2D1OA

Stromelysin-1 (mmp-3) complexed to a hydroxamic acid inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
171
structure length
171
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Stromelysin-1
publication title Crystal structures of the catalytic domain of human stromelysin-1 (MMP-3) and collagenase-3 (MMP-13) with a hydroxamic acid inhibitor SM-25453
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2d1oA00
3KMEA 1XUCA 1EB6A 1XFZA 2FV9A 3OHOA 1BZSA 1B8YA 5D2BA 1CQRA 3N2UA 2L0RA 3DWBA 2OW1A 1EUBA 2W12A 3KMCA 3E8RA 3LQ0A 1I1IP 1ZS0A 3WV2A 4FXQA 2J83A 5B5OA 2ERPA 4H3XA 1G4KA 3OHLA 1R1IA 3N2VA 4GR0A 1BKCE 4GQLA 2YB9A 4PKUA 1ASTA 1J7NA 1XUDA 2Z2DA 4XCTA 1EAKA 3USNA 4L6TA 4H49A 1C3IA 2W14A 2RJPA 1XURA 1Y8JA 3LUMA 5CZMA 4J4MA 3ZUKA 2WO8A 5I2ZA 3RTTA 1JH1A 2OY4A 4L63A 4GUYA 3F15A 1I73A 1QJIA 1D8FA 1SATA 3DPEA 1K7IA 1SLNA 2DDYA 1AYKA 2D1OA 3K7NA 5LABA 2JNPA 1KBCA 1AF0A 1SLMA 1BSWA 2XS4A 2WOAA 1HY7A 3GBOA 2CLTA 4IUWA 3TS4A 3UVCA 3P24A 5H8XA 2OI0A 4PKRA 3LJZA 5I43A 1D5JA 1KUGA 1D7XA 1B3DA 1GKDA 3KHIA 1MMQA 1HV5A 3VI1A 1ZXCA 1JANA 3LEAA 3BA0A 3I7GA 1ZXVA 5D1TA 4JIJA 5BPAA 2W0DA 4IN9A 1H71P 1OM6A 3Q2GA 4GF1A 1JKYA 3LE9A 3F17A 3HDAP 1CK7A 3EHYA 1ZVXA 3ZXHA 1QUAA 1YP1A 3KEKA 1YOUA 1UEAA 4JP4A 4R3VA 5BOYA 2DW1A 2A8HA 1FM1A 3B92A 2I47A 1XFYA 3KEJA 3LUNA 4AIGA 3HY9A 1Z3JA 1USNA 2DDFA 1CAQA 3LJGA 1GE5A 830CA 1GE6A 3LMCA 3G42A 4ILWD 1AKLA 1GE7A 4G0DA 1XFWA 5CUHA 2FV5A 3KECA 3LILA 1PWVA 5D7WA 2W13A 1IAAA 2V4BA 2X3BA 1PWPA 4I03A 1MMRA 4WKIA 1BQQM 1GKCA 5L7FA 1XFXA 966CA 3L0VA 1Q3AA 3LJTA 4PKTA 2OY2A 1C7KA 4A3WA 1G9KA 1JK3A 4EFSA 1G12A 3EWJA 1SU3A 1WNIA 2OW2A 1KUKA 2OW0A 4L19A 1MNCA 1CIZA 3RTSA 3SHIA 1UTTA 2J0TA 2OXUA 4PKQA 2OW9A 4G9LA 1R1JA 3ELMA 2Y6DA 4H30A 3HBUP 1SRPA 2RJQA 1K7QA 1CGEA 3G5CA 1DTHA 1C8TA 1Y0VA 4PKVA 3WV1A 2EROA 1ND1A 2JSDA 4DPEA 1QIAA 1PWQA 3WV3A 2OVXA 3HYGA 2MLRA 2DW2A 1RM8A 1FLSA 2E3XA 5D1SA 4AXQA 1ZTQA 1QIBA 1CXVA 4XBHA 4GWMA 2OXZA 3HY7A 3F1AA 456CA 1JAOA 3I7IA 3CKIA 1MMPA 4WK7A 1IACA 1R55A 1KAPP 2YIGA 4XM6A 2TCLA 3EDGA 1JAQA 1ATLA 4JQGA 1G05A 1UMSA 2HU6A 1JIZA 1OO9A 1CGFA 3TVCA 5BOTA 1OS9A 3NX7A 4I35A 2K2GA 1R54A 1KUHA 2X3AA 4IJOA 1ZP5A 4JA1A 1JAPA 3EHXA 1BUDA 3AYUA 2PJTA 1K7GA 1FBLA 3EDIA 1Y93A 3LQBA 1GO8P 2ERQA 2OXWA 1HFCA 4XM8A 1HOVA 1CGLA 1A85A 1IAEA 3MA2A 2X7MA 5I0LA 3LKAA 1UMTA 4Q1LA 2MZEA 2SRTA 2JIHA 3DSLA 4FU4A 2JT6A 4WZVA 5D1UA 3LIRA 1GO7P 3ZVSA 4CTHA 2DW0A 1KUFA 3K7LA 2MLSA 4DF9A 1UTZA 4FXYP 1JIWP 4HX3A 5I4OA 1OMJA 4JPAA 1RMZA 3DPFA 3Q2HA 4H84A 3F18A 1BM6A 2D1NA 1MMBA 2AIGP 1A86A 1S4BP 1O0TA 1YQYA 1DMTA 1XFUA 4AUOA 2K9CA 3KRYA 3V96B 4H2EA 4GR3A 1OM8A 2W15A 2KRJA 4DD8A 3O2XA 4H1QA 2O3EA 5JMYA 1HFSA 4WKEA 4AYKA 1BUVM 5D3CA 3EDHA 4HMAA 1YCMA 4PKWA 4DV8A 1SMPA 3DNGA 2CKIA 