3HDBA

Crystal structure of aahiv, a metalloproteinase from venom of agkistrodon acutus
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
417
structure length
417
Chain Sequence
YDPFKYVETVFVVDKAMVTKYNGDLDKIKTKMYEAANNMNEMYRYMFFRVVMVGLIIWTEEDKITVKPDVDYTLNAFAEWRKTYLLAEKKHDNAQLITGIDFRGSIIGYAYIGSMCHPKRSVGIIQDYSPINLVLAVIMAHEMGHNLGIHHDDGYCYCGGYPCIMGPSISPEPSKFFSNCSYIQCWDFIMNHNPECIDNEPLGTDIISPPLCGNELLEVGEECDCGTPENCQNPCCDAATCKLKSGSQCGHGKCCEQCKFRTSGTECRASMSECDPAEHCTGQSSECPADVFHKNGEPCLDNYGYCYNGNCPIMYHQCYALFGADIYEAEDSCFESNKKGNYYGYCRKENGKKIPCASEDVKCGRLYCKDDSPGQNNPCKMFYSNDDEHKGMVLPGTKCADGKVCSNGHCVDVTTAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAHIV
publication title Structural basis of the autolysis of AaHIV suggests a novel target recognizing model for ADAM/reprolysin family proteins
pubmed doi rcsb
molecule tags Hydrolase
total genus 123
structure length 417
sequence length 417
ec nomenclature ec 3.4.24.-:
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hdbA01
1GKDA 3BA0A 4PKUA 2OY4A 1S4BP 5BOTA 1KUHA 4J4MA 2JNPA 3HDBA 1JIZA 1YP1A 1IAAA 2YIGA 1C8TA 2O36A 4H3XA 3AYKA 2WO8A 3USNA 4IJOA 1JJ9A 1A85A 1GE6A 1HFCA 2OXWA 1KUKA 1Y0VA 1C7KA 2DW2A 3MA2A 2MLRA 1B8YA 2XS3A 1UMSA 1OS9A 3F15A 1CGEA 4PKWA 4AIGA 1WNIA 1Y93A 4H30A 1G05A 3F1AA 1SLNA 1BSWA 2MLSA 3Q2GA 1ND1A 3I7GA 830CA 2N8RA 4XM8A 4A7BA 3DSLA 1XFVA 1BM6A 1RM8A 2POJA 5D2BA 5D1SA 2MZEA 2OVXA 4ON1A 3B2ZA 1XFUA 3LIKA 1SATA 2K9CA 4XBHA 1XURA 3HDAP 3TVCA 1OM7A 456CA 1L6JA 3F18A 2J0TA 1K7GA 2J83A 3VI1A 2FV5A 5L79A 1QJIA 1OO9A 1MMPA 3KMCA 1XFYA 2OW0A 1ASTA 1BZSA 3HYGA 4XM7A 3EHYA 5I43A 1AYKA 3O64A 3LEAA 1D5JA 3CKIA 5CUHA 3RTTA 1H71P 1UEAA 2DDYA 4GR8A 4GWMA 5L7FA 1BUVM 3LE9A 2XS4A 966CA 1DMTA 3G42A 2O3EA 1GO7P 4QKZA 1K7QA 2CKIA 2V4BA 3O2XA 2D1NA 1ZTQA 3EDHA 1AKLA 3LJTA 1ATLA 1QIBA 3EDIA 1JIWP 2KRJA 2OVZA 5I4OA 2OXUA 1AF0A 4JQGA 1BQOA 3OHOA 3EHXA 2JT5A 5JMYA 4WK7A 3K7LA 3V96B 2W14A 2RJPA 3KEJA 1G4KA 2W13A 2X7MA 1O0TA 2OZRA 3SHIA 4GR0A 1SRPA 2SRTA 3F16A 3L0VA 5H8XA 3L0TA 1HFSA 3DNGA 1B3DA 1K7IA 2I47A 1GE7A 4Q1LA 3NX7A 1DTHA 3EDGA 1PWQA 4JIJA 4PKVA 1HOVA 5D1TA 1QICA 3TT4A 1CGFA 1CK7A 1GXDA 2DW0A 4GQLA 5BPAA 4AXQA 3AIGA 3EWJA 4JPAA 1OM8A 1OS2A 4EFSA 4L63A 3WV2A 1EUBA 3HB2P 1I76A 2DDFA 1HV5A 1SU3A 4G0DA 4DD8A 1D8FA 1BQQM 1IAEA 3OHLA 1I1IP 1QUAA 1YQYA 4WF6A 1PWVA 5I3MA 4WKEA 3RTSA 2A8HA 3N2UA 1HY7A 1QJJA 4WZVA 5LABA 5D3CA 1MMBA 1BKCE 3ELMA 2JT6A 3K7NA 3DPFA 1ZVXA 1GKCA 2X3CA 3WV3A 1Y8JA 4ZR5A 5I2ZA 4I35A 4XCTA 4PKSA 4L19A 4GUYA 2L0RA 4G9LA 1YCMA 4PKTA 3WV1A 1O0QA 2AIGP 1FLSA 1R1IA 3DPEA 3ZUKA 2OW2A 3G5CA 3DWBA 4PKQA 1UTTA 4XM6A 3N2VA 3Q2HA 3EDZA 1JANA 1UMTA 3LUMA 1ZS0A 3HBUP 1KBCA 2X3AA 2X3BA 2Y6DA 3F19A 2OI0A 1PWPA 1JKYA 1BKCI 3P1VA 3LGPA 2MZIA 3U1RA 1YOUA 4AUOA 4HX3A 2E3XA 3KRYA 1G9KA 4AYKA 5I0LA 3AYUA 1JAQA 4H49A 1BUDA 1CGLA 