2D1OA

Stromelysin-1 (mmp-3) complexed to a hydroxamic acid inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
171
structure length
171
Chain Sequence
b'FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromelysin-1
publication title Crystal structures of the catalytic domain of human stromelysin-1 (MMP-3) and collagenase-3 (MMP-13) with a hydroxamic acid inhibitor SM-25453
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2d1oA00
1MMBA 1G9KA 3UVCA 4WZVA 2DW2A 4WKIA 5L79A 1KUFA 1MNCA 4GR3A 2OY4A 4A7BA 2DW1A 4GQLA 4H82A 3VI1A 2X3AA 1AYKA 1ROSA 2OXUA 1BKCE 1SLMA 3LIRA 1R55A 1OM6A 4GWMA 1GO7P 1BKCI 3EHXA 1BKCA 1SRPA 3E8RA 4IUWA 3DWBA 4A3WA 2OVZA 1Y8JA 2OW1A 5H8XA 2OXZA 1SLNA 2W13A 1YP1A 1DTHA 1MMPA 3HB2P 1G12A 1PWQA 1JH1A 3LIKA 1ZTQA 2MZIA 3EHYA 4ILWD 1WNIA 3LJGA 1OO9A 1EUBA 4L6TA 4H84A 1Q3AA 2A8HA 4XCTA 1G49A 3LEAA 4H3XA 2N8RA 4PKWA 3SHIA 3WV1A 5D2BA 1R1IA 5LABA 3HY9A 3RTSA 1QJJA 3G42A 1KUHA 2POJA 1IAEA 2O36A 3TSKA 2OW0A 3ZXHA 3BA0A 2Y6DA 3KECA 3AYUA 3KRYA 2OXWA 1Y0VA 1JIWP 2K9CA 2MLSA 1BUVM 2YIGA 1XURA 1FBLA 1DMTA 2Z2DA 3N2VA 3I7GA 2RJPA 2TCLA 5D1TA 2O3EA 3LILA 1ND1A 1BUDA 1A86A 1I1IP 1XFXA 2AIGP 2WOAA 1SATA 1UTTA 1Z3JA 2J83A 1KUKA 4FXYP 1FM1A 3LGPA 1HV5A 2USNA 3LQBA 2ERPA 3Q2GA 2WO8A 2D1NA 1Y93A 3ELMA 3OHOA 4I35A 1JJ9A 3DL1A 3ZUKA 1XFUA 4G9LA 3N2UA 1HFCA 3LJZA 1UTZA 1USNA 1G05A 4DD8A 1CXVA 1ZP5A 2FV5A 1CK7A 4WK7A 1JAQA 1B8YA 3LUNA 4H30A 1OS2A 4PKRA 1GE6A 4JQGA 1GXDA 1EB6A 1EAKA 1CIZA 5I12A 3Q2HA 1GE7A 3AIGA 1SMPA 1QICA 5D3CA 2YB9A 2OW9A 3EDIA 1B3DA 1CQRA 1XFVA 5CZMA 1K7QA 1PWWA 3KEKA 3V96B 1BQQM 3K7NA 4L63A 2W15A 4H2EA 1KUIA 2K2GA 2OI0A 3TVCA 3DPEA 1XFZA 1R1HA 1XUDA 2FV9A 4JIJA 2CKIA 2KRJA 1PWPA 4GWNA 4L19A 1KUGA 2X7MA 1K7IA 3DNGA 1YCMA 3DPFA 1IAGA 1QIAA 2X3CA 4WF6A 4CTHA 3WV2A 3KMCA 3B2ZA 1AF0A 2MZEA 3O64A 2W0DA 3K7LA 4GR0A 3F19A 5BOTA 3TS4A 1MMQA 1BZSA 3HDBA 4AYKA 2ERQA 2XS4A 3F1AA 4J4MA 3KEJA 1I76A 3U1RA 3AYKA 3LK8A 1D5JA 966CA 3GBOA 4XM6A 1D8FA 1IACA 1C7KA 4PKUA 1G4KA 2X3BA 1R1JA 1HFSA 1ASTA 2RJQA 5D1UA 4H76A 1D7XA 2E2DA 3HDAP 3USNA 5JMYA 3HY7A 2J0TA 3B8ZA 4XBHA 2OW2A 3HBVP 4ZR5A 1IADA 1ATLA 1PWVA 3CKIA 1UEAA 2Y6CA 1L6JA 1YQYA 1QJIA 3KHIA 1I73A 1ZVXA 1A85A 3MA2A 3F15A 1AKLA 3I7IA 2D1OA 3P1VA 1H71P 1BQOA 1UMSA 3ZVSA 4PKQA 2JT5A 4R3VA 4QKZA 2EROA 3LJTA 2WO9A 4DV8A 3F16A 2JIHA 1HY7A 4XM7A 4FXQA 4JPAA 3EDHA 1CGLA 1UMTA 1SU3A 2XS3A 1GKDA 1BIWA 3NX7A 2QPJA 2L0RA 1S4BP 1QIBA 1C3IA 5L7FA 2DDFA 4Q1LA 1CGEA 1KBCA 1OM8A 2W14A 3KWVC 4H49A 4PKVA 4GR8A 1D8MA 3HBUP 4EFSA 1JIZA 1O0TA 1GKCA 3P24A 2JSDA 1XFWA 3DSLA 1R54A 3RTTA 4JA1A 5I43A 2OVXA 4GF1A 2DW0A 1YOUA 3TT4A 5B5PA 4AXQA 3VTGA 1J7NA 4WKEA 3EDZA 1PWUA 1CAQA 3EWJA 456CA 3L0TA 2JNPA 3LMCA 5D1SA 2CLTA 4FVLA 1HTDA 3OHLA 1ZXVA 1IAAA 5BPAA 1OS9A 1IABA 