4JIJA

Crystal structure of an inactive mutant of mmp-9 catalytic domain in complex with a fluorogenic synthetic peptidic substrate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
164
structure length
164
Chain Sequence
GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHAFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/substrate
molecule keywords fluorogenic peptidic substrate (8MC)PLG(PHI)(DNW)AR(NH2)
publication title Halogen Bonding Controls Selectivity of FRET Substrate Probes for MMP-9.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2013-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4jijA00
2WO8A 3LUNA 3N2VA 1BM6A 5I4OA 3I7GA 2DW2A 1G4KA 2OXUA 2W15A 1JAOA 1QICA 1GKDA 2KRJA 3LKAA 3DNGA 1ATLA 2J0TA 1K7IA 1MMBA 3EDZA 1HFCA 1I1IP 1GKCA 3AYKA 3GBOA 3F19A 2N8RA 2WOAA 3LJZA 4G9LA 3KHIA 2POJA 3KWVC 4HX3A 5BOYA 1C8TA 3O64A 1JAQA 1C7KA 1CQRA 2MZHA 1HOVA 1G49A 2K9CA 4PKTA 4DF9A 2V4BA 3EWJA 4FVLA 1UTTA 3USNA 4XCTA 1S4BP 4GR8A 456CA 3LIRA 1A85A 1MMRA 3DWBA 1GE6A 3LGPA 2OW2A 4I35A 4ON1A 4PKRA 2CLTA 4GQLA 5I2ZA 3E8RA 1ZP5A 4AIGA 4CTHA 1ZXVA 1D5JA 1B8YA 3HY9A 4DD8A 4DV8A 1OM8A 3F18A 1JANA 2JT5A 3SHIA 5B5OA 4GWNA 3HY7A 4FXYP 3TS4A 4JQGA 3B8ZA 5CXAA 5D1SA 1Y0VA 2MZEA 1KUKA 1JIWP 3OHOA 1JIZA 1YOUA 1BZSA 1FBLA 3KEJA 3LIKA 3EDGA 3EDIA 2JT6A 3LQBA 4DPEA 1YP1A 5BPAA 2TCLA 2O36A 1XFWA 1GO8P 3K7LA 1RM8A 3WV2A 5CZMA 1EUBA 2ERQA 3BA0A 1FLSA 2Y6DA 2OVXA 2RJQA 4PKUA 1L6JA 3Q2GA 1IADA 2DDYA 4JPAA 1XFVA 3RTTA 4AUOA 4JIJA 2MLSA 3L0TA 1SLMA 1GE7A 2DW0A 1AYKA 1CAQA 3UVCA 4R3VA 4WK7A 2YB9A 3F15A 3F17A 1IAGA 2AIGP 1EAKA 3HBUP 3LE9A 1BSWA 4JA1A 1FM1A 830CA 2AYKA 1BUVM 2HU6A 2XS3A 2DDFA 3G42A 3B92A 4IJOA 3LJTA 1QIAA 3KRYA 1B3DA 3HDAP 1MNCA 3TVCA 1CXVA 1KUGA 2OW9A 2YIGA 1Z3JA 1HTDA 5CUHA 1WNIA 1CK7A 3ZVSA 3EHYA 3LQ0A 2JSDA 1CGLA 3U1RA 2ERPA 3VI1A 5JMYA 3LJGA 1C3IA 5BOTA 3HYGA 1Q3AA 2CKIA 1ASTA 3G5CA 3DSLA 2I47A 1OM7A 2MZIA 1BQQM 1PWQA 2MLRA 2OY4A 4EFSA 1UMTA 1GO7P 3F1AA 4L63A 1BIWA 2SRTA 1XFXA 4ZR5A 1JKYA 2OZRA 2X7MA 5B5PA 3LUMA 1I76A 2X3AA 3P24A 4PKWA 2OY2A 1I73A 1ZS0A 4JP4A 5D3CA 1SATA 3KECA 3V96B 1SLNA 2OXZA 3DPFA 2W13A 1BUDA 1KUHA 2D1OA 3WV3A 5I0LA 1ND1A 1J7NA 1G9KA 1R55A 3WV1A 2Z2DA 1JAPA 1HFSA 3ELMA 1BKCE 1IAEA 1D8MA 3L0VA 3HDBA 2W14A 4H1QA 1SMPA 4L19A 1D7XA 1OMJA 3LEAA 1G05A 1BKCA 1GE5A 1XFZA 1O0TA 1PWWA 4GR0A 1KUIA 1PWVA 3K7NA 1OM6A 3MA2A 3CKIA 2OW0A 4WZVA 1AKLA 1IABA 3O2XA 4WF6A 5D1UA 4G0DA 4ILWD 1XUDA 2JIHA 2K2GA 3LMCA 1MMQA 1OS9A 2XS4A 1JH1A 1QJJA 1ROSA 3F16A 1IACA 1UEAA 3OHLA 3B2ZA 2W12A 5I3MA 2O3EA 4PKVA 4A3WA 1EB6A 4XM6A 2QPJA 2USNA 1HY7A 1DTHA 4XM8A 5D7WA 1O0QA 2JNPA 2X3CA 2DW1A 4AYKA 2A8HA 1XFYA 2W0DA 4PKQA 4PKSA 1OO9A 4A7BA 1DMTA 3KMCA 2WO9A 1UMSA 2E2DA 1XUCA 1YCMA 1D8FA 2Y6CA 4H2EA 5D1TA 2OVZA 1H71P 1G12A 1CGFA 