1R1JA 2K2GA 4H84A 1CIZA 5D1UA 4L6TA 4H82A 1JH1A 1PWWA 3LJZA 3LQBA 5CXAA 2W12A 1ROSA 1R55A 1Q3AA 4HMAA 3LKAA 2CLTA 4FU4A 1J7NA 2D1OA 4I03A 1D7XA 1Z3JA 3KECA 4R3VA 1JAPA 3KEKA 4FXYP 4DV8A 2ERPA 4PKRA 3LQ0A 5D7WA 2FV9A 1OMJA 5CZMA 1IAGA 2TCLA 4CTHA 4JA1A 1CXVA 3TSKA 1IADA 4DPEA 1HTDA 3P24A 5B5PA 1KUGA 2AYKA 3LK8A 2USNA 4IN9A 1IABA 3HY9A 1PWUA 3HBVP 1ZP5A 3LILA 1KUIA 1GO8P 3KHIA 3E8RA 2OXZA 2HU6A 1SLMA 3ZXHA 5B5OA 1USNA 1G49A 3ZVSA 4A3WA 1XFXA 3I7IA 2MZHA 4GR3A 3GBOA 1EAKA 1ZXCA 2OW9A 2W15A 1ZXVA 2JSDA 3KMEA 1IACA 1MNCA 2ERQA 1GE5A 2WO9A 3B92A 4FVLA 1OM6A 1FM1A 3KWVC 3LJGA 1SMPA 3TS4A 2OW1A 1R54A 1C3IA 4WKIA 1XFWA 3LMCA 4JP4A 1RMZA 1CAQA 3VTGA 3LUNA 1R1HA 2RJQA 3B8ZA 2JIHA 2E2DA 4H2EA 1G12A 4GF1A 4DF9A 3DL1A 1CQRA 3F17A 1KUFA 2DW1A 1EB6A 4GWNA 1UTZA 5I12A 2Z2DA 2EROA 1JAOA 4H1QA 1XUCA 2QPJA 3LIRA 1I73A 1FBLA 1BIWA 2PJTA 2W0DA 4FXQA 1XUDA 1XFZA 2Y6CA 4H76A 3HY7A 1A86A 2YB9A 5BOYA 1QIAA 4ILWD 1MMRA 3UVCA 2OY2A 4IUWA 1KAPP 2WOAA 1BKCA 1JK3A 1D8MA 1MMQA
chains in the Genus database with same CATH superfamily
1GKDA 3BA0A 4PKUA 2OY4A 1S4BP 5BOTA 1KUHA 4J4MA 2JNPA 3HDBA 1JIZA 1YP1A 1IAAA 2YIGA 1C8TA 2O36A 4H3XA 3AYKA 2WO8A 3USNA 4IJOA 1OZ9A 1JJ9A 1A85A 1GE6A 1HFCA 2OXWA 1KUKA 1Y0VA 1C7KA 2DW2A 2YUFA 3MA2A 2MLRA 1B8YA 2XS3A 1UMSA 1OS9A 3F15A 1CGEA 4PKWA 4AIGA 1WNIA 1Y93A 4H30A 1G05A 3F1AA 1SLNA 1BSWA 2MLSA 3DTEA 3Q2GA 1ND1A 3I7GA 830CA 2N8RA 4XM8A 4A7BA 3DSLA 1XFVA 1BM6A 1RM8A 2POJA 5D2BA 5D1SA 2MZEA 2OVXA 4ON1A 3B2ZA 1XFUA 3LIKA 1SATA 2K9CA 4XBHA 1XURA 3HDAP 3TVCA 1OM7A 456CA 1L6JA 3F18A 2J0TA 1K7GA 2J83A 3VI1A 2FV5A 5L79A 1QJIA 1OO9A 1MMPA 3KMCA 1XFYA 2OW0A 1ASTA 1BZSA 3HYGA 4XM7A 3EHYA 5I43A 1AYKA 3O64A 3LEAA 1D5JA 3CKIA 5CUHA 3RTTA 1H71P 1UEAA 2DDYA 4GR8A 4GWMA 5L7FA 1BUVM 3LE9A 2XS4A 966CA 1DMTA 3G42A 2O3EA 1GO7P 4QKZA 1K7QA 2CKIA 2V4BA 3O2XA 2D1NA 1ZTQA 3EDHA 1AKLA 3LJTA 1ATLA 1QIBA 1XM5A 3EDIA 1JIWP 2KRJA 2OVZA 5I4OA 2OXUA 1AF0A 4JQGA 1BQOA 3OHOA 3EHXA 2JT5A 5JMYA 4WK7A 3K7LA 3V96B 2W14A 2RJPA 3KEJA 1G4KA 2W13A 2X7MA 1O0TA 2OZRA 3SHIA 4GR0A 1SRPA 2SRTA 3F16A 3L0VA 5H8XA 3L0TA 1HFSA 3DNGA 1B3DA 1K7IA 2I47A 1GE7A 4Q1LA 3NX7A 1DTHA 3EDGA 1PWQA 4JIJA 4PKVA 1HOVA 5D1TA 1QICA 3TT4A 1CGFA 1CK7A 1GXDA 2DW0A 4GQLA 5BPAA 4AXQA 3AIGA 3EWJA 4JPAA 1OM8A 1OS2A 4EFSA 4L63A 3WV2A 1EUBA 3HB2P 1I76A 2DDFA 1HV5A 1SU3A 4G0DA 4DD8A 1D8FA 1BQQM 1IAEA 3OHLA 1I1IP 1QUAA 1YQYA 4WF6A 1PWVA 5I3MA 4WKEA 3RTSA 2A8HA 3N2UA 1HY7A 1QJJA 4WZVA 5LABA 5D3CA 1MMBA 1BKCE 3ELMA 2JT6A 3K7NA 3DPFA 1ZVXA 1GKCA 2X3CA 3WV3A 1Y8JA 4ZR5A 5I2ZA 4I35A 4XCTA 4PKSA 3DTKA 4L19A 4GUYA 2L0RA 4G9LA 1YCMA 4PKTA 3WV1A 1O0QA 2AIGP 1FLSA 1R1IA 3DPEA 3ZUKA 2OW2A 3G5CA 3DWBA 4PKQA 1UTTA 4XM6A 3N2VA 3Q2HA 3EDZA 1JANA 1UMTA 3LUMA 1ZS0A 3HBUP 1KBCA 2X3AA 2X3BA 2Y6DA 3F19A 2OI0A 1PWPA 1JKYA 1BKCI 3P1VA 3LGPA 2MZIA 3U1RA 1YOUA 4AUOA 