2OY4A

Uninhibited human mmp-8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
PKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Neutrophil collagenase
publication title Snapshots of the reaction mechanism of matrix metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 157
sequence length 157
chains with identical sequence F
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2oy4A00
3LQBA 3TVCA 2E3XA 1SATA 1YCMA 4I03A 4G0DA 4H84A 3AYUA 966CA 830CA 4XM8A 3F1AA 4GQLA 3K7NA 2N8RA 4A7BA 3SHIA 3OHLA 5CXAA 5JMYA 1GO8P 3P24A 2QPJA 3ZVSA 4ON1A 4GWNA 1JH1A 1JIZA 2X7MA 4XM7A 1IAEA 1HFCA 3ZUKA 1PWVA 5H8XA 3G5CA 1RM8A 3MA2A 1GE5A 1BUDA 1JANA 4A3WA 4R3VA 3LE9A 1GXDA 3LQ0A 4PKSA 1UTTA 1PWWA 2MZIA 2Y6DA 3O64A 4L6TA 4QKZA 1BKCI 3BA0A 3LEAA 2SRTA 3EHYA 3LILA 3WV2A 3LJZA 1AKLA 5BPAA 5L7FA 4DPEA 1GE7A 5CZMA 4H2EA 1ZXVA 1UMTA 2V4BA 1EUBA 2JNPA 3AYKA 1PWQA 4JQGA 1XFYA 3GBOA 1Y8JA 1USNA 4FXQA 1KUKA 3E8RA 1UTZA 4IN9A 1JK3A 1BQQM 2DW2A 1KUHA 1MMPA 5BOYA 1OS9A 1G49A 1SLMA 3KEJA 5D1SA 1S4BP 2MLRA 3V96B 1MMRA 1HY7A 5D1TA 3I7IA 4AUOA 3K7LA 1G12A 3G42A 3TSKA 1O0TA 3KRYA 1B3DA 4PKTA 3DNGA 1CGEA 1KUIA 4DD8A 4L63A 4Q1LA 1BM6A 1FLSA 1XUCA 2OZRA 1EAKA 2DDFA 1Y93A 3KECA 1CGFA 4AXQA 2Y6CA 3U1RA 1WNIA 1L6JA 4H82A 2YB9A 3L0TA 4DF9A 2POJA 4PKVA 4HX3A 1JAOA 2OW0A 3HY9A 4GR3A 1I73A 3CKIA 4IUWA 456CA 1XFZA 4GWMA 2DW1A 1BSWA 1C3IA 2E2DA 4XBHA 1HV5A 3F17A 1G4KA 2OW9A 3KMCA 2XS4A 3LUMA 4H49A 2FV5A 1DTHA 3ELMA 3LGPA 2X3CA 1BQOA 1R55A 1MNCA 1BKCA 3F19A 2OI0A 4FXYP 3EDHA 4H30A 1IAGA 4JPAA 2MLSA 1YOUA 3KEKA 1Z3JA 1K7QA 1ND1A 3HB2P 1R1IA 4WZVA 2USNA 1D5JA 4WF6A 2J0TA 3EDIA 1GKCA 1BKCE 4ILWD 4I35A 2AYKA 1QJJA 4PKUA 1J7NA 4JP4A 1QIAA 1PWUA 5I2ZA 2OVZA 5B5OA 2MZEA 1KBCA 3DSLA 3LIRA 2D1NA 1AF0A 3KWVC 1ZTQA 5CUHA 4H1QA 3HDBA 2JIHA 5I43A 2W0DA 2K9CA 2J83A 2HU6A 3HBUP 3LK8A 1OMJA 1A86A 1C7KA 1C8TA 1I76A 1UMSA 1MMBA 2OXUA 2Z2DA 4PKWA 1B8YA 1BUVM 1ZP5A 3L0VA 1DMTA 1HTDA 2OW2A 4H76A 2KRJA 3N2UA 1JKYA 3TT4A 1D8FA 4G9LA 3UVCA 5LABA 5B5PA 1KUFA 1KUGA 1K7GA 2CLTA 1YP1A 1BIWA 2YIGA 1ZS0A 3B2ZA 1A85A 3EHXA 1CXVA 5I4OA 3ZXHA 2AIGP 1O0QA 1XFUA 1MMQA 2FV9A 3F18A 2W14A 1OM8A 4DV8A 1JAQA 2DDYA 1YQYA 1IACA 2W12A 4CTHA 1OM6A 1IADA 3LKAA 2WO9A 3B92A 1ATLA 3HYGA 4H3XA 2OY2A 1OM7A 2TCLA 2OXWA 4JA1A 3AIGA 2JSDA 2OW1A 5D7WA 3NX7A 3WV1A 4WKIA 2O36A 4IJOA 2I47A 3WV3A 2OY4A 1SMPA 2WO8A 3VI1A 5D2BA 3N2VA 2ERQA 1EB6A 5I12A 1JIWP 4AYKA 3F15A 1QUAA 1G9KA 2OXZA 1AYKA 4L19A 2L0RA 3LUNA 1SLNA 3LJGA 4JIJA 2RJPA 1K7IA 4AIGA 4GF1A 5I3MA 1CGLA 3VTGA 4GUYA 1IABA 1XURA 1CAQA 3OHOA 2K2GA 4FVLA 3F16A 3EDGA 5D1UA 2EROA 1CQRA 1ROSA 2WOAA 1XFVA 4PKRA 4GR8A 3O2XA 3HDAP 3P1VA 3HBVP 2X3AA 1XFWA 2W15A 3I7GA 1ZVXA 1GO7P 1JJ9A 5BOTA 3DPFA 1ASTA 1QICA 1CIZA 2O3EA 4WK7A 1D8MA 1GKDA 