4I03A 1PWUA 4FXQA 3DPEA 3TT4A 2FV5A 1SU3A 4J4MA 4FU4A 1ZXCA 4L6TA 2D1NA 1R54A 3KEKA 4H3XA 4WKIA 966CA 1QIBA 4XM7A 1USNA 1KAPP 2J83A 5LABA 5L7FA 1R1HA 5I12A 1ZVXA 4IN9A 4GR3A 1PWPA 3HB2P 2PJTA 1RMZA 3HBVP 1SRPA 3EHXA 3I7IA 4GUYA 3NX7A 3EDHA 3KMEA 4HMAA 1XFUA 4XBHA 3TSKA 3LILA 1HV5A 1YQYA 1MMPA 4AXQA 2FV9A 4H49A 1KBCA 3RTSA 5L79A 2EROA 1R1IA 3DL1A 1BKCI 1GXDA 3VTGA 2OXWA 1K7GA 2OW1A 4QKZA 1OS2A 3ZUKA 1UTZA 4Q1LA 1JK3A 4H76A 3ZXHA 1KUFA 1CIZA 1R1JA 1XURA 1AF0A 4IUWA 4H84A 1IAAA 1CGEA 5I43A 1Y93A 3P1VA 3AIGA 3AYUA 2X3BA 4WKEA 3Q2HA 4H30A 2OI0A 1QJIA 3N2UA 1K7QA 1ZTQA 1QUAA 2E3XA 3LK8A 4GF1A 1JJ9A 2L0RA 4GWMA 4H82A 5H8XA 1A86A 1Y8JA 2RJPA 5D2BA 1BQOA
chains in the Genus database with same CATH superfamily
2WO8A 3LUNA 3N2VA 1BM6A 2YUFA 5I4OA 3I7GA 2DW2A 1G4KA 2OXUA 2W15A 1JAOA 1QICA 1GKDA 2KRJA 3LKAA 3DNGA 1ATLA 2J0TA 1K7IA 1MMBA 3EDZA 1HFCA 1I1IP 1GKCA 3AYKA 3GBOA 3F19A 2N8RA 2WOAA 3LJZA 4G9LA 3KHIA 2POJA 3KWVC 4HX3A 5BOYA 1C8TA 3O64A 1JAQA 1C7KA 1CQRA 2MZHA 1HOVA 1G49A 2K9CA 4PKTA 4DF9A 2V4BA 3DTIA 3EWJA 4FVLA 1UTTA 3USNA 4XCTA 1S4BP 4GR8A 456CA 3LIRA 1A85A 1MMRA 3DWBA 1GE6A 3LGPA 2OW2A 4I35A 4ON1A 4PKRA 2CLTA 4GQLA 5I2ZA 3E8RA 1ZP5A 4AIGA 4CTHA 1XM5A 1D5JA 1ZXVA 1B8YA 3HY9A 4DD8A 4DV8A 1OM8A 3F18A 1JANA 2JT5A 3SHIA 5B5OA 4GWNA 3HY7A 4FXYP 3TS4A 4JQGA 3B8ZA 5CXAA 5D1SA 1Y0VA 2MZEA 1KUKA 1JIWP 3OHOA 1JIZA 1YOUA 1BZSA 1FBLA 3KEJA 3LIKA 3EDGA 3EDIA 2JT6A 3LQBA 4DPEA 1YP1A 5BPAA 2TCLA 2O36A 1XFWA 1GO8P 3K7LA 1RM8A 3WV2A 5CZMA 1EUBA 2ERQA 3BA0A 1FLSA 2Y6DA 2OVXA 2RJQA 4PKUA 1L6JA 3Q2GA 1IADA 2DDYA 4JPAA 1XFVA 3RTTA 4AUOA 4JIJA 2MLSA 3L0TA 1SLMA 1GE7A 2DW0A 1AYKA 1CAQA 3UVCA 4R3VA 4WK7A 2YB9A 3F15A 3F17A 1IAGA 2AIGP 1EAKA 3HBUP 3LE9A 1BSWA 4JA1A 1FM1A 830CA 2AYKA 1BUVM 2HU6A 2XS3A 2DDFA 3G42A 3B92A 4IJOA 3LJTA 1QIAA 3KRYA 1B3DA 3HDAP 1TVIA 1MNCA 3TVCA 1CXVA 1KUGA 2OW9A 2YIGA 1Z3JA 1HTDA 5CUHA 1WNIA 1CK7A 3ZVSA 3EHYA 3LQ0A 2JSDA 1CGLA 3U1RA 2ERPA 3VI1A 5JMYA 3LJGA 1C3IA 5BOTA 3HYGA 1Q3AA 2CKIA 1ASTA 3G5CA 3DSLA 2I47A 1OM7A 2MZIA 1BQQM 1PWQA 2MLRA 2OY4A 4EFSA 1UMTA 1GO7P 3F1AA 1XAXA 4L63A 1BIWA 2SRTA 1XFXA 4ZR5A 1JKYA 2OZRA 2X7MA 5B5PA 3LUMA 1I76A 2X3AA 3P24A 4PKWA 2OY2A 1I73A 1ZS0A 4JP4A 5D3CA 1SATA 3KECA 3V96B 1SLNA 2OXZA 3DPFA 2W13A 1BUDA 1KUHA 2D1OA 3WV3A 5I0LA 1ND1A 1J7NA 1G9KA 1R55A 3WV1A 2Z2DA 1JAPA 1HFSA 3ELMA 1BKCE 1IAEA 1D8MA 3L0VA 3HDBA 2W14A 4H1QA 1SMPA 4L19A 1D7XA 1OMJA 3LEAA 1G05A 4L7AA 1BKCA 1GE5A 1XFZA 1O0TA 1PWWA 4GR0A 1KUIA 1PWVA 3K7NA 1OM6A 3MA2A 3CKIA 2OW0A 4WZVA 1AKLA 1IABA 3O2XA 4WF6A 5D1UA 4G0DA 4ILWD 1XUDA 2JIHA 2K2GA 3LMCA 1MMQA 1OS9A 2XS4A 1JH1A 1QJJA 1ROSA 3F16A 1IACA 1UEAA 3OHLA 3B2ZA 2W12A 5I3MA 2O3EA 4PKVA 4A3WA 1EB6A 4XM6A 2QPJA 2USNA 1HY7A 1DTHA 4XM8A 5D7WA 1O0QA 2JNPA 2X3CA 2DW1A 4AYKA 2A8HA 1XFYA 2W0DA 