4ON1A 2E3XA 5CXAA 2PJTA 4HMAA 3LUMA 5I3MA 1BM6A 3F18A 1XUCA 4GUYA 2SRTA 4DPEA 1OMJA 3EDGA 3L0VA 1ZXCA 2AYKA 1QUAA 1GO8P 2I47A 3WV3A 3O2XA 1K7GA 3KMEA 1KAPP 4PKTA 5CUHA 1ZS0A 2HU6A 4HX3A 3F17A 5BOYA 4I03A 5I4OA 1RM8A 5I0LA 4IN9A 4IJOA 1C8TA 3LKAA 1O0QA 1OM7A 1HOVA 4AUOA 1JK3A 2W12A 1FLSA 4PKSA 4FU4A 1MMRA 5D7WA 3G5CA 2MZHA 1BSWA 1GE5A 1RMZA 2OY2A 1CGFA 1JKYA 1JANA 4G0DA 1JAPA 4JP4A 4XM8A 2DDYA 2V4BA 3LE9A 2OZRA 1XFYA 3HYGA 2MLRA 5I2ZA 2JT6A 5B5OA 4H1QA 830CA 4AIGA 3LQ0A 1JAOA 4DF9A 3B92A
chains in the Genus database with same CATH superfamily
1MMBA 1G9KA 3UVCA 4WZVA 2DW2A 3DTIA 4WKIA 5L79A 1KUFA 1MNCA 4GR3A 2OY4A 4A7BA 2DW1A 4GQLA 4H82A 3VI1A 2X3AA 1AYKA 1ROSA 2OXUA 1BKCE 1SLMA 3LIRA 1R55A 1OM6A 4GWMA 1GO7P 1BKCI 3EHXA 1BKCA 1SRPA 3E8RA 4IUWA 3DWBA 4A3WA 2OVZA 1Y8JA 2OW1A 5H8XA 2OXZA 1SLNA 2W13A 1YP1A 1DTHA 1MMPA 3HB2P 1G12A 1PWQA 1JH1A 3LIKA 1ZTQA 2MZIA 3EHYA 4ILWD 1WNIA 3LJGA 1OO9A 1EUBA 4L6TA 4H84A 1Q3AA 2A8HA 4XCTA 1G49A 3LEAA 4H3XA 2N8RA 4PKWA 3SHIA 3WV1A 5D2BA 1R1IA 5LABA 3HY9A 3RTSA 1QJJA 3G42A 1KUHA 2POJA 1IAEA 2O36A 3TSKA 2OW0A 3ZXHA 3BA0A 2Y6DA 3KECA 3AYUA 3KRYA 2OXWA 1Y0VA 1JIWP 2K9CA 2MLSA 1BUVM 2YIGA 4L7AA 1XURA 1FBLA 1DMTA 2Z2DA 3N2VA 3I7GA 2RJPA 2TCLA 5D1TA 2O3EA 3LILA 1ND1A 1BUDA 1A86A 1I1IP 1XFXA 2AIGP 2WOAA 1SATA 1UTTA 1Z3JA 2J83A 1KUKA 4FXYP 1FM1A 3LGPA 1HV5A 2USNA 3LQBA 2ERPA 3Q2GA 2WO8A 2D1NA 1Y93A 3ELMA 3OHOA 4I35A 1JJ9A 3DL1A 3ZUKA 1XFUA 4G9LA 3N2UA 1HFCA 3LJZA 1UTZA 1USNA 1G05A 4DD8A 1CXVA 1ZP5A 2FV5A 1CK7A 4WK7A 1JAQA 1B8YA 3DTEA 1OZ9A 3LUNA 4H30A 1OS2A 4PKRA 1GE6A 4JQGA 1GXDA 1EB6A 1EAKA 1CIZA 5I12A 3Q2HA 1TVIA 1GE7A 3AIGA 1SMPA 1QICA 5D3CA 2YB9A 2OW9A 2YUFA 3EDIA 1B3DA 1CQRA 1XFVA 5CZMA 1K7QA 1PWWA 3KEKA 3V96B 1BQQM 3K7NA 4L63A 2W15A 4H2EA 1KUIA 2K2GA 2OI0A 3TVCA 3DPEA 1XFZA 1R1HA 1XUDA 2FV9A 4JIJA 2CKIA 2KRJA 1PWPA 4GWNA 4L19A 1KUGA 2X7MA 1K7IA 3DNGA 1YCMA 3DPFA 1IAGA 1QIAA 2X3CA 4WF6A 4CTHA 3WV2A 3KMCA 3B2ZA 1AF0A 2MZEA 3O64A 2W0DA 3K7LA 4GR0A 3F19A 5BOTA 3TS4A 1MMQA 1BZSA 3HDBA 4AYKA 2ERQA 2XS4A 3F1AA 4J4MA 3KEJA 1I76A 3U1RA 3AYKA 3LK8A 1D5JA 966CA 3GBOA 4XM6A 1D8FA 1IACA 1C7KA 4PKUA 1G4KA 2X3BA 1R1JA 1HFSA 1ASTA 2RJQA 5D1UA 4H76A 1D7XA 2E2DA 3HDAP 3USNA 5JMYA 3HY7A 2J0TA 3B8ZA 4XBHA 2OW2A 3HBVP 4ZR5A 1IADA 1ATLA 1PWVA 3CKIA 1UEAA 2Y6CA 1L6JA 1YQYA 1QJIA 3KHIA 1I73A 1ZVXA 1A85A 3MA2A 3F15A 1AKLA 3I7IA 2D1OA 3P1VA 1H71P 1BQOA 1XAXA 1UMSA 3ZVSA 4PKQA 2JT5A 4R3VA 4QKZA 2EROA 3LJTA 2WO9A 4DV8A 3F16A 2JIHA 1HY7A 4XM7A 4FXQA 4JPAA 3EDHA 1CGLA 1UMTA 1SU3A 2XS3A 1GKDA 1BIWA 3NX7A 2QPJA 2L0RA 1S4BP 1QIBA 1C3IA 5L7FA 2DDFA 4Q1LA 1CGEA 1KBCA 1OM8A 2W14A 3KWVC 4H49A 4PKVA 4GR8A 1D8MA 3HBUP 4EFSA 1JIZA 1O0TA 1GKCA 3P24A 2JSDA 1XFWA 3DSLA 1R54A 3RTTA 4JA1A 5I43A 2OVXA 4GF1A 2DW0A 1YOUA 