2A8HA 1OS2A 1FBLA 1JAPA 1KAPP 3Q2GA 1H71P 2D1OA 1UEAA 1Y0VA 3RTTA 3B8ZA 2JT5A 3USNA 3Q2HA 1R54A 4ZR5A 2MZHA 1OO9A 4XCTA 2X3BA 1CK7A 1HFSA 4XM6A 4EFSA 2PJTA 1D7XA 1GE6A 3EWJA 3HY7A 5D3CA 1RMZA 2XS3A 3DL1A 1FM1A 1G05A 2CKIA 1Q3AA 1QIBA 1XUDA 4J4MA 2ERPA 3LIKA 1SRPA 1QJIA 3LMCA 4PKQA 4FU4A 1HOVA 2W13A 5I0LA 3LJTA 1BZSA 4HMAA 1ZXCA 1XFXA 3DPEA 4WKEA 4GR0A 1R1JA 1PWPA 1I1IP 1SU3A 2RJQA 3RTSA 3DWBA 3KMEA 3EDZA 3KHIA 2DW0A 1R1HA 2OVXA 5L79A 2JT6A 1IAAA 3TS4A
chains in the Genus database with same CATH superfamily
3LQBA 3TVCA 2E3XA 1SATA 1YCMA 4I03A 4G0DA 4H84A 3AYUA 966CA 830CA 4XM8A 3F1AA 4GQLA 3K7NA 2N8RA 4A7BA 3SHIA 3OHLA 5CXAA 5JMYA 1GO8P 3P24A 2QPJA 3ZVSA 4ON1A 4GWNA 1JH1A 1JIZA 2X7MA 4XM7A 1IAEA 1HFCA 3ZUKA 1PWVA 5H8XA 3G5CA 1RM8A 3MA2A 1GE5A 1BUDA 1JANA 4A3WA 4R3VA 3LE9A 1GXDA 3LQ0A 4PKSA 1UTTA 1PWWA 2MZIA 2Y6DA 3O64A 4L6TA 4QKZA 1BKCI 3BA0A 3LEAA 2SRTA 3EHYA 3LILA 3WV2A 3LJZA 1AKLA 5BPAA 5L7FA 4DPEA 1GE7A 5CZMA 4H2EA 1ZXVA 1UMTA 2V4BA 1EUBA 2JNPA 3AYKA 1PWQA 4JQGA 1XFYA 3GBOA 1Y8JA 1USNA 4FXQA 1KUKA 3E8RA 1UTZA 4IN9A 1JK3A 1BQQM 2DW2A 1KUHA 1XAXA 1MMPA 5BOYA 1OS9A 1G49A 1SLMA 3KEJA 5D1SA 1S4BP 2MLRA 3V96B 1MMRA 1HY7A 1OZ9A 5D1TA 3I7IA 4AUOA 3K7LA 3DTKA 1G12A 3G42A 3TSKA 1O0TA 3DTIA 3KRYA 1B3DA 4PKTA 3DNGA 1CGEA 1KUIA 4DD8A 4L63A 4Q1LA 1BM6A 1FLSA 1XUCA 2OZRA 1EAKA 2DDFA 1Y93A 3KECA 1CGFA 4AXQA 2Y6CA 3U1RA 1WNIA 1L6JA 4H82A 2YB9A 3L0TA 4DF9A 2POJA 4PKVA 4HX3A 1JAOA 2OW0A 3HY9A 4GR3A 1I73A 3CKIA 4IUWA 456CA 1XFZA 4GWMA 2DW1A 1BSWA 1C3IA 2E2DA 4XBHA 1HV5A 3F17A 1G4KA 2OW9A 3KMCA 2XS4A 3LUMA 4H49A 2FV5A 1DTHA 3ELMA 3LGPA 2X3CA 1BQOA 1R55A 1MNCA 1BKCA 3F19A 2OI0A 4FXYP 3EDHA 4H30A 1IAGA 4JPAA 2MLSA 1YOUA 3KEKA 1Z3JA 1K7QA 1ND1A 3HB2P 1R1IA 4WZVA 2USNA 1D5JA 4WF6A 2J0TA 3EDIA 1GKCA 1BKCE 4ILWD 4I35A 2AYKA 1QJJA 4PKUA 1J7NA 4JP4A 1QIAA 1PWUA 5I2ZA 2OVZA 5B5OA 3DTEA 2MZEA 1KBCA 3DSLA 3LIRA 2D1NA 1AF0A 3KWVC 1ZTQA 5CUHA 4H1QA 3HDBA 2JIHA 5I43A 2W0DA 2K9CA 2J83A 2HU6A 3HBUP 3LK8A 1OMJA 1A86A 1C7KA 1C8TA 1I76A 1UMSA 1MMBA 2OXUA 2Z2DA 4PKWA 1B8YA 1BUVM 1ZP5A 3L0VA 1DMTA 1HTDA 2OW2A 4H76A 2KRJA 3N2UA 1JKYA 3TT4A 1D8FA 4G9LA 3UVCA 5LABA 5B5PA 1KUFA 1KUGA 1K7GA 2CLTA 1YP1A 1BIWA 2YIGA 1ZS0A 3B2ZA 1A85A 1XM5A 3EHXA 1CXVA 5I4OA 3ZXHA 2AIGP 1O0QA 1XFUA 1MMQA 2FV9A 3F18A 2W14A 1OM8A 4DV8A 1JAQA 2DDYA 1YQYA 1IACA 2W12A 4CTHA 1OM6A 1IADA 3LKAA 2WO9A 3B92A 1ATLA 3HYGA 4H3XA 2OY2A 1OM7A 2TCLA 2OXWA 4JA1A 3AIGA 2JSDA 2OW1A 5D7WA 3NX7A 3WV1A 4WKIA 2O36A 4IJOA 2I47A 3WV3A 2OY4A 1SMPA 2WO8A 3VI1A 5D2BA 3N2VA 2ERQA 1EB6A 5I12A 1JIWP 4AYKA 3F15A 4L7AA 1QUAA 1G9KA 2OXZA 1AYKA 4L19A 2L0RA 2YUFA 3LUNA 1SLNA 3LJGA 4JIJA 2RJPA 1K7IA 4AIGA 4GF1A 5I3MA 1CGLA 3VTGA 4GUYA 1IABA 1XURA 1CAQA 3OHOA 2K2GA 4FVLA 3F16A 1TVIA 3EDGA 5D1UA 