4HX3A 2E3XA 3KRYA 1G9KA 4AYKA 5I0LA 3AYUA 1JAQA 4H49A 1BUDA 1CGLA 1R1JA 1XAXA 2K2GA 4H84A 1CIZA 5D1UA 4L6TA 4H82A 1JH1A 1PWWA 3LJZA 3LQBA 5CXAA 2W12A 1ROSA 1R55A 1Q3AA 4HMAA 3LKAA 2CLTA 4FU4A 1J7NA 2D1OA 4I03A 1D7XA 1Z3JA 3KECA 4R3VA 1JAPA 3KEKA 4FXYP 4DV8A 2ERPA 4PKRA 3LQ0A 5D7WA 2FV9A 1OMJA 5CZMA 1IAGA 2TCLA 4CTHA 4JA1A 1CXVA 3TSKA 1IADA 4DPEA 1HTDA 3P24A 5B5PA 1KUGA 2AYKA 3LK8A 2USNA 4IN9A 1IABA 3HY9A 1PWUA 3HBVP 1ZP5A 3LILA 1KUIA 1GO8P 3KHIA 3E8RA 2OXZA 2HU6A 1TVIA 1SLMA 3ZXHA 5B5OA 1USNA 1G49A 3ZVSA 4A3WA 1XFXA 3I7IA 2MZHA 4GR3A 3GBOA 1EAKA 1ZXCA 2OW9A 2W15A 1ZXVA 2JSDA 3KMEA 4L7AA 1IACA 1MNCA 2ERQA 1GE5A 2WO9A 3B92A 4FVLA 1OM6A 1FM1A 3KWVC 3LJGA 1SMPA 3TS4A 2OW1A 1R54A 1C3IA 4WKIA 1XFWA 3LMCA 4JP4A 1RMZA 1CAQA 3VTGA 3LUNA 1R1HA 2RJQA 3B8ZA 2JIHA 2E2DA 4H2EA 1G12A 4GF1A 4DF9A 3DL1A 1CQRA 3F17A 1KUFA 2DW1A 1EB6A 4GWNA 1UTZA 5I12A 2Z2DA 2EROA 1JAOA 4H1QA 1XUCA 2QPJA 3LIRA 1I73A 1FBLA 1BIWA 2PJTA 2W0DA 4FXQA 1XUDA 1XFZA 2Y6CA 4H76A 3HY7A 1A86A 2YB9A 5BOYA 1QIAA 4ILWD 1MMRA 3UVCA 2OY2A 4IUWA 1KAPP 2WOAA 1BKCA 3DTIA 1JK3A 1D8MA 1MMQA
chains in the Genus database with same CATH topology
1GKDA 3BA0A 4PKUA 2OY4A 1S4BP 5BOTA 1KUHA 4J4MA 2JNPA 3HDBA 1JIZA 1YP1A 1IAAA 2YIGA 1C8TA 2O36A 4H3XA 3AYKA 2WO8A 3USNA 4IJOA 1JJ9A 1A85A 1GE6A 1HFCA 2OXWA 1KUKA 1Y0VA 1C7KA 2DW2A 2YUFA 3MA2A 2MLRA 1B8YA 2XS3A 1UMSA 1OS9A 3F15A 1CGEA 4PKWA 4AIGA 1WNIA 1Y93A 4H30A 1G05A 3F1AA 1SLNA 1BSWA 2MLSA 3DTEA 3Q2GA 1ND1A 3I7GA 830CA 2N8RA 4XM8A 4A7BA 3DSLA 1XFVA 1BM6A 1RM8A 2POJA 5D2BA 5D1SA 2MZEA 2OVXA 4ON1A 3B2ZA 1XFUA 3LIKA 1SATA 2K9CA 4XBHA 1XURA 3HDAP 3TVCA 1OM7A 456CA 1L6JA 3F18A 2J0TA 1K7GA 2J83A 3VI1A 2FV5A 5L79A 1QJIA 1OO9A 1MMPA 3KMCA 1XFYA 2OW0A 1ASTA 1BZSA 3HYGA 4XM7A 3EHYA 5I43A 1AYKA 3O64A 3LEAA 1D5JA 3CKIA 5CUHA 3RTTA 1H71P 1UEAA 2DDYA 4GR8A 4GWMA 5L7FA 1BUVM 3LE9A 2XS4A 966CA 1DMTA 3G42A 2O3EA 1GO7P 4QKZA 1K7QA 2CKIA 2V4BA 3O2XA 2D1NA 1ZTQA 3EDHA 1AKLA 3LJTA 1ATLA 1QIBA 3EDIA 1JIWP 2KRJA 2OVZA 5I4OA 2OXUA 1AF0A 4JQGA 1BQOA 3OHOA 3EHXA 2JT5A 5JMYA 4WK7A 3K7LA 3V96B 2W14A 2RJPA 3KEJA 1G4KA 2W13A 2X7MA 1O0TA 2OZRA 3SHIA 4GR0A 1SRPA 2SRTA 3F16A 3L0VA 5H8XA 3L0TA 1HFSA 3DNGA 1B3DA 1K7IA 2I47A 1GE7A 4Q1LA 3NX7A 1DTHA 3EDGA 1PWQA 4JIJA 4PKVA 1HOVA 5D1TA 1QICA 3TT4A 1CGFA 1CK7A 1GXDA 2DW0A 4GQLA 5BPAA 4AXQA 3AIGA 3EWJA 4JPAA 1OM8A 1OS2A 4EFSA 4L63A 3WV2A 1EUBA 3HB2P 1I76A 2DDFA 1HV5A 1SU3A 4G0DA 4DD8A 1D8FA 1BQQM 1IAEA 3OHLA 1I1IP 1QUAA 1YQYA 4WF6A 1PWVA 5I3MA 4WKEA 3RTSA 2A8HA 3N2UA 1HY7A 1QJJA 4WZVA 5LABA 5D3CA 1MMBA 1BKCE 3ELMA 2JT6A 3K7NA 3DPFA 1ZVXA 1GKCA 2X3CA 3WV3A 1Y8JA 4ZR5A 5I2ZA 4I35A 4XCTA 4PKSA 3DTKA 4L19A 4GUYA 2L0RA 4G9LA 1YCMA 4PKTA 3WV1A 1O0QA 2AIGP 1FLSA 1R1IA 3DPEA 3ZUKA 2OW2A 3G5CA 3DWBA 4PKQA 1UTTA 4XM6A 3N2VA 3Q2HA 3EDZA 1JANA 1UMTA 3LUMA 1ZS0A 3HBUP 1KBCA 2X3AA 