4PKQA 4PKSA 1OO9A 4A7BA 1DMTA 3KMCA 2WO9A 1UMSA 2E2DA 1XUCA 1YCMA 1D8FA 2Y6CA 4H2EA 1OZ9A 5D1TA 2OVZA 3DTEA 1H71P 1G12A 1CGFA 4I03A 1PWUA 4FXQA 3DPEA 3TT4A 2FV5A 1SU3A 4J4MA 4FU4A 1ZXCA 4L6TA 2D1NA 1R54A 3KEKA 4H3XA 4WKIA 966CA 1QIBA 4XM7A 1USNA 1KAPP 2J83A 5LABA 5L7FA 1R1HA 5I12A 1ZVXA 4IN9A 4GR3A 1PWPA 3HB2P 2PJTA 1RMZA 3HBVP 1SRPA 3EHXA 3I7IA 4GUYA 3NX7A 3EDHA 3KMEA 4HMAA 1XFUA 4XBHA 3TSKA 3LILA 1HV5A 1YQYA 1MMPA 4AXQA 2FV9A 4H49A 1KBCA 3RTSA 5L79A 2EROA 1R1IA 3DL1A 1BKCI 1GXDA 3VTGA 2OXWA 1K7GA 2OW1A 4QKZA 1OS2A 3ZUKA 1UTZA 4Q1LA 1JK3A 4H76A 3ZXHA 1KUFA 1CIZA 1R1JA 1XURA 1AF0A 4IUWA 4H84A 1IAAA 1CGEA 3DTKA 5I43A 1Y93A 3P1VA 3AIGA 3AYUA 2X3BA 4WKEA 3Q2HA 4H30A 2OI0A 1QJIA 3N2UA 1K7QA 1ZTQA 1QUAA 2E3XA 3LK8A 4GF1A 1JJ9A 2L0RA 4GWMA 4H82A 5H8XA 1A86A 1Y8JA 2RJPA 5D2BA 1BQOA
chains in the Genus database with same CATH topology
2WO8A 3LUNA 3N2VA 1BM6A 2YUFA 5I4OA 3I7GA 2DW2A 1G4KA 2OXUA 2W15A 1JAOA 1QICA 1GKDA 2KRJA 3LKAA 3DNGA 1ATLA 2J0TA 1K7IA 1MMBA 3EDZA 1HFCA 1I1IP 1GKCA 3AYKA 3GBOA 3F19A 2N8RA 2WOAA 3LJZA 4G9LA 3KHIA 2POJA 3KWVC 4HX3A 5BOYA 1C8TA 3O64A 1JAQA 1C7KA 1CQRA 2MZHA 1HOVA 1G49A 2K9CA 4PKTA 4DF9A 2V4BA 3DTIA 3EWJA 4FVLA 1UTTA 3USNA 4XCTA 1S4BP 4GR8A 456CA 3LIRA 1A85A 1MMRA 3DWBA 1GE6A 3LGPA 2OW2A 4I35A 4ON1A 4PKRA 2CLTA 4GQLA 5I2ZA 3E8RA 1ZP5A 4AIGA 4CTHA 1ZXVA 1D5JA 1B8YA 3HY9A 4DD8A 4DV8A 1OM8A 3F18A 1JANA 2JT5A 3SHIA 5B5OA 4GWNA 3HY7A 4FXYP 3TS4A 4JQGA 3B8ZA 5CXAA 5D1SA 1Y0VA 2MZEA 1KUKA 1JIWP 3OHOA 1JIZA 1YOUA 1BZSA 1FBLA 3KEJA 3LIKA 3EDGA 3EDIA 2JT6A 3LQBA 4DPEA 1YP1A 5BPAA 2TCLA 2O36A 1XFWA 1GO8P 3K7LA 1RM8A 3WV2A 5CZMA 1EUBA 2ERQA 3BA0A 1FLSA 2Y6DA 2OVXA 2RJQA 4PKUA 1L6JA 3Q2GA 1IADA 2DDYA 4JPAA 1XFVA 3RTTA 4AUOA 4JIJA 2MLSA 3L0TA 1SLMA 1GE7A 2DW0A 1AYKA 1CAQA 3UVCA 4R3VA 4WK7A 2YB9A 3F15A 3F17A 1IAGA 2AIGP 1EAKA 3HBUP 3LE9A 1BSWA 4JA1A 1FM1A 830CA 2AYKA 1BUVM 2HU6A 2XS3A 2DDFA 3G42A 3B92A 4IJOA 3LJTA 1QIAA 3KRYA 1B3DA 3HDAP 1MNCA 3TVCA 1CXVA 1KUGA 2OW9A 2YIGA 1Z3JA 1HTDA 5CUHA 1WNIA 1CK7A 3ZVSA 3EHYA 3LQ0A 2JSDA 1CGLA 3U1RA 2ERPA 3VI1A 5JMYA 3LJGA 1C3IA 5BOTA 3HYGA 1Q3AA 2CKIA 1ASTA 3G5CA 3DSLA 2I47A 1OM7A 2MZIA 1BQQM 1PWQA 2MLRA 2OY4A 4EFSA 1UMTA 1GO7P 3F1AA 4L63A 1BIWA 2SRTA 1XFXA 4ZR5A 1JKYA 2OZRA 2X7MA 5B5PA 3LUMA 1I76A 2X3AA 3P24A 4PKWA 2OY2A 1I73A 1ZS0A 4JP4A 5D3CA 1SATA 3KECA 3V96B 1SLNA 2OXZA 3DPFA 2W13A 1BUDA 1KUHA 2D1OA 3WV3A 5I0LA 1ND1A 1J7NA 1G9KA 1R55A 3WV1A 2Z2DA 1JAPA 1HFSA 3ELMA 1BKCE 1IAEA 1D8MA 3L0VA 3HDBA 2W14A 4H1QA 1SMPA 4L19A 1D7XA 1OMJA 3LEAA 1G05A 4L7AA 1BKCA 1GE5A 1XFZA 1O0TA 1PWWA 4GR0A 1KUIA 1PWVA 3K7NA 1OM6A 3MA2A 3CKIA 2OW0A 4WZVA 1AKLA 1IABA 3O2XA 4WF6A 5D1UA 4G0DA 4ILWD 1XUDA 2JIHA 2K2GA 3LMCA 1MMQA 1OS9A 2XS4A 1JH1A 1QJJA 1ROSA 3F16A 1IACA 1UEAA 3OHLA 3B2ZA 2W12A 5I3MA 