2EROA 1CQRA 1ROSA 2WOAA 1XFVA 4PKRA 4GR8A 3O2XA 3HDAP 3P1VA 3HBVP 2X3AA 1XFWA 2W15A 3I7GA 1ZVXA 1GO7P 1JJ9A 5BOTA 3DPFA 1ASTA 1QICA 1CIZA 2O3EA 4WK7A 1D8MA 1GKDA 2A8HA 1OS2A 1FBLA 1JAPA 1KAPP 3Q2GA 1H71P 2D1OA 1UEAA 1Y0VA 3RTTA 3B8ZA 2JT5A 3USNA 3Q2HA 1R54A 4ZR5A 2MZHA 1OO9A 4XCTA 2X3BA 1CK7A 1HFSA 4XM6A 4EFSA 2PJTA 1D7XA 1GE6A 3EWJA 3HY7A 5D3CA 1RMZA 2XS3A 3DL1A 1FM1A 1G05A 2CKIA 1Q3AA 1QIBA 1XUDA 4J4MA 2ERPA 3LIKA 1SRPA 1QJIA 3LMCA 4PKQA 4FU4A 1HOVA 2W13A 5I0LA 3LJTA 1BZSA 4HMAA 1ZXCA 1XFXA 3DPEA 4WKEA 4GR0A 1R1JA 1PWPA 1I1IP 1SU3A 2RJQA 3RTSA 3DWBA 3KMEA 3EDZA 3KHIA 2DW0A 1R1HA 2OVXA 5L79A 2JT6A 1IAAA 3TS4A
chains in the Genus database with same CATH topology
3LQBA 3TVCA 2E3XA 1SATA 1YCMA 4I03A 4G0DA 4H84A 3AYUA 966CA 830CA 4XM8A 3F1AA 4GQLA 3K7NA 2N8RA 4A7BA 3SHIA 3OHLA 5CXAA 5JMYA 1GO8P 3P24A 2QPJA 3ZVSA 4ON1A 4GWNA 1JH1A 1JIZA 2X7MA 4XM7A 1IAEA 1HFCA 3ZUKA 1PWVA 5H8XA 3G5CA 1RM8A 3MA2A 1GE5A 1BUDA 1JANA 4A3WA 4R3VA 3LE9A 1GXDA 3LQ0A 4PKSA 1UTTA 1PWWA 2MZIA 2Y6DA 3O64A 4L6TA 4QKZA 1BKCI 3BA0A 3LEAA 2SRTA 3EHYA 3LILA 3WV2A 3LJZA 1AKLA 5BPAA 5L7FA 4DPEA 1GE7A 5CZMA 4H2EA 1ZXVA 1UMTA 2V4BA 1EUBA 2JNPA 3AYKA 1PWQA 4JQGA 1XFYA 3GBOA 1Y8JA 1USNA 4FXQA 1KUKA 3E8RA 1UTZA 4IN9A 1JK3A 1BQQM 2DW2A 1KUHA 1MMPA 5BOYA 1OS9A 1G49A 1SLMA 3KEJA 5D1SA 1S4BP 2MLRA 3V96B 1MMRA 1HY7A 5D1TA 3I7IA 4AUOA 3K7LA 3DTKA 1G12A 3G42A 3TSKA 1O0TA 3DTIA 3KRYA 1B3DA 4PKTA 3DNGA 1CGEA 1KUIA 4DD8A 4L63A 4Q1LA 1BM6A 1FLSA 1XUCA 2OZRA 1EAKA 2DDFA 1Y93A 3KECA 1CGFA 4AXQA 2Y6CA 3U1RA 1WNIA 1L6JA 4H82A 2YB9A 3L0TA 4DF9A 2POJA 4PKVA 4HX3A 1JAOA 2OW0A 3HY9A 4GR3A 1I73A 3CKIA 4IUWA 456CA 1XFZA 4GWMA 2DW1A 1BSWA 1C3IA 2E2DA 4XBHA 1HV5A 3F17A 1G4KA 2OW9A 3KMCA 2XS4A 3LUMA 4H49A 2FV5A 1DTHA 3ELMA 3LGPA 2X3CA 1BQOA 1R55A 1MNCA 1BKCA 3F19A 2OI0A 4FXYP 3EDHA 4H30A 1IAGA 4JPAA 2MLSA 1YOUA 3KEKA 1Z3JA 1K7QA 1ND1A 3HB2P 1R1IA 4WZVA 2USNA 1D5JA 4WF6A 2J0TA 3EDIA 1GKCA 1BKCE 4ILWD 4I35A 2AYKA 1QJJA 4PKUA 1J7NA 4JP4A 1QIAA 1PWUA 5I2ZA 2OVZA 5B5OA 3DTEA 2MZEA 1KBCA 3DSLA 3LIRA 2D1NA 1AF0A 3KWVC 1ZTQA 5CUHA 4H1QA 3HDBA 2JIHA 5I43A 2W0DA 2K9CA 2J83A 2HU6A 3HBUP 3LK8A 1OMJA 1A86A 1C7KA 1C8TA 1I76A 1UMSA 1MMBA 2OXUA 2Z2DA 4PKWA 1B8YA 1BUVM 1ZP5A 3L0VA 1DMTA 1HTDA 2OW2A 4H76A 2KRJA 3N2UA 1JKYA 3TT4A 1D8FA 4G9LA 3UVCA 5LABA 5B5PA 1KUFA 1KUGA 1K7GA 2CLTA 1YP1A 1BIWA 2YIGA 1ZS0A 3B2ZA 1A85A 3EHXA 1CXVA 5I4OA 3ZXHA 2AIGP 1O0QA 1XFUA 1MMQA 2FV9A 3F18A 2W14A 1OM8A 4DV8A 1JAQA 2DDYA 1YQYA 1IACA 2W12A 4CTHA 1OM6A 1IADA 3LKAA 2WO9A 3B92A 1ATLA 3HYGA 4H3XA 2OY2A 1OM7A 2TCLA 2OXWA 4JA1A 3AIGA 2JSDA 2OW1A 5D7WA 3NX7A 3WV1A 4WKIA 2O36A 4IJOA 2I47A 3WV3A 2OY4A 1SMPA 2WO8A 3VI1A 5D2BA 3N2VA 2ERQA 1EB6A 5I12A 1JIWP 4AYKA 3F15A 4L7AA 1QUAA 1G9KA 2OXZA 1AYKA 4L19A 2L0RA 2YUFA 3LUNA 1SLNA 3LJGA 4JIJA 2RJPA 1K7IA 4AIGA 4GF1A 5I3MA 1CGLA 3VTGA 4GUYA 1IABA 1XURA 1CAQA 3OHOA 2K2GA 4FVLA 3F16A 3EDGA 5D1UA 2EROA 1CQRA 1ROSA 2WOAA 1XFVA 4PKRA 4GR8A 3O2XA 3HDAP 3P1VA 3HBVP 2X3AA 1XFWA 2W15A 3I7GA 1ZVXA 1GO7P 1JJ9A 5BOTA 3DPFA 1ASTA 1QICA 1CIZA 2O3EA 4WK7A 1D8MA 1GKDA 2A8HA 1OS2A 1FBLA 1JAPA 1KAPP 3Q2GA 1H71P 2D1OA 1UEAA 1Y0VA 3RTTA 3B8ZA 2JT5A 3USNA 3Q2HA 1R54A 4ZR5A 2MZHA 1OO9A 4XCTA 2X3BA 1CK7A 1HFSA 4XM6A 4EFSA 2PJTA 1D7XA 1GE6A 3EWJA 3HY7A 5D3CA 1RMZA 2XS3A 3DL1A 1FM1A 1G05A 2CKIA 1Q3AA 1QIBA 1XUDA 4J4MA 2ERPA 3LIKA 1SRPA 1QJIA 3LMCA 4PKQA 4FU4A 1HOVA 2W13A 5I0LA 3LJTA 1BZSA 4HMAA 1ZXCA 1XFXA 3DPEA 4WKEA 4GR0A 1R1JA 1PWPA 1I1IP 1SU3A 2RJQA 3RTSA 3DWBA 3KMEA 3EDZA 3KHIA 2DW0A 1R1HA 2OVXA 5L79A 2JT6A 1IAAA 3TS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQB A;  3TVC A;  2E3X A;  1SAT A;  1YCM A;  4I03 A;  4G0D A;  4H84 A;  3AYU A;  966C A;  830C A;  4XM8 A;  3F1A A;  4GQL A;  3K7N A;  2N8R A;  4A7B A;  3SHI A;  3OHL A;  5CXA A;  5JMY A;  1GO8 P;  3P24 A;  2QPJ A;  3ZVS A;  4ON1 A;  4GWN A;  1JH1 A;  1JIZ A;  2X7M A;  4XM7 A;  1IAE A;  1HFC A;  3ZUK A;  1PWV A;  5H8X A;  3G5C A;  1RM8 A;  3MA2 A;  1GE5 A;  1BUD A;  1JAN A;  4A3W A;  4R3V A;  3LE9 A;  1GXD A;  3LQ0 A;  4PKS A;  1UTT A;  1PWW A;  2MZI A;  2Y6D A;  3O64 A;  4L6T A;  4QKZ A;  1BKC I;  3BA0 A;  3LEA A;  2SRT A;  3EHY A;  3LIL A;  3WV2 A;  3LJZ A;  1AKL A;  5BPA A;  5L7F A;  4DPE A;  1GE7 A;  5CZM A;  4H2E A;  1ZXV A;  1UMT A;  2V4B A;  1EUB A;  2JNP A;  3AYK A;  1PWQ A;  4JQG A;  1XFY A;  3GBO A;  1Y8J A;  1USN A;  4FXQ A;  1KUK A;  3E8R A;  1UTZ A;  4IN9 A;  1JK3 A;  1BQQ M;  2DW2 A;  1KUH A;  1MMP A;  5BOY A;  1OS9 A;  1G49 A;  1SLM A;  3KEJ A;  5D1S A;  1S4B P;  2MLR A;  3V96 B;  1MMR A;  1HY7 A;  5D1T A;  3I7I A;  4AUO A;  3K7L A;  1G12 A;  3G42 A;  3TSK A;  1O0T A;  3KRY A;  1B3D A;  4PKT A;  3DNG A;  1CGE A;  1KUI A;  4DD8 A;  4L63 A;  4Q1L A;  1BM6 A;  1FLS A;  1XUC A;  2OZR A;  1EAK A;  2DDF A;  1Y93 A;  3KEC A;  1CGF A;  4AXQ A;  2Y6C A;  3U1R A;  1WNI A;  1L6J A;  4H82 A;  2YB9 A;  3L0T A;  4DF9 A;  2POJ A;  4PKV A;  4HX3 A;  1JAO A;  2OW0 A;  3HY9 A;  4GR3 A;  1I73 A;  3CKI A;  4IUW A;  456C A;  1XFZ A;  4GWM A;  2DW1 A;  1BSW A;  1C3I A;  2E2D A;  4XBH A;  1HV5 A;  3F17 A;  1G4K A;  2OW9 A;  3KMC A;  2XS4 A;  3LUM A;  4H49 A;  2FV5 A;  1DTH A;  3ELM A;  3LGP A;  2X3C A;  1BQO A;  1R55 A;  1MNC A;  1BKC A;  3F19 A;  2OI0 A;  4FXY P;  3EDH A;  4H30 A;  1IAG A;  4JPA A;  2MLS A;  1YOU A;  3KEK A;  1Z3J A;  1K7Q A;  1ND1 A;  3HB2 P;  1R1I A;  4WZV A;  2USN A;  1D5J A;  4WF6 A;  2J0T A;  3EDI A;  1GKC A;  1BKC E;  4ILW D;  4I35 A;  2AYK A;  1QJJ A;  4PKU A;  1J7N A;  4JP4 A;  1QIA A;  1PWU