4GWNA 3TSKA 2QPJA 4XM7A 1R1HA 2E2DA 1O0QA 4A7BA 2JT5A 4GR8A 4ZR5A 1L6JA 2AYKA 2O36A 1IADA 3L0TA 4H82A 4PKSA 4WF6A 3U1RA 1D8MA 3B2ZA 1I76A 2USNA 3DL1A 1GXDA 2XS3A 1PWUA 3EDZA 5CXAA 3HDBA 1IABA 4ON1A 2WO9A 3KWVC 2X3CA 1OS2A 1XFVA 3O64A 2Y6CA 3TT4A 1HTDA 3F19A 1QJJA 5I3MA 5L79A 1BIWA 1ROSA 5B5PA 1JJ9A 1BKCA 2MZIA 3AIGA 4FVLA 1OM7A 1IAGA 1BKCI 3HB2P 1BQOA 5I12A 2MZHA 2N8RA 3F16A 3P1VA 3LK8A 4QKZA 3LIKA 3AYKA 3VTGA 1PWWA 1G49A 3HBVP 1KUIA 2OZRA 4H76A 3B8ZA 2OVZA 2POJA 1QICA 3LGPA
chains in the Genus database with same CATH superfamily
3KMEA 1XUCA 1EB6A 1XFZA 2FV9A 3OHOA 1BZSA 1B8YA 5D2BA 1CQRA 3N2UA 2L0RA 3DWBA 2OW1A 1EUBA 2W12A 3KMCA 3E8RA 3LQ0A 1I1IP 1ZS0A 3WV2A 4FXQA 2J83A 5B5OA 2ERPA 4H3XA 1G4KA 3OHLA 1R1IA 3N2VA 4GR0A 1BKCE 4GQLA 2YB9A 4PKUA 1ASTA 1J7NA 1XUDA 2Z2DA 4XCTA 1EAKA 3USNA 4L6TA 4H49A 1C3IA 2W14A 2RJPA 1XURA 1Y8JA 3LUMA 5CZMA 4J4MA 3ZUKA 2WO8A 5I2ZA 3RTTA 1JH1A 2OY4A 4L63A 4GUYA 3DTIA 3F15A 1I73A 1QJIA 1D8FA 1SATA 3DPEA 1K7IA 1SLNA 2DDYA 1AYKA 2D1OA 3K7NA 5LABA 2JNPA 1KBCA 1AF0A 1SLMA 1BSWA 2XS4A 2WOAA 1HY7A 3GBOA 2CLTA 4IUWA 3TS4A 3UVCA 3P24A 5H8XA 2OI0A 4PKRA 3LJZA 1XM5A 5I43A 1D5JA 1KUGA 1D7XA 1B3DA 1GKDA 3KHIA 1MMQA 1HV5A 3VI1A 1ZXCA 1JANA 3LEAA 3BA0A 3I7GA 1ZXVA 5D1TA 4JIJA 5BPAA 2W0DA 4IN9A 1H71P 1OM6A 3Q2GA 4GF1A 1JKYA 4L7AA 3LE9A 3F17A 3HDAP 1CK7A 3EHYA 1ZVXA 3ZXHA 1QUAA 1YP1A 3KEKA 1YOUA 1UEAA 4JP4A 4R3VA 5BOYA 2DW1A 2A8HA 1FM1A 3B92A 2I47A 1XFYA 3KEJA 3LUNA 4AIGA 3HY9A 1Z3JA 1USNA 2DDFA 1CAQA 3LJGA 1XAXA 1GE5A 830CA 1GE6A 3LMCA 3G42A 4ILWD 1AKLA 1GE7A 4G0DA 1XFWA 5CUHA 2FV5A 3KECA 3LILA 1PWVA 5D7WA 2W13A 1IAAA 2V4BA 2X3BA 1PWPA 4I03A 1MMRA 4WKIA 1BQQM 1GKCA 5L7FA 1XFXA 966CA 3L0VA 1Q3AA 3LJTA 4PKTA 2OY2A 1C7KA 4A3WA 1G9KA 1JK3A 4EFSA 1G12A 3EWJA 1SU3A 1WNIA 2OW2A 1KUKA 2OW0A 4L19A 1MNCA 1CIZA 3RTSA 3SHIA 1UTTA 2J0TA 2OXUA 4PKQA 2OW9A 4G9LA 1R1JA 3ELMA 2Y6DA 4H30A 3HBUP 1SRPA 2RJQA 1K7QA 1CGEA 3G5CA 1DTHA 1C8TA 1Y0VA 4PKVA 3WV1A 2EROA 1ND1A 2JSDA 4DPEA 1QIAA 1PWQA 3WV3A 2OVXA 3HYGA 2MLRA 2DW2A 1RM8A 1FLSA 2E3XA 5D1SA 4AXQA 1ZTQA 1QIBA 1CXVA 4XBHA 4GWMA 2OXZA 3HY7A 3F1AA 456CA 1JAOA 3I7IA 3CKIA 1MMPA 4WK7A 1IACA 1R55A 1KAPP 2YIGA 4XM6A 2TCLA 3EDGA 1JAQA 1ATLA 4JQGA 1G05A 1UMSA 2HU6A 1JIZA 1OO9A 1CGFA 3DTEA 3TVCA 5BOTA 1OS9A 3NX7A 4I35A 2K2GA 1R54A 1KUHA 2X3AA 4IJOA 1ZP5A 4JA1A 1JAPA 3EHXA 1BUDA 3AYUA 2PJTA 1K7GA 1FBLA 3EDIA 1Y93A 3LQBA 1GO8P 2ERQA 2OXWA 1HFCA 4XM8A 1HOVA 1CGLA 1A85A 1IAEA 3MA2A 2X7MA 5I0LA 3LKAA 1UMTA 4Q1LA 2MZEA 2SRTA 2JIHA 3DSLA 4FU4A 2JT6A 4WZVA 5D1UA 3LIRA 1GO7P 3ZVSA 4CTHA 1TVIA 2DW0A 1KUFA 3K7LA 2MLSA 4DF9A 1UTZA 4FXYP 1JIWP 4HX3A 5I4OA 1OMJA 4JPAA 1RMZA 3DPFA 3Q2HA 4H84A 3F18A 1BM6A 2D1NA 1MMBA 3DTKA 2AIGP 1A86A 1S4BP 1O0TA 1YQYA 1DMTA 1XFUA 4AUOA 2K9CA 3KRYA 