2O3EA 4PKVA 4A3WA 1EB6A 4XM6A 2QPJA 2USNA 1HY7A 1DTHA 4XM8A 5D7WA 1O0QA 2JNPA 2X3CA 2DW1A 4AYKA 2A8HA 1XFYA 2W0DA 4PKQA 4PKSA 1OO9A 4A7BA 1DMTA 3KMCA 2WO9A 1UMSA 2E2DA 1XUCA 1YCMA 1D8FA 2Y6CA 4H2EA 5D1TA 2OVZA 3DTEA 1H71P 1G12A 1CGFA 4I03A 1PWUA 4FXQA 3DPEA 3TT4A 2FV5A 1SU3A 4J4MA 4FU4A 1ZXCA 4L6TA 2D1NA 1R54A 3KEKA 4H3XA 4WKIA 966CA 1QIBA 4XM7A 1USNA 1KAPP 2J83A 5LABA 5L7FA 1R1HA 5I12A 1ZVXA 4IN9A 4GR3A 1PWPA 3HB2P 2PJTA 1RMZA 3HBVP 1SRPA 3EHXA 3I7IA 4GUYA 3NX7A 3EDHA 3KMEA 4HMAA 1XFUA 4XBHA 3TSKA 3LILA 1HV5A 1YQYA 1MMPA 4AXQA 2FV9A 4H49A 1KBCA 3RTSA 5L79A 2EROA 1R1IA 3DL1A 1BKCI 1GXDA 3VTGA 2OXWA 1K7GA 2OW1A 4QKZA 1OS2A 3ZUKA 1UTZA 4Q1LA 1JK3A 4H76A 3ZXHA 1KUFA 1CIZA 1R1JA 1XURA 1AF0A 4IUWA 4H84A 1IAAA 1CGEA 3DTKA 5I43A 1Y93A 3P1VA 3AIGA 3AYUA 2X3BA 4WKEA 3Q2HA 4H30A 2OI0A 1QJIA 3N2UA 1K7QA 1ZTQA 1QUAA 2E3XA 3LK8A 4GF1A 1JJ9A 2L0RA 4GWMA 4H82A 5H8XA 1A86A 1Y8JA 2RJPA 5D2BA 1BQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WO8 A;  3LUN A;  3N2V A;  1BM6 A;  5I4O A;  3I7G A;  2DW2 A;  1G4K A;  2OXU A;  2W15 A;  1JAO A;  1QIC A;  1GKD A;  2KRJ A;  3LKA A;  3DNG A;  1ATL A;  2J0T A;  1K7I A;  1MMB A;  3EDZ A;  1HFC A;  1I1I P;  1GKC A;  3AYK A;  3GBO A;  3F19 A;  2N8R A;  2WOA A;  3LJZ A;  4G9L A;  3KHI A;  2POJ A;  3KWV C;  4HX3 A;  5BOY A;  1C8T A;  3O64 A;  1JAQ A;  1C7K A;  1CQR A;  2MZH A;  1HOV A;  1G49 A;  2K9C A;  4PKT A;  4DF9 A;  2V4B A;  3EWJ A;  4FVL A;  1UTT A;  3USN A;  4XCT A;  1S4B P;  4GR8 A;  456C A;  3LIR A;  1A85 A;  1MMR A;  3DWB A;  1GE6 A;  3LGP A;  2OW2 A;  4I35 A;  4ON1 A;  4PKR A;  2CLT A;  4GQL A;  5I2Z A;  3E8R A;  1ZP5 A;  4AIG A;  4CTH A;  1ZXV A;  1D5J A;  1B8Y A;  3HY9 A;  4DD8 A;  4DV8 A;  1OM8 A;  3F18 A;  1JAN A;  2JT5 A;  3SHI A;  5B5O A;  4GWN A;  3HY7 A;  4FXY P;  3TS4 A;  4JQG A;  3B8Z A;  5CXA A;  5D1S A;  1Y0V A;  2MZE A;  1KUK A;  1JIW P;  3OHO A;  1JIZ A;  1YOU A;  1BZS A;  1FBL A;  3KEJ A;  3LIK A;  3EDG A;  3EDI A;  2JT6 A;  3LQB A;  4DPE A;  1YP1 A;  5BPA A;  2TCL A;  2O36 A;  1XFW A;  1GO8 P;  3K7L A;  1RM8 A;  3WV2 A;  5CZM A;  1EUB A;  2ERQ A;  3BA0 A;  1FLS A;  2Y6D A;  2OVX A;  2RJQ A;  4PKU A;  1L6J A;  3Q2G A;  1IAD A;  2DDY A;  4JPA A;  1XFV A;  3RTT A;  4AUO A;  4JIJ A;  2MLS A;  3L0T A;  1SLM A;  1GE7 A;  2DW0 A;  1AYK A;  1CAQ A;  3UVC A;  4R3V A;  4WK7 A;  2YB9 A;  3F15 A;  3F17 A;  1IAG A;  2AIG P;  1EAK A;  3HBU P;  3LE9 A;  1BSW A;  4JA1 A;  1FM1 A;  830C A;  2AYK A;  1BUV M;  2HU6 A;  2XS3 A;  2DDF A;  3G42 A;  3B92 A;  4IJO A;  3LJT A;  1QIA A;  3KRY A;  1B3D A;  3HDA P;  1MNC A;  3TVC A;  1CXV A;  1KUG A;  2OW9 A;  2YIG A;  1Z3J A;  1HTD A;  5CUH A;  1WNI A;  1CK7 A;  3ZVS A;  3EHY A;  3LQ0 A;  2JSD A;  1CGL A;  3U1R A;  2ERP A;  3VI1 A;  5JMY A;  3LJG A;  