3TT4A 5B5PA 4AXQA 3VTGA 1J7NA 4WKEA 3EDZA 1PWUA 1CAQA 3EWJA 456CA 3L0TA 2JNPA 3LMCA 5D1SA 2CLTA 4FVLA 1HTDA 3OHLA 1ZXVA 1IAAA 5BPAA 1OS9A 1IABA 4ON1A 2E3XA 5CXAA 2PJTA 4HMAA 3LUMA 5I3MA 1BM6A 3F18A 1XUCA 4GUYA 2SRTA 4DPEA 1OMJA 3EDGA 3L0VA 1ZXCA 2AYKA 1QUAA 1GO8P 2I47A 3WV3A 3O2XA 1K7GA 3KMEA 1KAPP 4PKTA 5CUHA 1ZS0A 2HU6A 4HX3A 3F17A 5BOYA 4I03A 5I4OA 1RM8A 5I0LA 4IN9A 4IJOA 1C8TA 3LKAA 1O0QA 1OM7A 1HOVA 4AUOA 1JK3A 2W12A 1FLSA 4PKSA 4FU4A 1MMRA 5D7WA 3G5CA 2MZHA 1BSWA 1GE5A 1RMZA 2OY2A 1CGFA 1JKYA 1JANA 4G0DA 1JAPA 4JP4A 4XM8A 2DDYA 1XM5A 2V4BA 3LE9A 2OZRA 1XFYA 3HYGA 2MLRA 5I2ZA 2JT6A 5B5OA 4H1QA 830CA 4AIGA 3LQ0A 1JAOA 3DTKA 4DF9A 3B92A
chains in the Genus database with same CATH topology
1MMBA 1G9KA 3UVCA 4WZVA 2DW2A 3DTIA 4WKIA 5L79A 1KUFA 1MNCA 4GR3A 2OY4A 4A7BA 2DW1A 4GQLA 4H82A 3VI1A 2X3AA 1AYKA 1ROSA 2OXUA 1BKCE 1SLMA 3LIRA 1R55A 1OM6A 4GWMA 1GO7P 1BKCI 3EHXA 1BKCA 1SRPA 3E8RA 4IUWA 3DWBA 4A3WA 2OVZA 1Y8JA 2OW1A 5H8XA 2OXZA 1SLNA 2W13A 1YP1A 1DTHA 1MMPA 3HB2P 1G12A 1PWQA 1JH1A 3LIKA 1ZTQA 2MZIA 3EHYA 4ILWD 1WNIA 3LJGA 1OO9A 1EUBA 4L6TA 4H84A 1Q3AA 2A8HA 4XCTA 1G49A 3LEAA 4H3XA 2N8RA 4PKWA 3SHIA 3WV1A 5D2BA 1R1IA 5LABA 3HY9A 3RTSA 1QJJA 3G42A 1KUHA 2POJA 1IAEA 2O36A 3TSKA 2OW0A 3ZXHA 3BA0A 2Y6DA 3KECA 3AYUA 3KRYA 2OXWA 1Y0VA 1JIWP 2K9CA 2MLSA 1BUVM 2YIGA 4L7AA 1XURA 1FBLA 1DMTA 2Z2DA 3N2VA 3I7GA 2RJPA 2TCLA 5D1TA 2O3EA 3LILA 1ND1A 1BUDA 1A86A 1I1IP 1XFXA 2AIGP 2WOAA 1SATA 1UTTA 1Z3JA 2J83A 1KUKA 4FXYP 1FM1A 3LGPA 1HV5A 2USNA 3LQBA 2ERPA 3Q2GA 2WO8A 2D1NA 1Y93A 3ELMA 3OHOA 4I35A 1JJ9A 3DL1A 3ZUKA 1XFUA 4G9LA 3N2UA 1HFCA 3LJZA 1UTZA 1USNA 1G05A 4DD8A 1CXVA 1ZP5A 2FV5A 1CK7A 4WK7A 1JAQA 1B8YA 3DTEA 3LUNA 4H30A 1OS2A 4PKRA 1GE6A 4JQGA 1GXDA 1EB6A 1EAKA 1CIZA 5I12A 3Q2HA 1GE7A 3AIGA 1SMPA 1QICA 5D3CA 2YB9A 2OW9A 2YUFA 3EDIA 1B3DA 1CQRA 1XFVA 5CZMA 1K7QA 1PWWA 3KEKA 3V96B 1BQQM 3K7NA 4L63A 2W15A 4H2EA 1KUIA 2K2GA 2OI0A 3TVCA 3DPEA 1XFZA 1R1HA 1XUDA 2FV9A 4JIJA 2CKIA 2KRJA 1PWPA 4GWNA 4L19A 1KUGA 2X7MA 1K7IA 3DNGA 1YCMA 3DPFA 1IAGA 1QIAA 2X3CA 4WF6A 4CTHA 3WV2A 3KMCA 3B2ZA 1AF0A 2MZEA 3O64A 2W0DA 3K7LA 4GR0A 3F19A 5BOTA 3TS4A 1MMQA 1BZSA 3HDBA 4AYKA 2ERQA 2XS4A 3F1AA 4J4MA 3KEJA 1I76A 3U1RA 3AYKA 3LK8A 1D5JA 966CA 3GBOA 4XM6A 1D8FA 1IACA 1C7KA 4PKUA 1G4KA 2X3BA 1R1JA 1HFSA 1ASTA 2RJQA 5D1UA 4H76A 1D7XA 2E2DA 3HDAP 3USNA 5JMYA 3HY7A 2J0TA 3B8ZA 4XBHA 2OW2A 3HBVP 4ZR5A 1IADA 1ATLA 1PWVA 3CKIA 1UEAA 2Y6CA 1L6JA 1YQYA 1QJIA 3KHIA 1I73A 1ZVXA 1A85A 3MA2A 3F15A 1AKLA 3I7IA 2D1OA 3P1VA 1H71P 1BQOA 1UMSA 3ZVSA 4PKQA 2JT5A 4R3VA 4QKZA 2EROA 3LJTA 2WO9A 4DV8A 3F16A 2JIHA 1HY7A 4XM7A 4FXQA 4JPAA 3EDHA 1CGLA 1UMTA 1SU3A 2XS3A 1GKDA 1BIWA 3NX7A 2QPJA 2L0RA 1S4BP 1QIBA 1C3IA 5L7FA 2DDFA 4Q1LA 1CGEA 1KBCA 1OM8A 