3V96B 4H2EA 4GR3A 1OM8A 2W15A 2KRJA 4DD8A 3O2XA 4H1QA 2O3EA 5JMYA 1HFSA 4WKEA 4AYKA 1BUVM 5D3CA 3EDHA 4HMAA 1YCMA 4PKWA 4DV8A 1SMPA 3DNGA 2CKIA 1OZ9A 4GWNA 3TSKA 2QPJA 4XM7A 1R1HA 2E2DA 1O0QA 4A7BA 2JT5A 4GR8A 4ZR5A 1L6JA 2AYKA 2O36A 1IADA 3L0TA 4H82A 4PKSA 4WF6A 3U1RA 1D8MA 3B2ZA 1I76A 2USNA 3DL1A 1GXDA 2XS3A 1PWUA 3EDZA 5CXAA 3HDBA 1IABA 4ON1A 2WO9A 3KWVC 2X3CA 1OS2A 1XFVA 3O64A 2Y6CA 3TT4A 1HTDA 3F19A 1QJJA 5I3MA 5L79A 1BIWA 1ROSA 5B5PA 1JJ9A 1BKCA 2MZIA 3AIGA 4FVLA 1OM7A 1IAGA 1BKCI 3HB2P 1BQOA 5I12A 2MZHA 2N8RA 3F16A 3P1VA 3LK8A 4QKZA 2YUFA 3LIKA 3AYKA 3VTGA 1PWWA 1G49A 3HBVP 1KUIA 2OZRA 4H76A 3B8ZA 2OVZA 2POJA 1QICA 3LGPA
chains in the Genus database with same CATH topology
3KMEA 1XUCA 1EB6A 1XFZA 2FV9A 3OHOA 1BZSA 1B8YA 5D2BA 1CQRA 3N2UA 2L0RA 3DWBA 2OW1A 1EUBA 2W12A 3KMCA 3E8RA 3LQ0A 1I1IP 1ZS0A 3WV2A 4FXQA 2J83A 5B5OA 2ERPA 4H3XA 1G4KA 3OHLA 1R1IA 3N2VA 4GR0A 1BKCE 4GQLA 2YB9A 4PKUA 1ASTA 1J7NA 1XUDA 2Z2DA 4XCTA 1EAKA 3USNA 4L6TA 4H49A 1C3IA 2W14A 2RJPA 1XURA 1Y8JA 3LUMA 5CZMA 4J4MA 3ZUKA 2WO8A 5I2ZA 3RTTA 1JH1A 2OY4A 4L63A 4GUYA 3DTIA 3F15A 1I73A 1QJIA 1D8FA 1SATA 3DPEA 1K7IA 1SLNA 2DDYA 1AYKA 2D1OA 3K7NA 5LABA 2JNPA 1KBCA 1AF0A 1SLMA 1BSWA 2XS4A 2WOAA 1HY7A 3GBOA 2CLTA 4IUWA 3TS4A 3UVCA 3P24A 5H8XA 2OI0A 4PKRA 3LJZA 5I43A 1D5JA 1KUGA 1D7XA 1B3DA 1GKDA 3KHIA 1MMQA 1HV5A 3VI1A 1ZXCA 1JANA 3LEAA 3BA0A 3I7GA 1ZXVA 5D1TA 4JIJA 5BPAA 2W0DA 4IN9A 1H71P 1OM6A 3Q2GA 4GF1A 1JKYA 4L7AA 3LE9A 3F17A 3HDAP 1CK7A 3EHYA 1ZVXA 3ZXHA 1QUAA 1YP1A 3KEKA 1YOUA 1UEAA 4JP4A 4R3VA 5BOYA 2DW1A 2A8HA 1FM1A 3B92A 2I47A 1XFYA 3KEJA 3LUNA 4AIGA 3HY9A 1Z3JA 1USNA 2DDFA 1CAQA 3LJGA 1GE5A 830CA 1GE6A 3LMCA 3G42A 4ILWD 1AKLA 1GE7A 4G0DA 1XFWA 5CUHA 2FV5A 3KECA 3LILA 1PWVA 5D7WA 2W13A 1IAAA 2V4BA 2X3BA 1PWPA 4I03A 1MMRA 4WKIA 1BQQM 1GKCA 5L7FA 1XFXA 966CA 3L0VA 1Q3AA 3LJTA 4PKTA 2OY2A 1C7KA 4A3WA 1G9KA 1JK3A 4EFSA 1G12A 3EWJA 1SU3A 1WNIA 2OW2A 1KUKA 2OW0A 4L19A 1MNCA 1CIZA 3RTSA 3SHIA 1UTTA 2J0TA 2OXUA 4PKQA 2OW9A 4G9LA 1R1JA 3ELMA 2Y6DA 4H30A 3HBUP 1SRPA 2RJQA 1K7QA 1CGEA 3G5CA 1DTHA 1C8TA 1Y0VA 4PKVA 3WV1A 2EROA 1ND1A 2JSDA 4DPEA 1QIAA 1PWQA 3WV3A 2OVXA 3HYGA 2MLRA 2DW2A 1RM8A 1FLSA 2E3XA 5D1SA 4AXQA 1ZTQA 1QIBA 1CXVA 4XBHA 4GWMA 2OXZA 3HY7A 3F1AA 456CA 1JAOA 3I7IA 3CKIA 1MMPA 4WK7A 1IACA 1R55A 1KAPP 2YIGA 4XM6A 2TCLA 3EDGA 1JAQA 1ATLA 4JQGA 1G05A 1UMSA 2HU6A 1JIZA 1OO9A 1CGFA 3DTEA 3TVCA 5BOTA 1OS9A 3NX7A 4I35A 2K2GA 1R54A 1KUHA 2X3AA 4IJOA 1ZP5A 4JA1A 1JAPA 3EHXA 1BUDA 3AYUA 2PJTA 1K7GA 1FBLA 3EDIA 1Y93A 3LQBA 1GO8P 2ERQA 2OXWA 1HFCA 4XM8A 1HOVA 1CGLA 1A85A 1IAEA 3MA2A 2X7MA 5I0LA 3LKAA 1UMTA 4Q1LA 2MZEA 2SRTA 2JIHA 3DSLA 4FU4A 2JT6A 4WZVA 5D1UA 3LIRA 1GO7P 3ZVSA 4CTHA 2DW0A 1KUFA 3K7LA 2MLSA 4DF9A 1UTZA 4FXYP 1JIWP 