1C3I A;  5BOT A;  3HYG A;  1Q3A A;  2CKI A;  1AST A;  3G5C A;  3DSL A;  2I47 A;  1OM7 A;  2MZI A;  1BQQ M;  1PWQ A;  2MLR A;  2OY4 A;  4EFS A;  1UMT A;  1GO7 P;  3F1A A;  4L63 A;  1BIW A;  2SRT A;  1XFX A;  4ZR5 A;  1JKY A;  2OZR A;  2X7M A;  5B5P A;  3LUM A;  1I76 A;  2X3A A;  3P24 A;  4PKW A;  2OY2 A;  1I73 A;  1ZS0 A;  4JP4 A;  5D3C A;  1SAT A;  3KEC A;  3V96 B;  1SLN A;  2OXZ A;  3DPF A;  2W13 A;  1BUD A;  1KUH A;  2D1O A;  3WV3 A;  5I0L A;  1ND1 A;  1J7N A;  1G9K A;  1R55 A;  3WV1 A;  2Z2D A;  1JAP A;  1HFS A;  3ELM A;  1BKC E;  1IAE A;  1D8M A;  3L0V A;  3HDB A;  2W14 A;  4H1Q A;  1SMP A;  4L19 A;  1D7X A;  1OMJ A;  3LEA A;  1G05 A;  1BKC A;  1GE5 A;  1XFZ A;  1O0T A;  1PWW A;  4GR0 A;  1KUI A;  1PWV A;  3K7N A;  1OM6 A;  3MA2 A;  3CKI A;  2OW0 A;  4WZV A;  1AKL A;  1IAB A;  3O2X A;  4WF6 A;  5D1U A;  4G0D A;  4ILW D;  1XUD A;  2JIH A;  2K2G A;  3LMC A;  1MMQ A;  1OS9 A;  2XS4 A;  1JH1 A;  1QJJ A;  1ROS A;  3F16 A;  1IAC A;  1UEA A;  3OHL A;  3B2Z A;  2W12 A;  5I3M A;  2O3E A;  4PKV A;  4A3W A;  1EB6 A;  4XM6 A;  2QPJ A;  2USN A;  1HY7 A;  1DTH A;  4XM8 A;  5D7W A;  1O0Q A;  2JNP A;  2X3C A;  2DW1 A;  4AYK A;  2A8H A;  1XFY A;  2W0D A;  4PKQ A;  4PKS A;  1OO9 A;  4A7B A;  1DMT A;  3KMC A;  2WO9 A;  1UMS A;  2E2D A;  1XUC A;  1YCM A;  1D8F A;  2Y6C A;  4H2E A;  5D1T A;  2OVZ A;  1H71 P;  1G12 A;  1CGF A;  4I03 A;  1PWU A;  4FXQ A;  3DPE A;  3TT4 A;  2FV5 A;  1SU3 A;  4J4M A;  4FU4 A;  1ZXC A;  4L6T A;  2D1N A;  1R54 A;  3KEK A;  4H3X A;  4WKI A;  966C A;  1QIB A;  4XM7 A;  1USN A;  1KAP P;  2J83 A;  5LAB A;  5L7F A;  1R1H A;  5I12 A;  1ZVX A;  4IN9 A;  4GR3 A;  1PWP A;  3HB2 P;  2PJT A;  1RMZ A;  3HBV P;  1SRP A;  3EHX A;  3I7I A;  4GUY A;  3NX7 A;  3EDH A;  3KME A;  4HMA A;  1XFU A;  4XBH A;  3TSK A;  3LIL A;  1HV5 A;  1YQY A;  1MMP A;  4AXQ A;  2FV9 A;  4H49 A;  1KBC A;  3RTS A;  5L79 A;  2ERO A;  1R1I A;  3DL1 A;  1BKC I;  1GXD A;  3VTG A;  2OXW A;  1K7G A;  2OW1 A;  4QKZ A;  1OS2 A;  3ZUK A;  1UTZ A;  4Q1L A;  1JK3 A;  4H76 A;  3ZXH A;  1KUF A;  1CIZ A;  1R1J A;  1XUR A;  1AF0 A;  4IUW A;  4H84 A;  1IAA A;  1CGE A;  5I43 A;  1Y93 A;  3P1V A;  3AIG A;  3AYU A;  2X3B A;  4WKE A;  3Q2H A;  4H30 A;  2OI0 A;  1QJI A;  3N2U A;  1K7Q A;  1ZTQ A;  1QUA A;  2E3X A;  3LK8 A;  4GF1 A;  1JJ9 A;  2L0R A;  4GWM A;  4H82 A;  5H8X A;  1A86 A;  1Y8J A;  2RJP A;  5D2B A;  1BQO A; 
#chains in the Genus database with same CATH topology