2X3BA 2Y6DA 3F19A 2OI0A 1PWPA 1JKYA 1BKCI 3P1VA 3LGPA 2MZIA 3U1RA 1YOUA 4AUOA 4HX3A 2E3XA 3KRYA 1G9KA 4AYKA 5I0LA 3AYUA 1JAQA 4H49A 1BUDA 1CGLA 1R1JA 2K2GA 4H84A 1CIZA 5D1UA 4L6TA 4H82A 1JH1A 1PWWA 3LJZA 3LQBA 5CXAA 2W12A 1ROSA 1R55A 1Q3AA 4HMAA 3LKAA 2CLTA 4FU4A 1J7NA 2D1OA 4I03A 1D7XA 1Z3JA 3KECA 4R3VA 1JAPA 3KEKA 4FXYP 4DV8A 2ERPA 4PKRA 3LQ0A 5D7WA 2FV9A 1OMJA 5CZMA 1IAGA 2TCLA 4CTHA 4JA1A 1CXVA 3TSKA 1IADA 4DPEA 1HTDA 3P24A 5B5PA 1KUGA 2AYKA 3LK8A 2USNA 4IN9A 1IABA 3HY9A 1PWUA 3HBVP 1ZP5A 3LILA 1KUIA 1GO8P 3KHIA 3E8RA 2OXZA 2HU6A 1SLMA 3ZXHA 5B5OA 1USNA 1G49A 3ZVSA 4A3WA 1XFXA 3I7IA 2MZHA 4GR3A 3GBOA 1EAKA 1ZXCA 2OW9A 2W15A 1ZXVA 2JSDA 3KMEA 4L7AA 1IACA 1MNCA 2ERQA 1GE5A 2WO9A 3B92A 4FVLA 1OM6A 1FM1A 3KWVC 3LJGA 1SMPA 3TS4A 2OW1A 1R54A 1C3IA 4WKIA 1XFWA 3LMCA 4JP4A 1RMZA 1CAQA 3VTGA 3LUNA 1R1HA 2RJQA 3B8ZA 2JIHA 2E2DA 4H2EA 1G12A 4GF1A 4DF9A 3DL1A 1CQRA 3F17A 1KUFA 2DW1A 1EB6A 4GWNA 1UTZA 5I12A 2Z2DA 2EROA 1JAOA 4H1QA 1XUCA 2QPJA 3LIRA 1I73A 1FBLA 1BIWA 2PJTA 2W0DA 4FXQA 1XUDA 1XFZA 2Y6CA 4H76A 3HY7A 1A86A 2YB9A 5BOYA 1QIAA 4ILWD 1MMRA 3UVCA 2OY2A 4IUWA 1KAPP 2WOAA 1BKCA 3DTIA 1JK3A 1D8MA 1MMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKD A;  3BA0 A;  4PKU A;  2OY4 A;  1S4B P;  5BOT A;  1KUH A;  4J4M A;  2JNP A;  3HDB A;  1JIZ A;  1YP1 A;  1IAA A;  2YIG A;  1C8T A;  2O36 A;  4H3X A;  3AYK A;  2WO8 A;  3USN A;  4IJO A;  1JJ9 A;  1A85 A;  1GE6 A;  1HFC A;  2OXW A;  1KUK A;  1Y0V A;  1C7K A;  2DW2 A;  3MA2 A;  2MLR A;  1B8Y A;  2XS3 A;  1UMS A;  1OS9 A;  3F15 A;  1CGE A;  4PKW A;  4AIG A;  1WNI A;  1Y93 A;  4H30 A;  1G05 A;  3F1A A;  1SLN A;  1BSW A;  2MLS A;  3Q2G A;  1ND1 A;  3I7G A;  830C A;  2N8R A;  4XM8 A;  4A7B A;  3DSL A;  1XFV A;  1BM6 A;  1RM8 A;  2POJ A;  5D2B A;  5D1S A;  2MZE A;  2OVX A;  4ON1 A;  3B2Z A;  1XFU A;  3LIK A;  1SAT A;  2K9C A;  4XBH A;  1XUR A;  3HDA P;  3TVC A;  1OM7 A;  456C A;  1L6J A;  3F18 A;  2J0T A;  1K7G A;  2J83 A;  3VI1 A;  2FV5 A;  5L79 A;  1QJI A;  1OO9 A;  1MMP A;  3KMC A;  1XFY A;  2OW0 A;  1AST A;  1BZS A;  3HYG A;  4XM7 A;  3EHY A;  5I43 A;  1AYK A;  3O64 A;  3LEA A;  1D5J A;  3CKI A;  5CUH A;  3RTT A;  1H71 P;  1UEA A;  2DDY A;  4GR8 A;  4GWM A;  5L7F A;  1BUV M;  3LE9 A;  2XS4 A;  966C A;  1DMT A;  3G42 A;  2O3E A;  1GO7 P;  4QKZ A;  1K7Q A;  2CKI A;  2V4B A;  3O2X A;  2D1N A;  1ZTQ A;  3EDH A;  1AKL A;  3LJT A;  1ATL A;  1QIB A;  3EDI A;  1JIW P;  2KRJ A;  2OVZ A;  5I4O A;  2OXU A;  1AF0 A;  4JQG A;  1BQO A;  3OHO A;  3EHX A;  2JT5 A;  5JMY A;  4WK7 A;  3K7L A;  3V96 B;  2W14 A;  2RJP A;  3KEJ A;  1G4K A;  2W13 A;  2X7M A;  1O0T A;  2OZR A;  3SHI A;  4GR0 A;  1SRP A;  2SRT A;  3F16 A;  3L0V A;  5H8X A;  3L0T A;  1HFS A;  3DNG A;  1B3D A;  1K7I A;  2I47 A;  1GE7 A;  4Q1L A;  3NX7 A;  1DTH A;  3EDG A;  1PWQ A;  4JIJ A;  4PKV A;  1HOV A;  5D1T A;  1QIC A;  3TT4 A;  1CGF A;  1CK7 A;  1GXD A;  2DW0 A;  4GQL A;  5BPA A;  4AXQ A;  3AIG A;  3EWJ A;  4JPA A;  1OM8 A;  1OS2 A;  4EFS A;  4L63 A;  3WV2 A;  1EUB A;  3HB2 P;  1I76 A;  2DDF A;  1HV5 A;  1SU3 A;  4G0D A;  4DD8 A;  1D8F A;  1BQQ M;  1IAE A;  3OHL A;  1I1I P;  1QUA A;  1YQY A;  4WF6 A;  1PWV A;  5I3M A;  4WKE A;  3RTS A;  2A8H A;  3N2U A;  1HY7 A;  1QJJ A;  4WZV A;  5LAB A;  5D3C A;  1MMB A;  1BKC E;  3ELM A;  2JT6 A;  3K7N A;  3DPF A;  1ZVX A;  1GKC A;  2X3C A;  3WV3 A;  1Y8J A;  4ZR5 A;  5I2Z A;  4I35 A;  4XCT A;  4PKS A;  4L19 A;  4GUY A;  2L0R A;  4G9L A;  1YCM A;  4PKT A;  3WV1 A;  1O0Q A;  2AIG P;  1FLS A;  1R1I A;  3DPE A;  3ZUK A;  2OW2 A;  3G5C A;  3DWB A;  4PKQ A;  1UTT A;  4XM6 A;  3N2V A;  3Q2H A;  3EDZ A;  1JAN A;  1UMT A;  3LUM A;  1ZS0 A;  3HBU P;  1KBC A;  2X3A A;  2X3B A;  2Y6D A;  3F19 A;  2OI0 A;  1PWP A;  1JKY A;  1BKC I;  3P1V A;  3LGP A;  2MZI A;  3U1R A;  1YOU A;  4AUO A;  4HX3 A;  2E3X A;  3KRY A;  1G9K A;  4AYK A;  5I0L A;  3AYU A;  1JAQ A;  4H49 A;  1BUD A;  1CGL A;  1R1J A;  2K2G A;  4H84 A;  1CIZ A;  5D1U A;  4L6T A;  4H82 A;  1JH1 A;  1PWW A;  3LJZ A;  3LQB A;  5CXA A;  2W12 A;  1ROS A;  1R55 A;  1Q3A A;  4HMA A;  3LKA A;  2CLT A;  4FU4 A;  1J7N A;  2D1O A;  4I03 A;  1D7X A;  1Z3J A;  3KEC A;  4R3V A;  1JAP A;  3KEK A;  4FXY P;  4DV8 A;  2ERP A;  4PKR A;  3LQ0 A;  5D7W A;  2FV9 A;  1OMJ A;  5CZM A;  1IAG A;  2TCL A;  4CTH A;  4JA1 A;  1CXV A;  3TSK A;  1IAD A;  4DPE A;  1HTD A;  3P24 A;  5B5P A;  1KUG A;  2AYK A;  3LK8 A;  2USN A;  4IN9 A;  1IAB A;  3HY9 A;  1PWU A;  3HBV P;  1ZP5 A;  3LIL A;  1KUI A;  1GO8 P;  3KHI A;  3E8R A;  2OXZ A;  2HU6 A;  1SLM A;  3ZXH A;  5B5O A;  1USN A;  1G49 A;  3ZVS A;  4A3W A;  1XFX A;  3I7I A;  2MZH A;  4GR3 A;  3GBO A;  1EAK A;  1ZXC A;  2OW9 A;  2W15 A;  1ZXV A;  2JSD A;  3KME A;  1IAC A;  1MNC A;  2ERQ A;  1GE5 A;  2WO9 A;  3B92 A;  4FVL A;  1OM6 A;  1FM1 A;  3KWV C;  3LJG A;  1SMP A;  3TS4 A;  2OW1 A;  1R54 A;  1C3I A;  4WKI A;  1XFW A;  3LMC A;  4JP4 A;  1RMZ A;  1CAQ A;  3VTG A;  3LUN A;  1R1H A;  2RJQ A;  3B8Z A;  2JIH A;  2E2D A;  4H2E A;  1G12 A;  4GF1 A;  4DF9 A;  3DL1 A;  1CQR A;  3F17 A;  1KUF A;  2DW1 A;  1EB6 A;  4GWN A;  1UTZ A;  5I12 A;  2Z2D A;  2ERO A;  1JAO A;  4H1Q A;  1XUC A;  2QPJ A;  3LIR A;  1I73 A;  1FBL A;  1BIW A;  2PJT A;  2W0D A;  4FXQ A;  1XUD A;  1XFZ A;  2Y6C A;  4H76 A;  3HY7 A;  1A86 A;  2YB9 A;  5BOY A;  1QIA A;  4ILW D;  1MMR A;  3UVC A;  2OY2 A;  4IUW A;  1KAP P;  2WOA A;  1BKC A;  1JK3 A;  1D8M A;  1MMQ A; 
#chains in the Genus database with same CATH topology