4HX3A 5I4OA 1OMJA 4JPAA 1RMZA 3DPFA 3Q2HA 4H84A 3F18A 1BM6A 2D1NA 1MMBA 3DTKA 2AIGP 1A86A 1S4BP 1O0TA 1YQYA 1DMTA 1XFUA 4AUOA 2K9CA 3KRYA 3V96B 4H2EA 4GR3A 1OM8A 2W15A 2KRJA 4DD8A 3O2XA 4H1QA 2O3EA 5JMYA 1HFSA 4WKEA 4AYKA 1BUVM 5D3CA 3EDHA 4HMAA 1YCMA 4PKWA 4DV8A 1SMPA 3DNGA 2CKIA 4GWNA 3TSKA 2QPJA 4XM7A 1R1HA 2E2DA 1O0QA 4A7BA 2JT5A 4GR8A 4ZR5A 1L6JA 2AYKA 2O36A 1IADA 3L0TA 4H82A 4PKSA 4WF6A 3U1RA 1D8MA 3B2ZA 1I76A 2USNA 3DL1A 1GXDA 2XS3A 1PWUA 3EDZA 5CXAA 3HDBA 1IABA 4ON1A 2WO9A 3KWVC 2X3CA 1OS2A 1XFVA 3O64A 2Y6CA 3TT4A 1HTDA 3F19A 1QJJA 5I3MA 5L79A 1BIWA 1ROSA 5B5PA 1JJ9A 1BKCA 2MZIA 3AIGA 4FVLA 1OM7A 1IAGA 1BKCI 3HB2P 1BQOA 5I12A 2MZHA 2N8RA 3F16A 3P1VA 3LK8A 4QKZA 2YUFA 3LIKA 3AYKA 3VTGA 1PWWA 1G49A 3HBVP 1KUIA 2OZRA 4H76A 3B8ZA 2OVZA 2POJA 1QICA 3LGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KME A;  1XUC A;  1EB6 A;  1XFZ A;  2FV9 A;  3OHO A;  1BZS A;  1B8Y A;  5D2B A;  1CQR A;  3N2U A;  2L0R A;  3DWB A;  2OW1 A;  1EUB A;  2W12 A;  3KMC A;  3E8R A;  3LQ0 A;  1I1I P;  1ZS0 A;  3WV2 A;  4FXQ A;  2J83 A;  5B5O A;  2ERP A;  4H3X A;  1G4K A;  3OHL A;  1R1I A;  3N2V A;  4GR0 A;  1BKC E;  4GQL A;  2YB9 A;  4PKU A;  1AST A;  1J7N A;  1XUD A;  2Z2D A;  4XCT A;  1EAK A;  3USN A;  4L6T A;  4H49 A;  1C3I A;  2W14 A;  2RJP A;  1XUR A;  1Y8J A;  3LUM A;  5CZM A;  4J4M A;  3ZUK A;  2WO8 A;  5I2Z A;  3RTT A;  1JH1 A;  2OY4 A;  4L63 A;  4GUY A;  3F15 A;  1I73 A;  1QJI A;  1D8F A;  1SAT A;  3DPE A;  1K7I A;  1SLN A;  2DDY A;  1AYK A;  2D1O A;  3K7N A;  5LAB A;  2JNP A;  1KBC A;  1AF0 A;  1SLM A;  1BSW A;  2XS4 A;  2WOA A;  1HY7 A;  3GBO A;  2CLT A;  4IUW A;  3TS4 A;  3UVC A;  3P24 A;  5H8X A;  2OI0 A;  4PKR A;  3LJZ A;  5I43 A;  1D5J A;  1KUG A;  1D7X A;  1B3D A;  1GKD A;  3KHI A;  1MMQ A;  1HV5 A;  3VI1 A;  1ZXC A;  1JAN A;  3LEA A;  3BA0 A;  3I7G A;  1ZXV A;  5D1T A;  4JIJ A;  5BPA A;  2W0D A;  4IN9 A;  1H71 P;  1OM6 A;  3Q2G A;  4GF1 A;  1JKY A;  3LE9 A;  3F17 A;  3HDA P;  1CK7 A;  3EHY A;  1ZVX A;  3ZXH A;  1QUA A;  1YP1 A;  3KEK A;  1YOU A;  1UEA A;  4JP4 A;  4R3V A;  5BOY A;  2DW1 A;  2A8H A;  1FM1 A;  3B92 A;  2I47 A;  1XFY A;  3KEJ A;  3LUN A;  4AIG A;  3HY9 A;  1Z3J A;  1USN A;  2DDF A;  1CAQ A;  3LJG A;  1GE5 A;  830C A;  1GE6 A;  3LMC A;  3G42 A;  4ILW D;  1AKL A;  1GE7 A;  4G0D A;  1XFW A;  5CUH A;  2FV5 A;  3KEC A;  3LIL A;  1PWV A;  5D7W A;  2W13 A;  1IAA A;  2V4B A;  2X3B A;  1PWP A;  4I03 A;  1MMR A;  4WKI A;  1BQQ M;  1GKC A;  5L7F A;  1XFX A;  966C A;  3L0V A;  1Q3A A;  3LJT A;  4PKT A;  2OY2 A;  1C7K A;  4A3W A;  1G9K A;  1JK3 A;  4EFS A;  1G12 A;  3EWJ A;  1SU3 A;  1WNI A;  2OW2 A;  1KUK A;  2OW0 A;  4L19 A;  1MNC A;  1CIZ A;  3RTS A;  3SHI A;  1UTT A;  2J0T A;  2OXU A;  4PKQ A;  2OW9 A;  4G9L A;  1R1J A;  3ELM A;  2Y6D A;  4H30 A;  3HBU P;  1SRP A;  2RJQ A;  1K7Q A;  1CGE A;  3G5C A;  1DTH A;  1C8T A;  1Y0V A;  4PKV A;  3WV1 A;  2ERO A;  1ND1 A;  2JSD A;  4DPE A;  1QIA A;  1PWQ A;  3WV3 A;  2OVX A;  3HYG A;  2MLR A;  2DW2 A;  1RM8 A;  1FLS A;  2E3X A;  5D1S A;  4AXQ A;  1ZTQ A;  1QIB A;  1CXV A;  4XBH A;  4GWM A;  2OXZ A;  3HY7 A;  3F1A A;  456C A;  1JAO A;  3I7I A;  3CKI A;  1MMP A;  4WK7 A;  1IAC A;  1R55 A;  1KAP P;  2YIG A;  4XM6 A;  2TCL A;  3EDG A;  1JAQ A;  1ATL A;  4JQG A;  1G05 A;  1UMS A;  2HU6 A;  1JIZ A;  1OO9 A;  1CGF A;  3TVC A;  5BOT A;  1OS9 A;  3NX7 A;  4I35 A;  2K2G A;  1R54 A;  1KUH A;  2X3A A;  4IJO A;  1ZP5 A;  4JA1 A;  1JAP A;  3EHX A;  1BUD A;  3AYU A;  2PJT A;  1K7G A;  1FBL A;  3EDI A;  1Y93 A;  3LQB A;  1GO8 P;  2ERQ A;  2OXW A;  1HFC A;  4XM8 A;  1HOV A;  1CGL A;  1A85 A;  1IAE A;  3MA2 A;  2X7M A;  5I0L A;  3LKA A;  1UMT A;  4Q1L A;  2MZE A;  2SRT A;  2JIH A;  3DSL A;  4FU4 A;  2JT6 A;  4WZV A;  5D1U A;  3LIR A;  1GO7 P;  3ZVS A;  4CTH A;  2DW0 A;  1KUF A;  3K7L A;  2MLS A;  4DF9 A;  1UTZ A;  4FXY P;  1JIW P;  4HX3 A;  5I4O A;  1OMJ A;  4JPA A;  1RMZ A;  3DPF A;  3Q2H A;  4H84 A;  3F18 A;  1BM6 A;  2D1N A;  1MMB A;  2AIG P;  1A86 A;  1S4B P;  1O0T A;  1YQY A;  1DMT A;  1XFU A;  4AUO A;  2K9C A;  3KRY A;  3V96 B;  4H2E A;  4GR3 A;  1OM8 A;  2W15 A;  2KRJ A;  4DD8 A;  3O2X A;  4H1Q A;  2O3E A;  5JMY A;  1HFS A;  4WKE A;  4AYK A;  1BUV M;  5D3C A;  3EDH A;  4HMA A;  1YCM A;  4PKW A;  4DV8 A;  1SMP A;  3DNG A;  2CKI A;  4GWN A;  3TSK A;  2QPJ A;  4XM7 A;  1R1H A;  2E2D A;  1O0Q A;  4A7B A;  2JT5 A;  4GR8 A;  4ZR5 A;  1L6J A;  2AYK A;  2O36 A;  1IAD A;  3L0T A;  4H82 A;  4PKS A;  4WF6 A;  3U1R A;  1D8M A;  3B2Z A;  1I76 A;  2USN A;  3DL1 A;  1GXD A;  2XS3 A;  1PWU A;  3EDZ A;  5CXA A;  3HDB A;  1IAB A;  4ON1 A;  2WO9 A;  3KWV C;  2X3C A;  1OS2 A;  1XFV A;  3O64 A;  2Y6C A;  3TT4 A;  1HTD A;  3F19 A;  1QJJ A;  5I3M A;  5L79 A;  1BIW A;  1ROS A;  5B5P A;  1JJ9 A;  1BKC A;  2MZI A;  3AIG A;  4FVL A;  1OM7 A;  1IAG A;  1BKC I;  3HB2 P;  1BQO A;  5I12 A;  2MZH A;  2N8R A;  3F16 A;  3P1V A;  3LK8 A;  4QKZ A;  3LIK A;  3AYK A;  3VTG A;  1PWW A;  1G49 A;  3HBV P;  1KUI A;  2OZR A;  4H76 A;  3B8Z A;  2OVZ A;  2POJ A;  1QIC A;  3LGP A; 
#chains in the Genus database with same CATH topology