 2WO8 A;  3LUN A;  3N2V A;  1BM6 A;  2YUF A;  5I4O A;  3I7G A;  2DW2 A;  1G4K A;  2OXU A;  2W15 A;  1JAO A;  1QIC A;  1GKD A;  2KRJ A;  3LKA A;  3DNG A;  1ATL A;  2J0T A;  1K7I A;  1MMB A;  3EDZ A;  1HFC A;  1I1I P;  1GKC A;  3AYK A;  3GBO A;  3F19 A;  2N8R A;  2WOA A;  3LJZ A;  4G9L A;  3KHI A;  2POJ A;  3KWV C;  4HX3 A;  5BOY A;  1C8T A;  3O64 A;  1JAQ A;  1C7K A;  1CQR A;  2MZH A;  1HOV A;  1G49 A;  2K9C A;  4PKT A;  4DF9 A;  2V4B A;  3DTI A;  3EWJ A;  4FVL A;  1UTT A;  3USN A;  4XCT A;  1S4B P;  4GR8 A;  456C A;  3LIR A;  1A85 A;  1MMR A;  3DWB A;  1GE6 A;  3LGP A;  2OW2 A;  4I35 A;  4ON1 A;  4PKR A;  2CLT A;  4GQL A;  5I2Z A;  3E8R A;  1ZP5 A;  4AIG A;  4CTH A;  1XM5 A;  1D5J A;  1ZXV A;  1B8Y A;  3HY9 A;  4DD8 A;  4DV8 A;  1OM8 A;  3F18 A;  1JAN A;  2JT5 A;  3SHI A;  5B5O A;  4GWN A;  3HY7 A;  4FXY P;  3TS4 A;  4JQG A;  3B8Z A;  5CXA A;  5D1S A;  1Y0V A;  2MZE A;  1KUK A;  1JIW P;  3OHO A;  1JIZ A;  1YOU A;  1BZS A;  1FBL A;  3KEJ A;  3LIK A;  3EDG A;  3EDI A;  2JT6 A;  3LQB A;  4DPE A;  1YP1 A;  5BPA A;  2TCL A;  2O36 A;  1XFW A;  1GO8 P;  3K7L A;  1RM8 A;  3WV2 A;  5CZM A;  1EUB A;  2ERQ A;  3BA0 A;  1FLS A;  2Y6D A;  2OVX A;  2RJQ A;  4PKU A;  1L6J A;  3Q2G A;  1IAD A;  2DDY A;  4JPA A;  1XFV A;  3RTT A;  4AUO A;  4JIJ A;  2MLS A;  3L0T A;  1SLM A;  1GE7 A;  2DW0 A;  1AYK A;  1CAQ A;  3UVC A;  4R3V A;  4WK7 A;  2YB9 A;  3F15 A;  3F17 A;  1IAG A;  2AIG P;  1EAK A;  3HBU P;  3LE9 A;  1BSW A;  4JA1 A;  1FM1 A;  830C A;  2AYK A;  1BUV M;  2HU6 A;  2XS3 A;  2DDF A;  3G42 A;  3B92 A;  4IJO A;  3LJT A;  1QIA A;  3KRY A;  1B3D A;  3HDA P;  1TVI A;  1MNC A;  3TVC A;  1CXV A;  1KUG A;  2OW9 A;  2YIG A;  1Z3J A;  1HTD A;  5CUH A;  1WNI A;  1CK7 A;  3ZVS A;  3EHY A;  3LQ0 A;  2JSD A;  1CGL A;  3U1R A;  2ERP A;  3VI1 A;  5JMY A;  3LJG A;  1C3I A;  5BOT A;  3HYG A;  1Q3A A;  2CKI A;  1AST A;  3G5C A;  3DSL A;  2I47 A;  1OM7 A;  2MZI A;  1BQQ M;  1PWQ A;  2MLR A;  2OY4 A;  4EFS A;  1UMT A;  1GO7 P;  3F1A A;  1XAX A;  4L63 A;  1BIW A;  2SRT A;  1XFX A;  4ZR5 A;  1JKY A;  2OZR A;  2X7M A;  5B5P A;  3LUM A;  1I76 A;  2X3A A;  3P24 A;  4PKW A;  2OY2 A;  1I73 A;  1ZS0 A;  4JP4 A;  5D3C A;  1SAT A;  3KEC A;  3V96 B;  1SLN A;  2OXZ A;  3DPF A;  2W13 A;  1BUD A;  1KUH A;  2D1O A;  3WV3 A;  5I0L A;  1ND1 A;  1J7N A;  1G9K A;  1R55 A;  3WV1 A;  2Z2D A;  1JAP A;  1HFS A;  3ELM A;  1BKC E;  1IAE A;  1D8M A;  3L0V A;  3HDB A;  2W14 A;  4H1Q A;  1SMP A;  4L19 A;  1D7X A;  1OMJ A;  3LEA A;  1G05 A;  4L7A A;  1BKC A;  1GE5 A;  1XFZ A;  1O0T A;  1PWW A;  4GR0 A;  1KUI A;  1PWV A;  3K7N A;  1OM6 A;  3MA2 A;  3CKI A;  2OW0 A;  4WZV A;  1AKL A;  1IAB A;  3O2X A;  4WF6 A;  5D1U A;  4G0D A;  4ILW D;  1XUD A;  2JIH A;  2K2G A;  3LMC A;  1MMQ A;  1OS9 A;  2XS4 A;  1JH1 A;  1QJJ A;  1ROS A;  3F16 A;  1IAC A;  1UEA A;  3OHL A;  3B2Z A;  2W12 A;  5I3M A;  2O3E A;  4PKV A;  4A3W A;  1EB6 A;  4XM6 A;  2QPJ A;  2USN A;  1HY7 A;  1DTH A;  4XM8 A;  5D7W A;  1O0Q A;  2JNP A;  2X3C A;  2DW1 A;  4AYK A;  2A8H A;  1XFY A;  2W0D A;  4PKQ A;  4PKS A;  1OO9 A;  