A;  5I2Z A;  2OVZ A;  5B5O A;  2MZE A;  1KBC A;  3DSL A;  3LIR A;  2D1N A;  1AF0 A;  3KWV C;  1ZTQ A;  5CUH A;  4H1Q A;  3HDB A;  2JIH A;  5I43 A;  2W0D A;  2K9C A;  2J83 A;  2HU6 A;  3HBU P;  3LK8 A;  1OMJ A;  1A86 A;  1C7K A;  1C8T A;  1I76 A;  1UMS A;  1MMB A;  2OXU A;  2Z2D A;  4PKW A;  1B8Y A;  1BUV M;  1ZP5 A;  3L0V A;  1DMT A;  1HTD A;  2OW2 A;  4H76 A;  2KRJ A;  3N2U A;  1JKY A;  3TT4 A;  1D8F A;  4G9L A;  3UVC A;  5LAB A;  5B5P A;  1KUF A;  1KUG A;  1K7G A;  2CLT A;  1YP1 A;  1BIW A;  2YIG A;  1ZS0 A;  3B2Z A;  1A85 A;  3EHX A;  1CXV A;  5I4O A;  3ZXH A;  2AIG P;  1O0Q A;  1XFU A;  1MMQ A;  2FV9 A;  3F18 A;  2W14 A;  1OM8 A;  4DV8 A;  1JAQ A;  2DDY A;  1YQY A;  1IAC A;  2W12 A;  4CTH A;  1OM6 A;  1IAD A;  3LKA A;  2WO9 A;  3B92 A;  1ATL A;  3HYG A;  4H3X A;  2OY2 A;  1OM7 A;  2TCL A;  2OXW A;  4JA1 A;  3AIG A;  2JSD A;  2OW1 A;  5D7W A;  3NX7 A;  3WV1 A;  4WKI A;  2O36 A;  4IJO A;  2I47 A;  3WV3 A;  2OY4 A;  1SMP A;  2WO8 A;  3VI1 A;  5D2B A;  3N2V A;  2ERQ A;  1EB6 A;  5I12 A;  1JIW P;  4AYK A;  3F15 A;  1QUA A;  1G9K A;  2OXZ A;  1AYK A;  4L19 A;  2L0R A;  3LUN A;  1SLN A;  3LJG A;  4JIJ A;  2RJP A;  1K7I A;  4AIG A;  4GF1 A;  5I3M A;  1CGL A;  3VTG A;  4GUY A;  1IAB A;  1XUR A;  1CAQ A;  3OHO A;  2K2G A;  4FVL A;  3F16 A;  3EDG A;  5D1U A;  2ERO A;  1CQR A;  1ROS A;  2WOA A;  1XFV A;  4PKR A;  4GR8 A;  3O2X A;  3HDA P;  3P1V A;  3HBV P;  2X3A A;  1XFW A;  2W15 A;  3I7G A;  1ZVX A;  1GO7 P;  1JJ9 A;  5BOT A;  3DPF A;  1AST A;  1QIC A;  1CIZ A;  2O3E A;  4WK7 A;  1D8M A;  1GKD A;  2A8H A;  1OS2 A;  1FBL A;  1JAP A;  1KAP P;  3Q2G A;  1H71 P;  2D1O A;  1UEA A;  1Y0V A;  3RTT A;  3B8Z A;  2JT5 A;  3USN A;  3Q2H A;  1R54 A;  4ZR5 A;  2MZH A;  1OO9 A;  4XCT A;  2X3B A;  1CK7 A;  1HFS A;  4XM6 A;  4EFS A;  2PJT A;  1D7X A;  1GE6 A;  3EWJ A;  3HY7 A;  5D3C A;  1RMZ A;  2XS3 A;  3DL1 A;  1FM1 A;  1G05 A;  2CKI A;  1Q3A A;  1QIB A;  1XUD A;  4J4M A;  2ERP A;  3LIK A;  1SRP A;  1QJI A;  3LMC A;  4PKQ A;  4FU4 A;  1HOV A;  2W13 A;  5I0L A;  3LJT A;  1BZS A;  4HMA A;  1ZXC A;  1XFX A;  3DPE A;  4WKE A;  4GR0 A;  1R1J A;  1PWP A;  1I1I P;  1SU3 A;  2RJQ A;  3RTS A;  3DWB A;  3KME A;  3EDZ A;  3KHI A;  2DW0 A;  1R1H A;  2OVX A;  5L79 A;  2JT6 A;  1IAA A;  3TS4 A; 
#chains in the Genus database with same CATH topology