 3KME A;  1XUC A;  1EB6 A;  1XFZ A;  2FV9 A;  3OHO A;  1BZS A;  1B8Y A;  5D2B A;  1CQR A;  3N2U A;  2L0R A;  3DWB A;  2OW1 A;  1EUB A;  2W12 A;  3KMC A;  3E8R A;  3LQ0 A;  1I1I P;  1ZS0 A;  3WV2 A;  4FXQ A;  2J83 A;  5B5O A;  2ERP A;  4H3X A;  1G4K A;  3OHL A;  1R1I A;  3N2V A;  4GR0 A;  1BKC E;  4GQL A;  2YB9 A;  4PKU A;  1AST A;  1J7N A;  1XUD A;  2Z2D A;  4XCT A;  1EAK A;  3USN A;  4L6T A;  4H49 A;  1C3I A;  2W14 A;  2RJP A;  1XUR A;  1Y8J A;  3LUM A;  5CZM A;  4J4M A;  3ZUK A;  2WO8 A;  5I2Z A;  3RTT A;  1JH1 A;  2OY4 A;  4L63 A;  4GUY A;  3DTI A;  3F15 A;  1I73 A;  1QJI A;  1D8F A;  1SAT A;  3DPE A;  1K7I A;  1SLN A;  2DDY A;  1AYK A;  2D1O A;  3K7N A;  5LAB A;  2JNP A;  1KBC A;  1AF0 A;  1SLM A;  1BSW A;  2XS4 A;  2WOA A;  1HY7 A;  3GBO A;  2CLT A;  4IUW A;  3TS4 A;  3UVC A;  3P24 A;  5H8X A;  2OI0 A;  4PKR A;  3LJZ A;  1XM5 A;  5I43 A;  1D5J A;  1KUG A;  1D7X A;  1B3D A;  1GKD A;  3KHI A;  1MMQ A;  1HV5 A;  3VI1 A;  1ZXC A;  1JAN A;  3LEA A;  3BA0 A;  3I7G A;  1ZXV A;  5D1T A;  4JIJ A;  5BPA A;  2W0D A;  4IN9 A;  1H71 P;  1OM6 A;  3Q2G A;  4GF1 A;  1JKY A;  4L7A A;  3LE9 A;  3F17 A;  3HDA P;  1CK7 A;  3EHY A;  1ZVX A;  3ZXH A;  1QUA A;  1YP1 A;  3KEK A;  1YOU A;  1UEA A;  4JP4 A;  4R3V A;  5BOY A;  2DW1 A;  2A8H A;  1FM1 A;  3B92 A;  2I47 A;  1XFY A;  3KEJ A;  3LUN A;  4AIG A;  3HY9 A;  1Z3J A;  1USN A;  2DDF A;  1CAQ A;  3LJG A;  1XAX A;  1GE5 A;  830C A;  1GE6 A;  3LMC A;  3G42 A;  4ILW D;  1AKL A;  1GE7 A;  4G0D A;  1XFW A;  5CUH A;  2FV5 A;  3KEC A;  3LIL A;  1PWV A;  5D7W A;  2W13 A;  1IAA A;  2V4B A;  2X3B A;  1PWP A;  4I03 A;  1MMR A;  4WKI A;  1BQQ M;  1GKC A;  5L7F A;  1XFX A;  966C A;  3L0V A;  1Q3A A;  3LJT A;  4PKT A;  2OY2 A;  1C7K A;  4A3W A;  1G9K A;  1JK3 A;  4EFS A;  1G12 A;  3EWJ A;  1SU3 A;  1WNI A;  2OW2 A;  1KUK A;  2OW0 A;  4L19 A;  1MNC A;  1CIZ A;  3RTS A;  3SHI A;  1UTT A;  2J0T A;  2OXU A;  4PKQ A;  2OW9 A;  4G9L A;  1R1J A;  3ELM A;  2Y6D A;  4H30 A;  3HBU P;  1SRP A;  2RJQ A;  1K7Q A;  1CGE A;  3G5C A;  1DTH A;  1C8T A;  1Y0V A;  4PKV A;  3WV1 A;  2ERO A;  1ND1 A;  2JSD A;  4DPE A;  1QIA A;  1PWQ A;  3WV3 A;  2OVX A;  3HYG A;  2MLR A;  2DW2 A;  1RM8 A;  1FLS A;  2E3X A;  5D1S A;  4AXQ A;  1ZTQ A;  1QIB A;  1CXV A;  4XBH A;  4GWM A;  2OXZ A;  3HY7 A;  3F1A A;  456C A;  1JAO A;  3I7I A;  3CKI A;  1MMP A;  4WK7 A;  1IAC A;  1R55 A;  1KAP P;  2YIG A;  4XM6 A;  2TCL A;  3EDG A;  1JAQ A;  1ATL A;  4JQG A;  1G05 A;  1UMS A;  2HU6 A;  1JIZ A;  1OO9 A;  1CGF A;  3DTE A;  3TVC A;  5BOT A;  1OS9 A;  3NX7 A;  4I35 A;  2K2G A;  1R54 A;  1KUH A;  2X3A A;  4IJO A;  1ZP5 A;  4JA1 A;  1JAP A;  3EHX A;  1BUD A;  3AYU A;  2PJT A;  1K7G A;  1FBL A;  3EDI A;  1Y93 A;  3LQB A;  1GO8 P;  2ERQ A;  2OXW A;  1HFC A;  4XM8 A;  1HOV A;  1CGL A;  1A85 A;  1IAE A;  3MA2 A;  2X7M A;  5I0L A;  3LKA A;  1UMT A;  4Q1L A;  2MZE A;  2SRT A;  2JIH A;  3DSL A;  4FU4 A;  2JT6 A;  4WZV A;  5D1U A;  3LIR A;  1GO7 P;  3ZVS A;  4CTH A;  1TVI A;  2DW0 A;  1KUF A;  3K7L A;  2MLS A;  4DF9 A;  1UTZ A;  4FXY P;  1JIW P;  4HX3 A;  5I4O A;  1OMJ A;  4JPA A;  1RMZ A;  3DPF A;  3Q2H A;  