4A7B A;  1DMT A;  3KMC A;  2WO9 A;  1UMS A;  2E2D A;  1XUC A;  1YCM A;  1D8F A;  2Y6C A;  4H2E A;  1OZ9 A;  5D1T A;  2OVZ A;  3DTE A;  1H71 P;  1G12 A;  1CGF A;  4I03 A;  1PWU A;  4FXQ A;  3DPE A;  3TT4 A;  2FV5 A;  1SU3 A;  4J4M A;  4FU4 A;  1ZXC A;  4L6T A;  2D1N A;  1R54 A;  3KEK A;  4H3X A;  4WKI A;  966C A;  1QIB A;  4XM7 A;  1USN A;  1KAP P;  2J83 A;  5LAB A;  5L7F A;  1R1H A;  5I12 A;  1ZVX A;  4IN9 A;  4GR3 A;  1PWP A;  3HB2 P;  2PJT A;  1RMZ A;  3HBV P;  1SRP A;  3EHX A;  3I7I A;  4GUY A;  3NX7 A;  3EDH A;  3KME A;  4HMA A;  1XFU A;  4XBH A;  3TSK A;  3LIL A;  1HV5 A;  1YQY A;  1MMP A;  4AXQ A;  2FV9 A;  4H49 A;  1KBC A;  3RTS A;  5L79 A;  2ERO A;  1R1I A;  3DL1 A;  1BKC I;  1GXD A;  3VTG A;  2OXW A;  1K7G A;  2OW1 A;  4QKZ A;  1OS2 A;  3ZUK A;  1UTZ A;  4Q1L A;  1JK3 A;  4H76 A;  3ZXH A;  1KUF A;  1CIZ A;  1R1J A;  1XUR A;  1AF0 A;  4IUW A;  4H84 A;  1IAA A;  1CGE A;  3DTK A;  5I43 A;  1Y93 A;  3P1V A;  3AIG A;  3AYU A;  2X3B A;  4WKE A;  3Q2H A;  4H30 A;  2OI0 A;  1QJI A;  3N2U A;  1K7Q A;  1ZTQ A;  1QUA A;  2E3X A;  3LK8 A;  4GF1 A;  1JJ9 A;  2L0R A;  4GWM A;  4H82 A;  5H8X A;  1A86 A;  1Y8J A;  2RJP A;  5D2B A;  1BQO A; 
#chains in the Genus database with same CATH homology
 2WO8 A;  3LUN A;  3N2V A;  1BM6 A;  2YUF A;  5I4O A;  3I7G A;  2DW2 A;  1G4K A;  2OXU A;  2W15 A;  1JAO A;  1QIC A;  1GKD A;  2KRJ A;  3LKA A;  3DNG A;  1ATL A;  2J0T A;  1K7I A;  1MMB A;  3EDZ A;  1HFC A;  1I1I P;  1GKC A;  3AYK A;  3GBO A;  3F19 A;  2N8R A;  2WOA A;  3LJZ A;  4G9L A;  3KHI A;  2POJ A;  3KWV C;  4HX3 A;  5BOY A;  1C8T A;  3O64 A;  1JAQ A;  1C7K A;  1CQR A;  2MZH A;  1HOV A;  1G49 A;  2K9C A;  4PKT A;  4DF9 A;  2V4B A;  3DTI A;  3EWJ A;  4FVL A;  1UTT A;  3USN A;  4XCT A;  1S4B P;  4GR8 A;  456C A;  3LIR A;  1A85 A;  1MMR A;  3DWB A;  1GE6 A;  3LGP A;  2OW2 A;  4I35 A;  4ON1 A;  4PKR A;  2CLT A;  4GQL A;  5I2Z A;  3E8R A;  1ZP5 A;  4AIG A;  4CTH A;  1ZXV A;  1D5J A;  1B8Y A;  3HY9 A;  4DD8 A;  4DV8 A;  1OM8 A;  3F18 A;  1JAN A;  2JT5 A;  3SHI A;  5B5O A;  4GWN A;  3HY7 A;  4FXY P;  3TS4 A;  4JQG A;  3B8Z A;  5CXA A;  5D1S A;  1Y0V A;  2MZE A;  1KUK A;  1JIW P;  3OHO A;  1JIZ A;  1YOU A;  1BZS A;  1FBL A;  3KEJ A;  3LIK A;  3EDG A;  3EDI A;  2JT6 A;  3LQB A;  4DPE A;  1YP1 A;  5BPA A;  2TCL A;  2O36 A;  1XFW A;  1GO8 P;  3K7L A;  1RM8 A;  3WV2 A;  5CZM A;  1EUB A;  2ERQ A;  3BA0 A;  1FLS A;  2Y6D A;  2OVX A;  2RJQ A;  4PKU A;  1L6J A;  3Q2G A;  1IAD A;  2DDY A;  4JPA A;  1XFV A;  3RTT A;  4AUO A;  4JIJ A;  2MLS A;  3L0T A;  1SLM A;  1GE7 A;  2DW0 A;  1AYK A;  1CAQ A;  3UVC A;  4R3V A;  4WK7 A;  2YB9 A;  3F15 A;  3F17 A;  1IAG A;  2AIG P;  1EAK A;  3HBU P;  3LE9 A;  1BSW A;  4JA1 A;  1FM1 A;  830C A;  2AYK A;  1BUV M;  2HU6 A;  