 1GKD A;  3BA0 A;  4PKU A;  2OY4 A;  1S4B P;  5BOT A;  1KUH A;  4J4M A;  2JNP A;  3HDB A;  1JIZ A;  1YP1 A;  1IAA A;  2YIG A;  1C8T A;  2O36 A;  4H3X A;  3AYK A;  2WO8 A;  3USN A;  4IJO A;  1OZ9 A;  1JJ9 A;  1A85 A;  1GE6 A;  1HFC A;  2OXW A;  1KUK A;  1Y0V A;  1C7K A;  2DW2 A;  2YUF A;  3MA2 A;  2MLR A;  1B8Y A;  2XS3 A;  1UMS A;  1OS9 A;  3F15 A;  1CGE A;  4PKW A;  4AIG A;  1WNI A;  1Y93 A;  4H30 A;  1G05 A;  3F1A A;  1SLN A;  1BSW A;  2MLS A;  3DTE A;  3Q2G A;  1ND1 A;  3I7G A;  830C A;  2N8R A;  4XM8 A;  4A7B A;  3DSL A;  1XFV A;  1BM6 A;  1RM8 A;  2POJ A;  5D2B A;  5D1S A;  2MZE A;  2OVX A;  4ON1 A;  3B2Z A;  1XFU A;  3LIK A;  1SAT A;  2K9C A;  4XBH A;  1XUR A;  3HDA P;  3TVC A;  1OM7 A;  456C A;  1L6J A;  3F18 A;  2J0T A;  1K7G A;  2J83 A;  3VI1 A;  2FV5 A;  5L79 A;  1QJI A;  1OO9 A;  1MMP A;  3KMC A;  1XFY A;  2OW0 A;  1AST A;  1BZS A;  3HYG A;  4XM7 A;  3EHY A;  5I43 A;  1AYK A;  3O64 A;  3LEA A;  1D5J A;  3CKI A;  5CUH A;  3RTT A;  1H71 P;  1UEA A;  2DDY A;  4GR8 A;  4GWM A;  5L7F A;  1BUV M;  3LE9 A;  2XS4 A;  966C A;  1DMT A;  3G42 A;  2O3E A;  1GO7 P;  4QKZ A;  1K7Q A;  2CKI A;  2V4B A;  3O2X A;  2D1N A;  1ZTQ A;  3EDH A;  1AKL A;  3LJT A;  1ATL A;  1QIB A;  1XM5 A;  3EDI A;  1JIW P;  2KRJ A;  2OVZ A;  5I4O A;  2OXU A;  1AF0 A;  4JQG A;  1BQO A;  3OHO A;  3EHX A;  2JT5 A;  5JMY A;  4WK7 A;  3K7L A;  3V96 B;  2W14 A;  2RJP A;  3KEJ A;  1G4K A;  2W13 A;  2X7M A;  1O0T A;  2OZR A;  3SHI A;  4GR0 A;  1SRP A;  2SRT A;  3F16 A;  3L0V A;  5H8X A;  3L0T A;  1HFS A;  3DNG A;  1B3D A;  1K7I A;  2I47 A;  1GE7 A;  4Q1L A;  3NX7 A;  1DTH A;  3EDG A;  1PWQ A;  4JIJ A;  4PKV A;  1HOV A;  5D1T A;  1QIC A;  3TT4 A;  1CGF A;  1CK7 A;  1GXD A;  2DW0 A;  4GQL A;  5BPA A;  4AXQ A;  3AIG A;  3EWJ A;  4JPA A;  1OM8 A;  1OS2 A;  4EFS A;  4L63 A;  3WV2 A;  1EUB A;  3HB2 P;  1I76 A;  2DDF A;  1HV5 A;  1SU3 A;  4G0D A;  4DD8 A;  1D8F A;  1BQQ M;  1IAE A;  3OHL A;  1I1I P;  1QUA A;  1YQY A;  4WF6 A;  1PWV A;  5I3M A;  4WKE A;  3RTS A;  2A8H A;  3N2U A;  1HY7 A;  1QJJ A;  4WZV A;  5LAB A;  5D3C A;  1MMB A;  1BKC E;  3ELM A;  2JT6 A;  3K7N A;  3DPF A;  1ZVX A;  1GKC A;  2X3C A;  3WV3 A;  1Y8J A;  4ZR5 A;  5I2Z A;  4I35 A;  4XCT A;  4PKS A;  3DTK A;  4L19 A;  4GUY A;  2L0R A;  4G9L A;  1YCM A;  4PKT A;  3WV1 A;  1O0Q A;  2AIG P;  1FLS A;  1R1I A;  3DPE A;  3ZUK A;  2OW2 A;  3G5C A;  3DWB A;  4PKQ A;  1UTT A;  4XM6 A;  3N2V A;  3Q2H A;  3EDZ A;  1JAN A;  1UMT A;  3LUM A;  1ZS0 A;  3HBU P;  1KBC A;  2X3A A;  2X3B A;  2Y6D A;  3F19 A;  2OI0 A;  1PWP A;  1JKY A;  1BKC I;  3P1V A;  3LGP A;  2MZI A;  3U1R A;  1YOU A;  4AUO A;  4HX3 A;  2E3X A;  3KRY A;  1G9K A;  4AYK A;  5I0L A;  3AYU A;  1JAQ A;  4H49 A;  1BUD A;  1CGL A;  1R1J A;  1XAX A;  2K2G A;  4H84 A;  1CIZ A;  5D1U A;  4L6T A;  4H82 A;  1JH1 A;  1PWW A;  3LJZ A;  3LQB A;  5CXA A;  2W12 A;  1ROS A;  1R55 A;  1Q3A A;  4HMA A;  3LKA A;  2CLT A;  4FU4 A;  1J7N A;  2D1O A;  4I03 A;  1D7X A;  1Z3J A;  3KEC