2W14A 3KWVC 4H49A 4PKVA 4GR8A 1D8MA 3HBUP 4EFSA 1JIZA 1O0TA 1GKCA 3P24A 2JSDA 1XFWA 3DSLA 1R54A 3RTTA 4JA1A 5I43A 2OVXA 4GF1A 2DW0A 1YOUA 3TT4A 5B5PA 4AXQA 3VTGA 1J7NA 4WKEA 3EDZA 1PWUA 1CAQA 3EWJA 456CA 3L0TA 2JNPA 3LMCA 5D1SA 2CLTA 4FVLA 1HTDA 3OHLA 1ZXVA 1IAAA 5BPAA 1OS9A 1IABA 4ON1A 2E3XA 5CXAA 2PJTA 4HMAA 3LUMA 5I3MA 1BM6A 3F18A 1XUCA 4GUYA 2SRTA 4DPEA 1OMJA 3EDGA 3L0VA 1ZXCA 2AYKA 1QUAA 1GO8P 2I47A 3WV3A 3O2XA 1K7GA 3KMEA 1KAPP 4PKTA 5CUHA 1ZS0A 2HU6A 4HX3A 3F17A 5BOYA 4I03A 5I4OA 1RM8A 5I0LA 4IN9A 4IJOA 1C8TA 3LKAA 1O0QA 1OM7A 1HOVA 4AUOA 1JK3A 2W12A 1FLSA 4PKSA 4FU4A 1MMRA 5D7WA 3G5CA 2MZHA 1BSWA 1GE5A 1RMZA 2OY2A 1CGFA 1JKYA 1JANA 4G0DA 1JAPA 4JP4A 4XM8A 2DDYA 2V4BA 3LE9A 2OZRA 1XFYA 3HYGA 2MLRA 5I2ZA 2JT6A 5B5OA 4H1QA 830CA 4AIGA 3LQ0A 1JAOA 3DTKA 4DF9A 3B92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMB A;  1G9K A;  3UVC A;  4WZV A;  2DW2 A;  4WKI A;  5L79 A;  1KUF A;  1MNC A;  4GR3 A;  2OY4 A;  4A7B A;  2DW1 A;  4GQL A;  4H82 A;  3VI1 A;  2X3A A;  1AYK A;  1ROS A;  2OXU A;  1BKC E;  1SLM A;  3LIR A;  1R55 A;  1OM6 A;  4GWM A;  1GO7 P;  1BKC I;  3EHX A;  1BKC A;  1SRP A;  3E8R A;  4IUW A;  3DWB A;  4A3W A;  2OVZ A;  1Y8J A;  2OW1 A;  5H8X A;  2OXZ A;  1SLN A;  2W13 A;  1YP1 A;  1DTH A;  1MMP A;  3HB2 P;  1G12 A;  1PWQ A;  1JH1 A;  3LIK A;  1ZTQ A;  2MZI A;  3EHY A;  4ILW D;  1WNI A;  3LJG A;  1OO9 A;  1EUB A;  4L6T A;  4H84 A;  1Q3A A;  2A8H A;  4XCT A;  1G49 A;  3LEA A;  4H3X A;  2N8R A;  4PKW A;  3SHI A;  3WV1 A;  5D2B A;  1R1I A;  5LAB A;  3HY9 A;  3RTS A;  1QJJ A;  3G42 A;  1KUH A;  2POJ A;  1IAE A;  2O36 A;  3TSK A;  2OW0 A;  3ZXH A;  3BA0 A;  2Y6D A;  3KEC A;  3AYU A;  3KRY A;  2OXW A;  1Y0V A;  1JIW P;  2K9C A;  2MLS A;  1BUV M;  2YIG A;  1XUR A;  1FBL A;  1DMT A;  2Z2D A;  3N2V A;  3I7G A;  2RJP A;  2TCL A;  5D1T A;  2O3E A;  3LIL A;  1ND1 A;  1BUD A;  1A86 A;  1I1I P;  1XFX A;  2AIG P;  2WOA A;  1SAT A;  1UTT A;  1Z3J A;  2J83 A;  1KUK A;  4FXY P;  1FM1 A;  3LGP A;  1HV5 A;  2USN A;  3LQB A;  2ERP A;  3Q2G A;  2WO8 A;  2D1N A;  1Y93 A;  3ELM A;  3OHO A;  4I35 A;  1JJ9 A;  3DL1 A;  3ZUK A;  1XFU A;  4G9L A;  3N2U A;  1HFC A;  3LJZ A;  1UTZ A;  1USN A;  1G05 A;  4DD8 A;  1CXV A;  1ZP5 A;  2FV5 A;  1CK7 A;  4WK7 A;  1JAQ A;  1B8Y A;  3LUN A;  4H30 A;  1OS2 A;  4PKR A;  1GE6 A;  4JQG A;  1GXD A;  1EB6 A;  1EAK A;  1CIZ A;  5I12 A;  3Q2H A;  1GE7 A;  3AIG A;  1SMP A;  1QIC A;  5D3C A;  2YB9 A;  2OW9 A;  3EDI A;  1B3D A;  1CQR A;  1XFV A;  5CZM A;  1K7Q A;  1PWW A;  3KEK A;  3V96 B;  1BQQ M;  3K7N A;  4L63 A;  2W15 A;  4H2E A;  1KUI A;  2K2G A;  2OI0 A;  3TVC A;  3DPE A;  1XFZ A;  1R1H A;  1XUD A;  2FV9 A;  4JIJ A;  2CKI A;  2KRJ A;  1PWP A;  4GWN A;  4L19 A;  1KUG A;  2X7M A;  