PKQ A;  3V96 B;  3ZXH A;  2CLT A;  1G49 A;  2POJ A;  3TT4 A;  1OO9 A;  4PKT A;  1XFW A;  4H1Q A;  1BSW A;  1XUC A;  1K7I A;  1FBL A;  1KUG A;  5D1T A;  4I35 A;  4XM7 A;  3K7N A;  4GWM A;  1D7X A;  4GR8 A;  4L6T A;  1XFU A;  1CAQ A;  1K7Q A;  2W13 A;  4CTH A;  2D1N A;  5I0L A;  3LKA A;  1IAB A;  1GE6 A;  1CK7 A;  1SLN A;  1XFY A;  2FV9 A;  3E8R A;  4WKE A;  5D1S A;  2TCL A;  3F15 A;  1AF0 A;  3P1V A;  4HX3 A;  1L6J A;  1ATL A;  3GBO A;  2OXZ A;  3N2V A;  1IAA A;  5CXA A;  2MLS A;  3F19 A;  3L0V A;  1IAD A;  5BOT A;  4R3V A;  2W12 A;  3TS4 A;  5L79 A;  1I76 A;  2MZE A;  5I3M A;  2OXU A;  3LJG A;  3EHX A;  1XUD A;  2ERP A;  3Q2G A;  3EDZ A;  1MMB A;  1BQO A;  2W15 A;  3LEA A;  1ZP5 A;  4H84 A;  1CXV A;  1K7G A;  2JSD A;  1HV5 A;  2X3B A;  1AYK A;  3EDH A;  1GO8 P;  3LMC A;  1OM6 A;  1BIW A;  1DTH A;  3VTG A;  4A7B A;  3EHY A;  1PWP A;  1XFZ A;  4J4M A;  3F17 A;  1UTZ A;  1D5J A;  2L0R A;  2DW2 A;  1QJI A;  1RMZ A;  4AUO A;  4PKR A;  3G42 A;  1PWQ A;  2WO9 A;  2RJQ A;  4FXY P;  4PKV A;  3VI1 A;  4GF1 A;  1H71 P;  2FV5 A;  1RM8 A;  3LUN A;  1QIA A;  1YP1 A;  3LE9 A;  2YUF A;  1J7N A;  1D8F A;  4AIG A;  5B5P A;  1IAC A;  1BUD A;  1WNI A;  1EB6 A;  4PKW A;  1OM8 A;  1XUR A;  1C7K A;  1ZS0 A;  3RTS A;  1MNC A;  3MA2 A;  4H49 A;  1XFX A;  4L63 A;  3LGP A;  3DNG A;  2JT6 A;  1GE5 A;  3WV2 A;  3DPE A;  3KME A;  1UTT A;  1FLS A;  3LUM A;  1GXD A;  1MMP A;  4I03 A;  5D7W A;  4HMA A;  4FXQ A;  3AIG A;  4JA1 A;  1KUH A;  2DW1 A;  1EAK A;  2OZR A;  5D2B A;  3LQB A;  5I12 A;  1ZTQ A;  1MMR A;  2SRT A;  1PWW A;  2A8H A;  2DDY A;  3NX7 A;  1KUF A;  2AYK A;  1ZVX A;  3P24 A;  3N2U A;  2XS3 A;  1R1H A;  4JP4 A;  2K2G A;  2N8R A;  3UVC A;  2RJP A;  2OY4 A;  5D1U A;  4DPE A;  4ON1 A;  2PJT A;  2YIG A;  3U1R A;  3WV1 A;  2WOA A;  1G9K A;  1Y8J A;  4WK7 A;  3Q2H A;  1CQR A;  2K9C A;  2V4B A;  3LK8 A;  3I7I A;  3HY9 A;  3HY7 A;  5BPA A;  2HU6 A;  2OVZ A;  2OI0 A;  1XFV A;  1FM1 A;  1AST A;  1UMS A;  3KEK A;  1JK3 A;  4AXQ A;  2OW2 A;  1B8Y A;  3LJT A;  2ERQ A;  3KEC A;  2MZH A;  1YQY A;  1BZS A;  4FU4 A;  3OHL A;  1SLM A;  3TSK A;  4H76 A;  2OVX A;  3LIL A;  1QIC A;  3O64 A;  1PWV A;  2DW0 A;  1JIW P;  1USN A;  1I73 A;  1EUB A;  1A85 A;  1KUI A;  1HOV A;  3RTT A;  4WKI A;  1JAP A;  1OMJ A;  3DTK A;  1JJ9 A;  2OXW A;  3DSL A;  830C A;  1ZXC A;  3F16 A;  2W0D A;  1OS2 A;  4H2E A;  1GKC A;  3EWJ A;  1GE7 A;  2W14 A;  3LQ0 A;  3LIR A;  1MMQ A;  1BKC A;  3WV3 A;  1HFS A;  1KUK A;  4Q1L A;  3DWB A;  2O36 A;  4GWN A;  2OW1 A;  1BUV M;  4FVL A;  1QUA A;  456C A;  2OW0 A;  3I7G A;  1OS9 A;  2XS4 A;  4IUW A;  1Z3J A;  3DPF A;  4JQG A;  3B8Z A;  4JPA A;  4PKS A;  3TVC A;  4H3X A;  1IAE A;  3CKI A;  1C8T A;  1YCM A;  1HFC A;  2J83 A;  3SHI A;  3AYK A;  1Y93 A;  1JAN A;  4G9L A;  4IN9 A;  5I43 A;  3DTI A;  2MZI A;  1S4B P;  3G5C A;  2O3E A;  3EDI A;  4L7A A;  1JAQ A;  3KMC A;  2Y6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...