A;  4R3V A;  1JAP A;  3KEK A;  4FXY P;  4DV8 A;  2ERP A;  4PKR A;  3LQ0 A;  5D7W A;  2FV9 A;  1OMJ A;  5CZM A;  1IAG A;  2TCL A;  4CTH A;  4JA1 A;  1CXV A;  3TSK A;  1IAD A;  4DPE A;  1HTD A;  3P24 A;  5B5P A;  1KUG A;  2AYK A;  3LK8 A;  2USN A;  4IN9 A;  1IAB A;  3HY9 A;  1PWU A;  3HBV P;  1ZP5 A;  3LIL A;  1KUI A;  1GO8 P;  3KHI A;  3E8R A;  2OXZ A;  2HU6 A;  1TVI A;  1SLM A;  3ZXH A;  5B5O A;  1USN A;  1G49 A;  3ZVS A;  4A3W A;  1XFX A;  3I7I A;  2MZH A;  4GR3 A;  3GBO A;  1EAK A;  1ZXC A;  2OW9 A;  2W15 A;  1ZXV A;  2JSD A;  3KME A;  4L7A A;  1IAC A;  1MNC A;  2ERQ A;  1GE5 A;  2WO9 A;  3B92 A;  4FVL A;  1OM6 A;  1FM1 A;  3KWV C;  3LJG A;  1SMP A;  3TS4 A;  2OW1 A;  1R54 A;  1C3I A;  4WKI A;  1XFW A;  3LMC A;  4JP4 A;  1RMZ A;  1CAQ A;  3VTG A;  3LUN A;  1R1H A;  2RJQ A;  3B8Z A;  2JIH A;  2E2D A;  4H2E A;  1G12 A;  4GF1 A;  4DF9 A;  3DL1 A;  1CQR A;  3F17 A;  1KUF A;  2DW1 A;  1EB6 A;  4GWN A;  1UTZ A;  5I12 A;  2Z2D A;  2ERO A;  1JAO A;  4H1Q A;  1XUC A;  2QPJ A;  3LIR A;  1I73 A;  1FBL A;  1BIW A;  2PJT A;  2W0D A;  4FXQ A;  1XUD A;  1XFZ A;  2Y6C A;  4H76 A;  3HY7 A;  1A86 A;  2YB9 A;  5BOY A;  1QIA A;  4ILW D;  1MMR A;  3UVC A;  2OY2 A;  4IUW A;  1KAP P;  2WOA A;  1BKC A;  3DTI A;  1JK3 A;  1D8M A;  1MMQ A; 
#chains in the Genus database with same CATH homology
 1GKD A;  3BA0 A;  4PKU A;  2OY4 A;  1S4B P;  5BOT A;  1KUH A;  4J4M A;  2JNP A;  3HDB A;  1JIZ A;  1YP1 A;  1IAA A;  2YIG A;  1C8T A;  2O36 A;  4H3X A;  3AYK A;  2WO8 A;  3USN A;  4IJO A;  1JJ9 A;  1A85 A;  1GE6 A;  1HFC A;  2OXW A;  1KUK A;  1Y0V A;  1C7K A;  2DW2 A;  2YUF A;  3MA2 A;  2MLR A;  1B8Y A;  2XS3 A;  1UMS A;  1OS9 A;  3F15 A;  1CGE A;  4PKW A;  4AIG A;  1WNI A;  1Y93 A;  4H30 A;  1G05 A;  3F1A A;  1SLN A;  1BSW A;  2MLS A;  3DTE A;  3Q2G A;  1ND1 A;  3I7G A;  830C A;  2N8R A;  4XM8 A;  4A7B A;  3DSL A;  1XFV A;  1BM6 A;  1RM8 A;  2POJ A;  5D2B A;  5D1S A;  2MZE A;  2OVX A;  4ON1 A;  3B2Z A;  1XFU A;  3LIK A;  1SAT A;  2K9C A;  4XBH A;  1XUR A;  3HDA P;  3TVC A;  1OM7 A;  456C A;  1L6J A;  3F18 A;  2J0T A;  1K7G A;  2J83 A;  3VI1 A;  2FV5 A;  5L79 A;  1QJI A;  1OO9 A;  1MMP A;  3KMC A;  1XFY A;  2OW0 A;  1AST A;  1BZS A;  3HYG A;  4XM7 A;  3EHY A;  5I43 A;  1AYK A;  3O64 A;  3LEA A;  1D5J A;  3CKI A;  5CUH A;  3RTT A;  1H71 P;  1UEA A;  2DDY A;  4GR8 A;  4GWM A;  5L7F A;  1BUV M;  3LE9 A;  2XS4 A;  966C A;  1DMT A;  3G42 A;  2O3E A;  1GO7 P;  4QKZ A;  1K7Q A;  2CKI A;  2V4B A;  3O2X A;  2D1N A;  1ZTQ A;  3EDH A;  1AKL A;  3LJT A;  1ATL A;  1QIB A;  3EDI A;  1JIW P;  2KRJ A;  2OVZ A;  5I4O A;  2OXU A;  1AF0 A;  4JQG A;  1BQO A;  3OHO A;  3EHX A;  2JT5 A;  5JMY A;  4WK7 A;  3K7L A;  3V96 B;  2W14 A;  2RJP A;  3KEJ A;  1G4K A;  2W13 A;  2X7M A;  1O0T A;  2OZR A;  3SHI A;  4GR0 A;  1SRP A;  