1K7I A;  3DNG A;  1YCM A;  3DPF A;  1IAG A;  1QIA A;  2X3C A;  4WF6 A;  4CTH A;  3WV2 A;  3KMC A;  3B2Z A;  1AF0 A;  2MZE A;  3O64 A;  2W0D A;  3K7L A;  4GR0 A;  3F19 A;  5BOT A;  3TS4 A;  1MMQ A;  1BZS A;  3HDB A;  4AYK A;  2ERQ A;  2XS4 A;  3F1A A;  4J4M A;  3KEJ A;  1I76 A;  3U1R A;  3AYK A;  3LK8 A;  1D5J A;  966C A;  3GBO A;  4XM6 A;  1D8F A;  1IAC A;  1C7K A;  4PKU A;  1G4K A;  2X3B A;  1R1J A;  1HFS A;  1AST A;  2RJQ A;  5D1U A;  4H76 A;  1D7X A;  2E2D A;  3HDA P;  3USN A;  5JMY A;  3HY7 A;  2J0T A;  3B8Z A;  4XBH A;  2OW2 A;  3HBV P;  4ZR5 A;  1IAD A;  1ATL A;  1PWV A;  3CKI A;  1UEA A;  2Y6C A;  1L6J A;  1YQY A;  1QJI A;  3KHI A;  1I73 A;  1ZVX A;  1A85 A;  3MA2 A;  3F15 A;  1AKL A;  3I7I A;  2D1O A;  3P1V A;  1H71 P;  1BQO A;  1UMS A;  3ZVS A;  4PKQ A;  2JT5 A;  4R3V A;  4QKZ A;  2ERO A;  3LJT A;  2WO9 A;  4DV8 A;  3F16 A;  2JIH A;  1HY7 A;  4XM7 A;  4FXQ A;  4JPA A;  3EDH A;  1CGL A;  1UMT A;  1SU3 A;  2XS3 A;  1GKD A;  1BIW A;  3NX7 A;  2QPJ A;  2L0R A;  1S4B P;  1QIB A;  1C3I A;  5L7F A;  2DDF A;  4Q1L A;  1CGE A;  1KBC A;  1OM8 A;  2W14 A;  3KWV C;  4H49 A;  4PKV A;  4GR8 A;  1D8M A;  3HBU P;  4EFS A;  1JIZ A;  1O0T A;  1GKC A;  3P24 A;  2JSD A;  1XFW A;  3DSL A;  1R54 A;  3RTT A;  4JA1 A;  5I43 A;  2OVX A;  4GF1 A;  2DW0 A;  1YOU A;  3TT4 A;  5B5P A;  4AXQ A;  3VTG A;  1J7N A;  4WKE A;  3EDZ A;  1PWU A;  1CAQ A;  3EWJ A;  456C A;  3L0T A;  2JNP A;  3LMC A;  5D1S A;  2CLT A;  4FVL A;  1HTD A;  3OHL A;  1ZXV A;  1IAA A;  5BPA A;  1OS9 A;  1IAB A;  4ON1 A;  2E3X A;  5CXA A;  2PJT A;  4HMA A;  3LUM A;  5I3M A;  1BM6 A;  3F18 A;  1XUC A;  4GUY A;  2SRT A;  4DPE A;  1OMJ A;  3EDG A;  3L0V A;  1ZXC A;  2AYK A;  1QUA A;  1GO8 P;  2I47 A;  3WV3 A;  3O2X A;  1K7G A;  3KME A;  1KAP P;  4PKT A;  5CUH A;  1ZS0 A;  2HU6 A;  4HX3 A;  3F17 A;  5BOY A;  4I03 A;  5I4O A;  1RM8 A;  5I0L A;  4IN9 A;  4IJO A;  1C8T A;  3LKA A;  1O0Q A;  1OM7 A;  1HOV A;  4AUO A;  1JK3 A;  2W12 A;  1FLS A;  4PKS A;  4FU4 A;  1MMR A;  5D7W A;  3G5C A;  2MZH A;  1BSW A;  1GE5 A;  1RMZ A;  2OY2 A;  1CGF A;  1JKY A;  1JAN A;  4G0D A;  1JAP A;  4JP4 A;  4XM8 A;  2DDY A;  2V4B A;  3LE9 A;  2OZR A;  1XFY A;  3HYG A;  2MLR A;  5I2Z A;  2JT6 A;  5B5O A;  4H1Q A;  830C A;  4AIG A;  3LQ0 A;  1JAO A;  4DF9 A;  3B92 A; 
#chains in the Genus database with same CATH topology