 3LQB A;  3TVC A;  2E3X A;  1SAT A;  1YCM A;  4I03 A;  4G0D A;  4H84 A;  3AYU A;  966C A;  830C A;  4XM8 A;  3F1A A;  4GQL A;  3K7N A;  2N8R A;  4A7B A;  3SHI A;  3OHL A;  5CXA A;  5JMY A;  1GO8 P;  3P24 A;  2QPJ A;  3ZVS A;  4ON1 A;  4GWN A;  1JH1 A;  1JIZ A;  2X7M A;  4XM7 A;  1IAE A;  1HFC A;  3ZUK A;  1PWV A;  5H8X A;  3G5C A;  1RM8 A;  3MA2 A;  1GE5 A;  1BUD A;  1JAN A;  4A3W A;  4R3V A;  3LE9 A;  1GXD A;  3LQ0 A;  4PKS A;  1UTT A;  1PWW A;  2MZI A;  2Y6D A;  3O64 A;  4L6T A;  4QKZ A;  1BKC I;  3BA0 A;  3LEA A;  2SRT A;  3EHY A;  3LIL A;  3WV2 A;  3LJZ A;  1AKL A;  5BPA A;  5L7F A;  4DPE A;  1GE7 A;  5CZM A;  4H2E A;  1ZXV A;  1UMT A;  2V4B A;  1EUB A;  2JNP A;  3AYK A;  1PWQ A;  4JQG A;  1XFY A;  3GBO A;  1Y8J A;  1USN A;  4FXQ A;  1KUK A;  3E8R A;  1UTZ A;  4IN9 A;  1JK3 A;  1BQQ M;  2DW2 A;  1KUH A;  1XAX A;  1MMP A;  5BOY A;  1OS9 A;  1G49 A;  1SLM A;  3KEJ A;  5D1S A;  1S4B P;  2MLR A;  3V96 B;  1MMR A;  1HY7 A;  1OZ9 A;  5D1T A;  3I7I A;  4AUO A;  3K7L A;  3DTK A;  1G12 A;  3G42 A;  3TSK A;  1O0T A;  3DTI A;  3KRY A;  1B3D A;  4PKT A;  3DNG A;  1CGE A;  1KUI A;  4DD8 A;  4L63 A;  4Q1L A;  1BM6 A;  1FLS A;  1XUC A;  2OZR A;  1EAK A;  2DDF A;  1Y93 A;  3KEC A;  1CGF A;  4AXQ A;  2Y6C A;  3U1R A;  1WNI A;  1L6J A;  4H82 A;  2YB9 A;  3L0T A;  4DF9 A;  2POJ A;  4PKV A;  4HX3 A;  1JAO A;  2OW0 A;  3HY9 A;  4GR3 A;  1I73 A;  3CKI A;  4IUW A;  456C A;  1XFZ A;  4GWM A;  2DW1 A;  1BSW A;  1C3I A;  2E2D A;  4XBH A;  1HV5 A;  3F17 A;  1G4K A;  2OW9 A;  3KMC A;  2XS4 A;  3LUM A;  4H49 A;  2FV5 A;  1DTH A;  3ELM A;  3LGP A;  2X3C A;  1BQO A;  1R55 A;  1MNC A;  1BKC A;  3F19 A;  2OI0 A;  4FXY P;  3EDH A;  4H30 A;  1IAG A;  4JPA A;  2MLS A;  1YOU A;  3KEK A;  1Z3J A;  1K7Q A;  1ND1 A;  3HB2 P;  1R1I A;  4WZV A;  2USN A;  1D5J A;  4WF6 A;  2J0T A;  3EDI A;  1GKC A;  1BKC E;  4ILW D;  4I35 A;  2AYK A;  1QJJ A;  4PKU A;  1J7N A;  4JP4 A;  1QIA A;  1PWU A;  5I2Z A;  2OVZ A;  5B5O A;  3DTE A;  2MZE A;  1KBC A;  3DSL A;  3LIR A;  2D1N A;  1AF0 A;  3KWV C;  1ZTQ A;  5CUH A;  4H1Q A;  3HDB A;  2JIH A;  5I43 A;  2W0D A;  2K9C A;  2J83 A;  2HU6 A;  3HBU P;  3LK8 A;  1OMJ A;  1A86 A;  1C7K A;  1C8T A;  1I76 A;  1UMS A;  1MMB A;  2OXU A;  2Z2D A;  4PKW A;  1B8Y A;  1BUV M;  1ZP5 A;  3L0V A;  1DMT A;  1HTD A;  2OW2 A;  4H76 A;  2KRJ A;  3N2U A;  1JKY A;  3TT4 A;  1D8F A;  4G9L A;  3UVC A;  5LAB A;  5B5P A;  1KUF A;  1KUG A;  1K7G A;  2CLT A;  1YP1 A;  1BIW A;  2YIG A;  1ZS0 A;  3B2Z A;  1A85 A;  1XM5 A;  3EHX A;  1CXV A;  5I4O A;  3ZXH A;  2AIG P;  1O0Q A;  1XFU A;  1MMQ A;  2FV9 A;  3F18 A;  2W14 A;  1OM8 A;  4DV8 A;  1JAQ A;  2DDY A;  1YQY A;  1IAC A;  2W12 A;  4CTH A;  1OM6 A;  1IAD A;  3LKA A;  2WO9 A;  3B92 A;  1ATL A;  3HYG A;  4H3X A;  2OY2 A;  1OM7 A;  2TCL A;  2OXW A;  4JA1 A;  3AIG A;  2JSD A;  2OW1 A;  5D7W A;  3NX7 A;  3WV1 A;  4WKI A;  2O36 A;  4IJO A;  2I47 A;  3WV3 A;  2OY4 A;  1SMP A;  2WO8 A;  3VI1 A;  5D2B A;  3N2V A;  2ERQ A;  1EB6 A;  5I12 A;  1JIW P;  4AYK A;  3F15 A;  4L7A A;  1QUA A;  1G9K A;  2OXZ A;  1AYK A;  4L19 A;  2L0R A;  2YUF A;  3LUN A;  1SLN A;  3LJG A;  4JIJ A;  2RJP A;  1K7I A;  4AIG A;  4GF1 A;  5I3M A;  1CGL A;  3VTG A;  4GUY A;  1IAB A;  1XUR A;  1CAQ A;  3OHO A;  2K2G A;  4FVL A;  3F16 A;  1TVI A;  3EDG A;  5D1U A;  2ERO A;  1CQR A;  1ROS A;  2WOA A;  1XFV A;  4PKR A;  4GR8 A;  3O2X A;  3HDA P;  3P1V A;  3HBV P;  2X3A A;  1XFW A;  2W15 A;  3I7G A;  1ZVX A;  1GO7 P;  1JJ9 A;  5BOT A;  3DPF A;  1AST A;  1QIC A;  1CIZ A;  2O3E A;  4WK7 A;  1D8M A;  1GKD A;  2A8H A;  1OS2 A;  1FBL A;  1JAP A;  1KAP P;  3Q2G A;  1H71 P;  2D1O A;  1UEA A;  1Y0V A;  3RTT A;  3B8Z A;  2JT5 A;  3USN A;  3Q2H A;  1R54 A;  4ZR5 A;  2MZH A;  1OO9 A;  4XCT A;  2X3B A;  1CK7 A;  1HFS A;  4XM6 A;  4EFS A;  2PJT A;  1D7X A;  1GE6 A;  3EWJ A;  3HY7 A;  5D3C A;  1RMZ A;  2XS3 A;  3DL1 A;  1FM1 A;  1G05 A;  2CKI A;  1Q3A A;  1QIB A;  1XUD A;  4J4M A;  2ERP A;  3LIK A;  1SRP A;  1QJI A;  3LMC A;  4PKQ A;  4FU4 A;  1HOV A;  2W13 A;  5I0L A;  3LJT A;  1BZS A;  4HMA A;  1ZXC A;  1XFX A;  3DPE A;  4WKE A;  4GR0 A;  1R1J A;  1PWP A;  1I1I P;  1SU3 A;  2RJQ A;  3RTS A;  3DWB A;  3KME A;  3EDZ A;  3KHI A;  2DW0 A;  1R1H A;  2OVX A;  5L79 A;  2JT6 A;  1IAA A;  3TS4 A; 
#chains in the Genus database with same CATH homology
 3LQB A;  3TVC A;  2E3X A;  1SAT A;  1YCM A;  4I03 A;  4G0D A;  4H84 A;  3AYU A;  966C A;  830C A;  4XM8 A;  3F1A A;  4GQL A;  3K7N A;  2N8R A;  4A7B A;  3SHI A;  3OHL A;  5CXA A;  5JMY A;  1GO8 P;  3P24 A;  2QPJ A;  3ZVS A;  4ON1 A;  4GWN A;  1JH1 A;  1JIZ A;  2X7M A;  4XM7 A;  1IAE A;  1HFC A;  3ZUK A;  1PWV A;  5H8X A;  3G5C A;  1RM8 A;  3MA2 A;  1GE5 A;  1BUD A;  1JAN A;  4A3W A;  4R3V A;  3LE9 A;  1GXD A;  3LQ0 A;  4PKS A;  1UTT A;  1PWW A;  2MZI A;  2Y6D A;  3O64 A;  4L6T A;  4QKZ A;  1BKC I;  3BA0 A;  3LEA A;  2SRT A;  3EHY A;  3LIL A;  3WV2 A;  3LJZ A;  1AKL A;  5BPA A;  5L7F A;  4DPE A;  1GE7 A;  5CZM A;  4H2E A;  1ZXV A;  1UMT A;  2V4B A;  1EUB A;  2JNP A;  3AYK A;  1PWQ A;  4JQG A;  1XFY A;  3GBO A;  1Y8J A;  1USN A;  4FXQ A;  1KUK A;  3E8R A;  1UTZ A;  4IN9 A;  1JK3 A;  1BQQ M;  2DW2 A;  1KUH A;  1MMP A;  5BOY A;  1OS9 A;  1G49 A;  1SLM A;  3KEJ A;  5D1S A;  1S4B P;  2MLR A;  3V96 B;  1MMR A;  1HY7 A;  5D1T A;  3I7I A;  4AUO A;  3K7L A;  3DTK A;  1G12 A;  3G42 A;  3TSK A;  1O0T A;  3DTI A;  3KRY A;  1B3D A;  4PKT A;  3DNG A;  1CGE A;  1KUI A;  4DD8 A;  4L63 A;  4Q1L A;  1BM6 A;  1FLS A;  1XUC A;  2OZR A;  1EAK A;  2DDF A;  1Y93 A;  3KEC A;  1CGF A;  4AXQ A;  2Y6C A;  3U1R A;  1WNI A;  1L6J A;  4H82 A;  2YB9 A;  3L0T A;  4DF9 A;  2POJ A;  4PKV A;  4HX3 A;  1JAO A;  2OW0 A;  3HY9 A;  4GR3 A;  1I73 A;  3CKI A;  4IUW A;  456C A;  1XFZ A;  4GWM A;  2DW1 A;  1BSW A;  1C3I A;  2E2D A;  4XBH A;  1HV5 A;  3F17 A;  1G4K A;  2OW9 A;  3KMC A;  2XS4 A;  3LUM A;  4H49 A;  