2XS3 A;  2DDF A;  3G42 A;  3B92 A;  4IJO A;  3LJT A;  1QIA A;  3KRY A;  1B3D A;  3HDA P;  1MNC A;  3TVC A;  1CXV A;  1KUG A;  2OW9 A;  2YIG A;  1Z3J A;  1HTD A;  5CUH A;  1WNI A;  1CK7 A;  3ZVS A;  3EHY A;  3LQ0 A;  2JSD A;  1CGL A;  3U1R A;  2ERP A;  3VI1 A;  5JMY A;  3LJG A;  1C3I A;  5BOT A;  3HYG A;  1Q3A A;  2CKI A;  1AST A;  3G5C A;  3DSL A;  2I47 A;  1OM7 A;  2MZI A;  1BQQ M;  1PWQ A;  2MLR A;  2OY4 A;  4EFS A;  1UMT A;  1GO7 P;  3F1A A;  4L63 A;  1BIW A;  2SRT A;  1XFX A;  4ZR5 A;  1JKY A;  2OZR A;  2X7M A;  5B5P A;  3LUM A;  1I76 A;  2X3A A;  3P24 A;  4PKW A;  2OY2 A;  1I73 A;  1ZS0 A;  4JP4 A;  5D3C A;  1SAT A;  3KEC A;  3V96 B;  1SLN A;  2OXZ A;  3DPF A;  2W13 A;  1BUD A;  1KUH A;  2D1O A;  3WV3 A;  5I0L A;  1ND1 A;  1J7N A;  1G9K A;  1R55 A;  3WV1 A;  2Z2D A;  1JAP A;  1HFS A;  3ELM A;  1BKC E;  1IAE A;  1D8M A;  3L0V A;  3HDB A;  2W14 A;  4H1Q A;  1SMP A;  4L19 A;  1D7X A;  1OMJ A;  3LEA A;  1G05 A;  4L7A A;  1BKC A;  1GE5 A;  1XFZ A;  1O0T A;  1PWW A;  4GR0 A;  1KUI A;  1PWV A;  3K7N A;  1OM6 A;  3MA2 A;  3CKI A;  2OW0 A;  4WZV A;  1AKL A;  1IAB A;  3O2X A;  4WF6 A;  5D1U A;  4G0D A;  4ILW D;  1XUD A;  2JIH A;  2K2G A;  3LMC A;  1MMQ A;  1OS9 A;  2XS4 A;  1JH1 A;  1QJJ A;  1ROS A;  3F16 A;  1IAC A;  1UEA A;  3OHL A;  3B2Z A;  2W12 A;  5I3M A;  2O3E A;  4PKV A;  4A3W A;  1EB6 A;  4XM6 A;  2QPJ A;  2USN A;  1HY7 A;  1DTH A;  4XM8 A;  5D7W A;  1O0Q A;  2JNP A;  2X3C A;  2DW1 A;  4AYK A;  2A8H A;  1XFY A;  2W0D A;  4PKQ A;  4PKS A;  1OO9 A;  4A7B A;  1DMT A;  3KMC A;  2WO9 A;  1UMS A;  2E2D A;  1XUC A;  1YCM A;  1D8F A;  2Y6C A;  4H2E A;  5D1T A;  2OVZ A;  3DTE A;  1H71 P;  1G12 A;  1CGF A;  4I03 A;  1PWU A;  4FXQ A;  3DPE A;  3TT4 A;  2FV5 A;  1SU3 A;  4J4M A;  4FU4 A;  1ZXC A;  4L6T A;  2D1N A;  1R54 A;  3KEK A;  4H3X A;  4WKI A;  966C A;  1QIB A;  4XM7 A;  1USN A;  1KAP P;  2J83 A;  5LAB A;  5L7F A;  1R1H A;  5I12 A;  1ZVX A;  4IN9 A;  4GR3 A;  1PWP A;  3HB2 P;  2PJT A;  1RMZ A;  3HBV P;  1SRP A;  3EHX A;  3I7I A;  4GUY A;  3NX7 A;  3EDH A;  3KME A;  4HMA A;  1XFU A;  4XBH A;  3TSK A;  3LIL A;  1HV5 A;  1YQY A;  1MMP A;  4AXQ A;  2FV9 A;  4H49 A;  1KBC A;  3RTS A;  5L79 A;  2ERO A;  1R1I A;  3DL1 A;  1BKC I;  1GXD A;  3VTG A;  2OXW A;  1K7G A;  2OW1 A;  4QKZ A;  1OS2 A;  3ZUK A;  1UTZ A;  4Q1L A;  1JK3 A;  4H76 A;  3ZXH A;  1KUF A;  1CIZ A;  1R1J A;  1XUR A;  1AF0 A;  4IUW A;  4H84 A;  1IAA A;  1CGE A;  3DTK A;  5I43 A;  1Y93 A;  3P1V A;  3AIG A;  3AYU A;  2X3B A;  4WKE A;  3Q2H A;  4H30 A;  2OI0 A;  1QJI A;  3N2U A;  1K7Q A;  1ZTQ A;  1QUA A;  2E3X A;  3LK8 A;  4GF1 A;  1JJ9 A;  2L0R A;  4GWM A;  4H82 A;  5H8X A;  1A86 A;  1Y8J A;  2RJP A;  5D2B A;  1BQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...