 1MMB A;  1G9K A;  3UVC A;  4WZV A;  2DW2 A;  3DTI A;  4WKI A;  5L79 A;  1KUF A;  1MNC A;  4GR3 A;  2OY4 A;  4A7B A;  2DW1 A;  4GQL A;  4H82 A;  3VI1 A;  2X3A A;  1AYK A;  1ROS A;  2OXU A;  1BKC E;  1SLM A;  3LIR A;  1R55 A;  1OM6 A;  4GWM A;  1GO7 P;  1BKC I;  3EHX A;  1BKC A;  1SRP A;  3E8R A;  4IUW A;  3DWB A;  4A3W A;  2OVZ A;  1Y8J A;  2OW1 A;  5H8X A;  2OXZ A;  1SLN A;  2W13 A;  1YP1 A;  1DTH A;  1MMP A;  3HB2 P;  1G12 A;  1PWQ A;  1JH1 A;  3LIK A;  1ZTQ A;  2MZI A;  3EHY A;  4ILW D;  1WNI A;  3LJG A;  1OO9 A;  1EUB A;  4L6T A;  4H84 A;  1Q3A A;  2A8H A;  4XCT A;  1G49 A;  3LEA A;  4H3X A;  2N8R A;  4PKW A;  3SHI A;  3WV1 A;  5D2B A;  1R1I A;  5LAB A;  3HY9 A;  3RTS A;  1QJJ A;  3G42 A;  1KUH A;  2POJ A;  1IAE A;  2O36 A;  3TSK A;  2OW0 A;  3ZXH A;  3BA0 A;  2Y6D A;  3KEC A;  3AYU A;  3KRY A;  2OXW A;  1Y0V A;  1JIW P;  2K9C A;  2MLS A;  1BUV M;  2YIG A;  4L7A A;  1XUR A;  1FBL A;  1DMT A;  2Z2D A;  3N2V A;  3I7G A;  2RJP A;  2TCL A;  5D1T A;  2O3E A;  3LIL A;  1ND1 A;  1BUD A;  1A86 A;  1I1I P;  1XFX A;  2AIG P;  2WOA A;  1SAT A;  1UTT A;  1Z3J A;  2J83 A;  1KUK A;  4FXY P;  1FM1 A;  3LGP A;  1HV5 A;  2USN A;  3LQB A;  2ERP A;  3Q2G A;  2WO8 A;  2D1N A;  1Y93 A;  3ELM A;  3OHO A;  4I35 A;  1JJ9 A;  3DL1 A;  3ZUK A;  1XFU A;  4G9L A;  3N2U A;  1HFC A;  3LJZ A;  1UTZ A;  1USN A;  1G05 A;  4DD8 A;  1CXV A;  1ZP5 A;  2FV5 A;  1CK7 A;  4WK7 A;  1JAQ A;  1B8Y A;  3DTE A;  1OZ9 A;  3LUN A;  4H30 A;  1OS2 A;  4PKR A;  1GE6 A;  4JQG A;  1GXD A;  1EB6 A;  1EAK A;  1CIZ A;  5I12 A;  3Q2H A;  1TVI A;  1GE7 A;  3AIG A;  1SMP A;  1QIC A;  5D3C A;  2YB9 A;  2OW9 A;  2YUF A;  3EDI A;  1B3D A;  1CQR A;  1XFV A;  5CZM A;  1K7Q A;  1PWW A;  3KEK A;  3V96 B;  1BQQ M;  3K7N A;  4L63 A;  2W15 A;  4H2E A;  1KUI A;  2K2G A;  2OI0 A;  3TVC A;  3DPE A;  1XFZ A;  1R1H A;  1XUD A;  2FV9 A;  4JIJ A;  2CKI A;  2KRJ A;  1PWP A;  4GWN A;  4L19 A;  1KUG A;  2X7M A;  1K7I A;  3DNG A;  1YCM A;  3DPF A;  1IAG A;  1QIA A;  2X3C A;  4WF6 A;  4CTH A;  3WV2 A;  3KMC A;  3B2Z A;  1AF0 A;  2MZE A;  3O64 A;  2W0D A;  3K7L A;  4GR0 A;  3F19 A;  5BOT A;  3TS4 A;  1MMQ A;  1BZS A;  3HDB A;  4AYK A;  2ERQ A;  2XS4 A;  3F1A A;  4J4M A;  3KEJ A;  1I76 A;  3U1R A;  3AYK A;  3LK8 A;  1D5J A;  966C A;  3GBO A;  4XM6 A;  1D8F A;  1IAC A;  1C7K A;  4PKU A;  1G4K A;  2X3B A;  1R1J A;  1HFS A;  1AST A;  2RJQ A;  5D1U A;  4H76 A;  1D7X A;  2E2D A;  3HDA P;  3USN A;  5JMY A;  3HY7 A;  2J0T A;  3B8Z A;  4XBH A;  2OW2 A;  3HBV P;  4ZR5 A;  1IAD A;  1ATL A;  1PWV A;  3CKI A;  1UEA A;  2Y6C A;  1L6J A;  1YQY A;  1QJI A;  3KHI A;  1I73 A;  1ZVX A;  1A85 A;  3MA2 A;  3F15 A;  1AKL A;  3I7I A;  2D1O A;  3P1V A;  1H71 P;  1BQO A;  1XAX A;  1UMS A;  3ZVS A;  4PKQ A;  2JT5 A;  4R3V A;  4QKZ A;  2ERO A;  3LJT A;  2WO9 A;  4DV8 A;  3F16 A;  2JIH A;  1HY7 A;  4XM7 A;  4FXQ A;  4JPA A;  3EDH A;  1CGL A;  1UMT A;  1SU3 A;  2XS3 A;  1GKD A;  1BIW A;  3NX7 A;  2QPJ A;  2L0R A;  1S4B P;  1QIB A;  1C3I A;  5L7F A;  2DDF A;  4Q1L A;  1CGE A;  1KBC A;  1OM8 A;  2W14 A;  3KWV C;  4H49 A;  4PKV A;  4GR8 A;  1D8M A;  3HBU P;  4EFS A;  1JIZ A;  1O0T A;  1GKC A;  3P24 A;  2JSD A;  1XFW A;  3DSL A;  1R54 A;  3RTT A;  4JA1 A;  5I43 A;  2OVX A;  4GF1 A;  2DW0 A;  1YOU A;  3TT4 A;  5B5P A;  4AXQ A;  3VTG A;  1J7N A;  4WKE A;  3EDZ A;  1PWU A;  1CAQ A;  3EWJ A;  456C A;  3L0T A;  2JNP A;  3LMC A;  5D1S A;  2CLT A;  4FVL A;  1HTD A;  3OHL A;  1ZXV A;  1IAA A;  5BPA A;  1OS9 A;  1IAB A;  4ON1 A;  2E3X A;  5CXA A;  2PJT A;  4HMA A;  3LUM A;  5I3M A;  1BM6 A;  3F18 A;  1XUC A;  4GUY A;  2SRT A;  4DPE A;  1OMJ A;  3EDG A;  3L0V A;  1ZXC A;  2AYK A;  1QUA A;  1GO8 P;  2I47 A;  3WV3 A;  3O2X A;  1K7G A;  3KME A;  1KAP P;  4PKT A;  5CUH A;  1ZS0 A;  2HU6 A;  4HX3 A;  3F17 A;  5BOY A;  4I03 A;  5I4O A;  1RM8 A;  5I0L A;  4IN9 A;  4IJO A;  1C8T A;  3LKA A;  1O0Q A;  1OM7 A;  1HOV A;  4AUO A;  1JK3 A;  2W12 A;  1FLS A;  4PKS A;  4FU4 A;  1MMR A;  5D7W A;  3G5C A;  2MZH A;  1BSW A;  1GE5 A;  1RMZ A;  2OY2 A;  1CGF A;  1JKY A;  1JAN A;  4G0D A;  1JAP A;  4JP4 A;  4XM8 A;  2DDY A;  1XM5 A;  2V4B A;  3LE9 A;  2OZR A;  1XFY A;  3HYG A;  2MLR A;  5I2Z A;  2JT6 A;  5B5O A;  4H1Q A;  830C A;  4AIG A;  3LQ0 A;  1JAO A;  3DTK A;  4DF9 A;  3B92 A; 
#chains in the Genus database with same CATH homology
 1MMB A;  1G9K A;  3UVC A;  4WZV A;  2DW2 A;  3DTI A;  4WKI A;  5L79 A;  1KUF A;  1MNC A;  4GR3 A;  2OY4 A;  4A7B A;  2DW1 A;  4GQL A;  4H82 A;  3VI1 A;  2X3A A;  1AYK A;  1ROS A;  2OXU A;  1BKC E;  1SLM A;  3LIR A;  1R55 A;  1OM6 A;  4GWM A;  1GO7 P;  1BKC I;  3EHX A;  1BKC A;  1SRP A;  3E8R A;  4IUW A;  3DWB A;  4A3W A;  2OVZ A;  1Y8J A;  2OW1 A;  5H8X A;  2OXZ A;  1SLN A;  2W13 A;  1YP1 A;  1DTH A;  1MMP A;  3HB2 P;  1G12 A;  1PWQ A;  1JH1 A;  3LIK A;  1ZTQ A;  2MZI A;  3EHY A;  4ILW D;  1WNI A;  3LJG A;  1OO9 A;  1EUB A;  4L6T A;  4H84 A;  1Q3A A;  2A8H A;  4XCT A;  1G49 A;  3LEA A;  4H3X A;  2N8R A;  4PKW A;  3SHI A;  3WV1 A;  5D2B A;  1R1I A;  5LAB A;  3HY9 A;  3RTS A;  1QJJ A;  3G42 A;  1KUH A;  2POJ A;  1IAE A;  2O36 A;  3TSK A;  2OW0 A;  3ZXH A;  3BA0 A;  2Y6D A;  3KEC A;  3AYU A;  3KRY A;  2OXW A;  1Y0V A;  1JIW P;  2K9C A;  2MLS A;  1BUV M;  2YIG A;  4L7A A;  1XUR A;  1FBL A;  1DMT A;  2Z2D A;  3N2V A;  3I7G A;  2RJP A;  2TCL A;  5D1T A;  2O3E A;  3LIL A;  1ND1 A;  1BUD A;  1A86 A;  1I1I P;  1XFX A;  2AIG P;  2WOA A;  1SAT A;  1UTT A;  1Z3J A;  2J83 A;  1KUK A;  4FXY P;  1FM1 A;  3LGP A;  1HV5 A;  2USN A;  3LQB A;  2ERP A;  3Q2G A;  2WO8 A;  2D1N A;  1Y93 A;  3ELM A;  3OHO A;  4I35 A;  1JJ9 A;  3DL1 A;  3ZUK A;  1XFU A;  4G9L A;  3N2U A;  1HFC A;  3LJZ A;  1UTZ A;  1USN A;  1G05 A;  4DD8 A;  1CXV A;  1ZP5 A;  2FV5 A;  1CK7 A;  4WK7 A;  1JAQ A;  1B8Y A;  3DTE A;  3LUN A;  4H30 A;  1OS2 A;  4PKR A;  1GE6 A;  4JQG A;  1GXD A;  1EB6 A;  1EAK A;  1CIZ A;  5I12 