2SRT A;  3F16 A;  3L0V A;  5H8X A;  3L0T A;  1HFS A;  3DNG A;  1B3D A;  1K7I A;  2I47 A;  1GE7 A;  4Q1L A;  3NX7 A;  1DTH A;  3EDG A;  1PWQ A;  4JIJ A;  4PKV A;  1HOV A;  5D1T A;  1QIC A;  3TT4 A;  1CGF A;  1CK7 A;  1GXD A;  2DW0 A;  4GQL A;  5BPA A;  4AXQ A;  3AIG A;  3EWJ A;  4JPA A;  1OM8 A;  1OS2 A;  4EFS A;  4L63 A;  3WV2 A;  1EUB A;  3HB2 P;  1I76 A;  2DDF A;  1HV5 A;  1SU3 A;  4G0D A;  4DD8 A;  1D8F A;  1BQQ M;  1IAE A;  3OHL A;  1I1I P;  1QUA A;  1YQY A;  4WF6 A;  1PWV A;  5I3M A;  4WKE A;  3RTS A;  2A8H A;  3N2U A;  1HY7 A;  1QJJ A;  4WZV A;  5LAB A;  5D3C A;  1MMB A;  1BKC E;  3ELM A;  2JT6 A;  3K7N A;  3DPF A;  1ZVX A;  1GKC A;  2X3C A;  3WV3 A;  1Y8J A;  4ZR5 A;  5I2Z A;  4I35 A;  4XCT A;  4PKS A;  3DTK A;  4L19 A;  4GUY A;  2L0R A;  4G9L A;  1YCM A;  4PKT A;  3WV1 A;  1O0Q A;  2AIG P;  1FLS A;  1R1I A;  3DPE A;  3ZUK A;  2OW2 A;  3G5C A;  3DWB A;  4PKQ A;  1UTT A;  4XM6 A;  3N2V A;  3Q2H A;  3EDZ A;  1JAN A;  1UMT A;  3LUM A;  1ZS0 A;  3HBU P;  1KBC A;  2X3A A;  2X3B A;  2Y6D A;  3F19 A;  2OI0 A;  1PWP A;  1JKY A;  1BKC I;  3P1V A;  3LGP A;  2MZI A;  3U1R A;  1YOU A;  4AUO A;  4HX3 A;  2E3X A;  3KRY A;  1G9K A;  4AYK A;  5I0L A;  3AYU A;  1JAQ A;  4H49 A;  1BUD A;  1CGL A;  1R1J A;  2K2G A;  4H84 A;  1CIZ A;  5D1U A;  4L6T A;  4H82 A;  1JH1 A;  1PWW A;  3LJZ A;  3LQB A;  5CXA A;  2W12 A;  1ROS A;  1R55 A;  1Q3A A;  4HMA A;  3LKA A;  2CLT A;  4FU4 A;  1J7N A;  2D1O A;  4I03 A;  1D7X A;  1Z3J A;  3KEC A;  4R3V A;  1JAP A;  3KEK A;  4FXY P;  4DV8 A;  2ERP A;  4PKR A;  3LQ0 A;  5D7W A;  2FV9 A;  1OMJ A;  5CZM A;  1IAG A;  2TCL A;  4CTH A;  4JA1 A;  1CXV A;  3TSK A;  1IAD A;  4DPE A;  1HTD A;  3P24 A;  5B5P A;  1KUG A;  2AYK A;  3LK8 A;  2USN A;  4IN9 A;  1IAB A;  3HY9 A;  1PWU A;  3HBV P;  1ZP5 A;  3LIL A;  1KUI A;  1GO8 P;  3KHI A;  3E8R A;  2OXZ A;  2HU6 A;  1SLM A;  3ZXH A;  5B5O A;  1USN A;  1G49 A;  3ZVS A;  4A3W A;  1XFX A;  3I7I A;  2MZH A;  4GR3 A;  3GBO A;  1EAK A;  1ZXC A;  2OW9 A;  2W15 A;  1ZXV A;  2JSD A;  3KME A;  4L7A A;  1IAC A;  1MNC A;  2ERQ A;  1GE5 A;  2WO9 A;  3B92 A;  4FVL A;  1OM6 A;  1FM1 A;  3KWV C;  3LJG A;  1SMP A;  3TS4 A;  2OW1 A;  1R54 A;  1C3I A;  4WKI A;  1XFW A;  3LMC A;  4JP4 A;  1RMZ A;  1CAQ A;  3VTG A;  3LUN A;  1R1H A;  2RJQ A;  3B8Z A;  2JIH A;  2E2D A;  4H2E A;  1G12 A;  4GF1 A;  4DF9 A;  3DL1 A;  1CQR A;  3F17 A;  1KUF A;  2DW1 A;  1EB6 A;  4GWN A;  1UTZ A;  5I12 A;  2Z2D A;  2ERO A;  1JAO A;  4H1Q A;  1XUC A;  2QPJ A;  3LIR A;  1I73 A;  1FBL A;  1BIW A;  2PJT A;  2W0D A;  4FXQ A;  1XUD A;  1XFZ A;  2Y6C A;  4H76 A;  3HY7 A;  1A86 A;  2YB9 A;  5BOY A;  1QIA A;  4ILW D;  1MMR A;  3UVC A;  2OY2 A;  4IUW A;  1KAP P;  2WOA A;  1BKC A;  3DTI A;  1JK3 A;  1D8M A;  1MMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...