4H84 A;  3F18 A;  1BM6 A;  2D1N A;  1MMB A;  3DTK A;  2AIG P;  1A86 A;  1S4B P;  1O0T A;  1YQY A;  1DMT A;  1XFU A;  4AUO A;  2K9C A;  3KRY A;  3V96 B;  4H2E A;  4GR3 A;  1OM8 A;  2W15 A;  2KRJ A;  4DD8 A;  3O2X A;  4H1Q A;  2O3E A;  5JMY A;  1HFS A;  4WKE A;  4AYK A;  1BUV M;  5D3C A;  3EDH A;  4HMA A;  1YCM A;  4PKW A;  4DV8 A;  1SMP A;  3DNG A;  2CKI A;  1OZ9 A;  4GWN A;  3TSK A;  2QPJ A;  4XM7 A;  1R1H A;  2E2D A;  1O0Q A;  4A7B A;  2JT5 A;  4GR8 A;  4ZR5 A;  1L6J A;  2AYK A;  2O36 A;  1IAD A;  3L0T A;  4H82 A;  4PKS A;  4WF6 A;  3U1R A;  1D8M A;  3B2Z A;  1I76 A;  2USN A;  3DL1 A;  1GXD A;  2XS3 A;  1PWU A;  3EDZ A;  5CXA A;  3HDB A;  1IAB A;  4ON1 A;  2WO9 A;  3KWV C;  2X3C A;  1OS2 A;  1XFV A;  3O64 A;  2Y6C A;  3TT4 A;  1HTD A;  3F19 A;  1QJJ A;  5I3M A;  5L79 A;  1BIW A;  1ROS A;  5B5P A;  1JJ9 A;  1BKC A;  2MZI A;  3AIG A;  4FVL A;  1OM7 A;  1IAG A;  1BKC I;  3HB2 P;  1BQO A;  5I12 A;  2MZH A;  2N8R A;  3F16 A;  3P1V A;  3LK8 A;  4QKZ A;  2YUF A;  3LIK A;  3AYK A;  3VTG A;  1PWW A;  1G49 A;  3HBV P;  1KUI A;  2OZR A;  4H76 A;  3B8Z A;  2OVZ A;  2POJ A;  1QIC A;  3LGP A; 
#chains in the Genus database with same CATH homology
 3KME A;  1XUC A;  1EB6 A;  1XFZ A;  2FV9 A;  3OHO A;  1BZS A;  1B8Y A;  5D2B A;  1CQR A;  3N2U A;  2L0R A;  3DWB A;  2OW1 A;  1EUB A;  2W12 A;  3KMC A;  3E8R A;  3LQ0 A;  1I1I P;  1ZS0 A;  3WV2 A;  4FXQ A;  2J83 A;  5B5O A;  2ERP A;  4H3X A;  1G4K A;  3OHL A;  1R1I A;  3N2V A;  4GR0 A;  1BKC E;  4GQL A;  2YB9 A;  4PKU A;  1AST A;  1J7N A;  1XUD A;  2Z2D A;  4XCT A;  1EAK A;  3USN A;  4L6T A;  4H49 A;  1C3I A;  2W14 A;  2RJP A;  1XUR A;  1Y8J A;  3LUM A;  5CZM A;  4J4M A;  3ZUK A;  2WO8 A;  5I2Z A;  3RTT A;  1JH1 A;  2OY4 A;  4L63 A;  4GUY A;  3DTI A;  3F15 A;  1I73 A;  1QJI A;  1D8F A;  1SAT A;  3DPE A;  1K7I A;  1SLN A;  2DDY A;  1AYK A;  2D1O A;  3K7N A;  5LAB A;  2JNP A;  1KBC A;  1AF0 A;  1SLM A;  1BSW A;  2XS4 A;  2WOA A;  1HY7 A;  3GBO A;  2CLT A;  4IUW A;  3TS4 A;  3UVC A;  3P24 A;  5H8X A;  2OI0 A;  4PKR A;  3LJZ A;  5I43 A;  1D5J A;  1KUG A;  1D7X A;  1B3D A;  1GKD A;  3KHI A;  1MMQ A;  1HV5 A;  3VI1 A;  1ZXC A;  1JAN A;  3LEA A;  3BA0 A;  3I7G A;  1ZXV A;  5D1T A;  4JIJ A;  5BPA A;  2W0D A;  4IN9 A;  1H71 P;  1OM6 A;  3Q2G A;  4GF1 A;  1JKY A;  4L7A A;  3LE9 A;  3F17 A;  3HDA P;  1CK7 A;  3EHY A;  1ZVX A;  3ZXH A;  1QUA A;  1YP1 A;  3KEK A;  1YOU A;  1UEA A;  4JP4 A;  4R3V A;  5BOY A;  2DW1 A;  2A8H A;  1FM1 A;  3B92 A;  2I47 A;  1XFY A;  3KEJ A;  3LUN A;  4AIG A;  3HY9 A;  1Z3J A;  1USN A;  2DDF A;  1CAQ A;  3LJG A;  1GE5 A;  830C A;  1GE6 A;  3LMC A;  3G42 A;  4ILW D;  1AKL A;  1GE7 A;  4G0D A;  1XFW A;  5CUH A;  2FV5 A;  3KEC A;  3LIL A;  1PWV A;  5D7W