A;  3Q2H A;  1GE7 A;  3AIG A;  1SMP A;  1QIC A;  5D3C A;  2YB9 A;  2OW9 A;  2YUF A;  3EDI A;  1B3D A;  1CQR A;  1XFV A;  5CZM A;  1K7Q A;  1PWW A;  3KEK A;  3V96 B;  1BQQ M;  3K7N A;  4L63 A;  2W15 A;  4H2E A;  1KUI A;  2K2G A;  2OI0 A;  3TVC A;  3DPE A;  1XFZ A;  1R1H A;  1XUD A;  2FV9 A;  4JIJ A;  2CKI A;  2KRJ A;  1PWP A;  4GWN A;  4L19 A;  1KUG A;  2X7M A;  1K7I A;  3DNG A;  1YCM A;  3DPF A;  1IAG A;  1QIA A;  2X3C A;  4WF6 A;  4CTH A;  3WV2 A;  3KMC A;  3B2Z A;  1AF0 A;  2MZE A;  3O64 A;  2W0D A;  3K7L A;  4GR0 A;  3F19 A;  5BOT A;  3TS4 A;  1MMQ A;  1BZS A;  3HDB A;  4AYK A;  2ERQ A;  2XS4 A;  3F1A A;  4J4M A;  3KEJ A;  1I76 A;  3U1R A;  3AYK A;  3LK8 A;  1D5J A;  966C A;  3GBO A;  4XM6 A;  1D8F A;  1IAC A;  1C7K A;  4PKU A;  1G4K A;  2X3B A;  1R1J A;  1HFS A;  1AST A;  2RJQ A;  5D1U A;  4H76 A;  1D7X A;  2E2D A;  3HDA P;  3USN A;  5JMY A;  3HY7 A;  2J0T A;  3B8Z A;  4XBH A;  2OW2 A;  3HBV P;  4ZR5 A;  1IAD A;  1ATL A;  1PWV A;  3CKI A;  1UEA A;  2Y6C A;  1L6J A;  1YQY A;  1QJI A;  3KHI A;  1I73 A;  1ZVX A;  1A85 A;  3MA2 A;  3F15 A;  1AKL A;  3I7I A;  2D1O A;  3P1V A;  1H71 P;  1BQO A;  1UMS A;  3ZVS A;  4PKQ A;  2JT5 A;  4R3V A;  4QKZ A;  2ERO A;  3LJT A;  2WO9 A;  4DV8 A;  3F16 A;  2JIH A;  1HY7 A;  4XM7 A;  4FXQ A;  4JPA A;  3EDH A;  1CGL A;  1UMT A;  1SU3 A;  2XS3 A;  1GKD A;  1BIW A;  3NX7 A;  2QPJ A;  2L0R A;  1S4B P;  1QIB A;  1C3I A;  5L7F A;  2DDF A;  4Q1L A;  1CGE A;  1KBC A;  1OM8 A;  2W14 A;  3KWV C;  4H49 A;  4PKV A;  4GR8 A;  1D8M A;  3HBU P;  4EFS A;  1JIZ A;  1O0T A;  1GKC A;  3P24 A;  2JSD A;  1XFW A;  3DSL A;  1R54 A;  3RTT A;  4JA1 A;  5I43 A;  2OVX A;  4GF1 A;  2DW0 A;  1YOU A;  3TT4 A;  5B5P A;  4AXQ A;  3VTG A;  1J7N A;  4WKE A;  3EDZ A;  1PWU A;  1CAQ A;  3EWJ A;  456C A;  3L0T A;  2JNP A;  3LMC A;  5D1S A;  2CLT A;  4FVL A;  1HTD A;  3OHL A;  1ZXV A;  1IAA A;  5BPA A;  1OS9 A;  1IAB A;  4ON1 A;  2E3X A;  5CXA A;  2PJT A;  4HMA A;  3LUM A;  5I3M A;  1BM6 A;  3F18 A;  1XUC A;  4GUY A;  2SRT A;  4DPE A;  1OMJ A;  3EDG A;  3L0V A;  1ZXC A;  2AYK A;  1QUA A;  1GO8 P;  2I47 A;  3WV3 A;  3O2X A;  1K7G A;  3KME A;  1KAP P;  4PKT A;  5CUH A;  1ZS0 A;  2HU6 A;  4HX3 A;  3F17 A;  5BOY A;  4I03 A;  5I4O A;  1RM8 A;  5I0L A;  4IN9 A;  4IJO A;  1C8T A;  3LKA A;  1O0Q A;  1OM7 A;  1HOV A;  4AUO A;  1JK3 A;  2W12 A;  1FLS A;  4PKS A;  4FU4 A;  1MMR A;  5D7W A;  3G5C A;  2MZH A;  1BSW A;  1GE5 A;  1RMZ A;  2OY2 A;  1CGF A;  1JKY A;  1JAN A;  4G0D A;  1JAP A;  4JP4 A;  4XM8 A;  2DDY A;  2V4B A;  3LE9 A;  2OZR A;  1XFY A;  3HYG A;  2MLR A;  5I2Z A;  2JT6 A;  5B5O A;  4H1Q A;  830C A;  4AIG A;  3LQ0 A;  1JAO A;  3DTK A;  4DF9 A;  3B92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...