2FV5 A;  1DTH A;  3ELM A;  3LGP A;  2X3C A;  1BQO A;  1R55 A;  1MNC A;  1BKC A;  3F19 A;  2OI0 A;  4FXY P;  3EDH A;  4H30 A;  1IAG A;  4JPA A;  2MLS A;  1YOU A;  3KEK A;  1Z3J A;  1K7Q A;  1ND1 A;  3HB2 P;  1R1I A;  4WZV A;  2USN A;  1D5J A;  4WF6 A;  2J0T A;  3EDI A;  1GKC A;  1BKC E;  4ILW D;  4I35 A;  2AYK A;  1QJJ A;  4PKU A;  1J7N A;  4JP4 A;  1QIA A;  1PWU A;  5I2Z A;  2OVZ A;  5B5O A;  3DTE A;  2MZE A;  1KBC A;  3DSL A;  3LIR A;  2D1N A;  1AF0 A;  3KWV C;  1ZTQ A;  5CUH A;  4H1Q A;  3HDB A;  2JIH A;  5I43 A;  2W0D A;  2K9C A;  2J83 A;  2HU6 A;  3HBU P;  3LK8 A;  1OMJ A;  1A86 A;  1C7K A;  1C8T A;  1I76 A;  1UMS A;  1MMB A;  2OXU A;  2Z2D A;  4PKW A;  1B8Y A;  1BUV M;  1ZP5 A;  3L0V A;  1DMT A;  1HTD A;  2OW2 A;  4H76 A;  2KRJ A;  3N2U A;  1JKY A;  3TT4 A;  1D8F A;  4G9L A;  3UVC A;  5LAB A;  5B5P A;  1KUF A;  1KUG A;  1K7G A;  2CLT A;  1YP1 A;  1BIW A;  2YIG A;  1ZS0 A;  3B2Z A;  1A85 A;  3EHX A;  1CXV A;  5I4O A;  3ZXH A;  2AIG P;  1O0Q A;  1XFU A;  1MMQ A;  2FV9 A;  3F18 A;  2W14 A;  1OM8 A;  4DV8 A;  1JAQ A;  2DDY A;  1YQY A;  1IAC A;  2W12 A;  4CTH A;  1OM6 A;  1IAD A;  3LKA A;  2WO9 A;  3B92 A;  1ATL A;  3HYG A;  4H3X A;  2OY2 A;  1OM7 A;  2TCL A;  2OXW A;  4JA1 A;  3AIG A;  2JSD A;  2OW1 A;  5D7W A;  3NX7 A;  3WV1 A;  4WKI A;  2O36 A;  4IJO A;  2I47 A;  3WV3 A;  2OY4 A;  1SMP A;  2WO8 A;  3VI1 A;  5D2B A;  3N2V A;  2ERQ A;  1EB6 A;  5I12 A;  1JIW P;  4AYK A;  3F15 A;  4L7A A;  1QUA A;  1G9K A;  2OXZ A;  1AYK A;  4L19 A;  2L0R A;  2YUF A;  3LUN A;  1SLN A;  3LJG A;  4JIJ A;  2RJP A;  1K7I A;  4AIG A;  4GF1 A;  5I3M A;  1CGL A;  3VTG A;  4GUY A;  1IAB A;  1XUR A;  1CAQ A;  3OHO A;  2K2G A;  4FVL A;  3F16 A;  3EDG A;  5D1U A;  2ERO A;  1CQR A;  1ROS A;  2WOA A;  1XFV A;  4PKR A;  4GR8 A;  3O2X A;  3HDA P;  3P1V A;  3HBV P;  2X3A A;  1XFW A;  2W15 A;  3I7G A;  1ZVX A;  1GO7 P;  1JJ9 A;  5BOT A;  3DPF A;  1AST A;  1QIC A;  1CIZ A;  2O3E A;  4WK7 A;  1D8M A;  1GKD A;  2A8H A;  1OS2 A;  1FBL A;  1JAP A;  1KAP P;  3Q2G A;  1H71 P;  2D1O A;  1UEA A;  1Y0V A;  3RTT A;  3B8Z A;  2JT5 A;  3USN A;  3Q2H A;  1R54 A;  4ZR5 A;  2MZH A;  1OO9 A;  4XCT A;  2X3B A;  1CK7 A;  1HFS A;  4XM6 A;  4EFS A;  2PJT A;  1D7X A;  1GE6 A;  3EWJ A;  3HY7 A;  5D3C A;  1RMZ A;  2XS3 A;  3DL1 A;  1FM1 A;  1G05 A;  2CKI A;  1Q3A A;  1QIB A;  1XUD A;  4J4M A;  2ERP A;  3LIK A;  1SRP A;  1QJI A;  3LMC A;  4PKQ A;  4FU4 A;  1HOV A;  2W13 A;  5I0L A;  3LJT A;  1BZS A;  4HMA A;  1ZXC A;  1XFX A;  3DPE A;  4WKE A;  4GR0 A;  1R1J A;  1PWP A;  1I1I P;  1SU3 A;  2RJQ A;  3RTS A;  3DWB A;  3KME A;  3EDZ A;  3KHI A;  2DW0 A;  1R1H A;  2OVX A;  5L79 A;  2JT6 A;  1IAA A;  3TS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...