A;  2W13 A;  1IAA A;  2V4B A;  2X3B A;  1PWP A;  4I03 A;  1MMR A;  4WKI A;  1BQQ M;  1GKC A;  5L7F A;  1XFX A;  966C A;  3L0V A;  1Q3A A;  3LJT A;  4PKT A;  2OY2 A;  1C7K A;  4A3W A;  1G9K A;  1JK3 A;  4EFS A;  1G12 A;  3EWJ A;  1SU3 A;  1WNI A;  2OW2 A;  1KUK A;  2OW0 A;  4L19 A;  1MNC A;  1CIZ A;  3RTS A;  3SHI A;  1UTT A;  2J0T A;  2OXU A;  4PKQ A;  2OW9 A;  4G9L A;  1R1J A;  3ELM A;  2Y6D A;  4H30 A;  3HBU P;  1SRP A;  2RJQ A;  1K7Q A;  1CGE A;  3G5C A;  1DTH A;  1C8T A;  1Y0V A;  4PKV A;  3WV1 A;  2ERO A;  1ND1 A;  2JSD A;  4DPE A;  1QIA A;  1PWQ A;  3WV3 A;  2OVX A;  3HYG A;  2MLR A;  2DW2 A;  1RM8 A;  1FLS A;  2E3X A;  5D1S A;  4AXQ A;  1ZTQ A;  1QIB A;  1CXV A;  4XBH A;  4GWM A;  2OXZ A;  3HY7 A;  3F1A A;  456C A;  1JAO A;  3I7I A;  3CKI A;  1MMP A;  4WK7 A;  1IAC A;  1R55 A;  1KAP P;  2YIG A;  4XM6 A;  2TCL A;  3EDG A;  1JAQ A;  1ATL A;  4JQG A;  1G05 A;  1UMS A;  2HU6 A;  1JIZ A;  1OO9 A;  1CGF A;  3DTE A;  3TVC A;  5BOT A;  1OS9 A;  3NX7 A;  4I35 A;  2K2G A;  1R54 A;  1KUH A;  2X3A A;  4IJO A;  1ZP5 A;  4JA1 A;  1JAP A;  3EHX A;  1BUD A;  3AYU A;  2PJT A;  1K7G A;  1FBL A;  3EDI A;  1Y93 A;  3LQB A;  1GO8 P;  2ERQ A;  2OXW A;  1HFC A;  4XM8 A;  1HOV A;  1CGL A;  1A85 A;  1IAE A;  3MA2 A;  2X7M A;  5I0L A;  3LKA A;  1UMT A;  4Q1L A;  2MZE A;  2SRT A;  2JIH A;  3DSL A;  4FU4 A;  2JT6 A;  4WZV A;  5D1U A;  3LIR A;  1GO7 P;  3ZVS A;  4CTH A;  2DW0 A;  1KUF A;  3K7L A;  2MLS A;  4DF9 A;  1UTZ A;  4FXY P;  1JIW P;  4HX3 A;  5I4O A;  1OMJ A;  4JPA A;  1RMZ A;  3DPF A;  3Q2H A;  4H84 A;  3F18 A;  1BM6 A;  2D1N A;  1MMB A;  3DTK A;  2AIG P;  1A86 A;  1S4B P;  1O0T A;  1YQY A;  1DMT A;  1XFU A;  4AUO A;  2K9C A;  3KRY A;  3V96 B;  4H2E A;  4GR3 A;  1OM8 A;  2W15 A;  2KRJ A;  4DD8 A;  3O2X A;  4H1Q A;  2O3E A;  5JMY A;  1HFS A;  4WKE A;  4AYK A;  1BUV M;  5D3C A;  3EDH A;  4HMA A;  1YCM A;  4PKW A;  4DV8 A;  1SMP A;  3DNG A;  2CKI A;  4GWN A;  3TSK A;  2QPJ A;  4XM7 A;  1R1H A;  2E2D A;  1O0Q A;  4A7B A;  2JT5 A;  4GR8 A;  4ZR5 A;  1L6J A;  2AYK A;  2O36 A;  1IAD A;  3L0T A;  4H82 A;  4PKS A;  4WF6 A;  3U1R A;  1D8M A;  3B2Z A;  1I76 A;  2USN A;  3DL1 A;  1GXD A;  2XS3 A;  1PWU A;  3EDZ A;  5CXA A;  3HDB A;  1IAB A;  4ON1 A;  2WO9 A;  3KWV C;  2X3C A;  1OS2 A;  1XFV A;  3O64 A;  2Y6C A;  3TT4 A;  1HTD A;  3F19 A;  1QJJ A;  5I3M A;  5L79 A;  1BIW A;  1ROS A;  5B5P A;  1JJ9 A;  1BKC A;  2MZI A;  3AIG A;  4FVL A;  1OM7 A;  1IAG A;  1BKC I;  3HB2 P;  1BQO A;  5I12 A;  2MZH A;  2N8R A;  3F16 A;  3P1V A;  3LK8 A;  4QKZ A;  2YUF A;  3LIK A;  3AYK A;  3VTG A;  1PWW A;  1G49 A;  3HBV P;  1KUI A;  2OZR A;  4H76 A;  3B8Z A;  2OVZ A;  2POJ A;  1QIC A;  3LGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...