4WK7A

Crystal structure of human adamts-4 in complex with inhibitor (compound 1, 2-(4-chlorophenoxy)-n-{[(4r)-4-methyl-2,5-dioxoimidazolidin-4-yl]methyl} acetamide)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
209
Chain Sequence
SRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHELGHVFNMLHDNSKPCISLNGPLSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords A disintegrin and metalloproteinase with thrombospondin moti
publication title Identification of potent and selective hydantoin inhibitors of aggrecanase-1 and aggrecanase-2 that are efficacious in both chemical and surgical models of osteoarthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 209
sequence length 216
ec nomenclature ec 3.4.24.82: ADAMTS-4 endopeptidase.
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4wk7A00
3F16A 4PKRA 1CQRA 3WV3A 4DD8A 1QJJA 2DW0A 5D2BA 3G5CA 4IN9A 4L6TA 2MZEA 1K7GA 3EDZA 1UMTA 1BQOA 1A85A 4GR8A 1EAKA 1OM8A 3I7GA 4H30A 2OY4A 3P1VA 3MA2A 1GO7P 1ZP5A 4WKIA 1BUDA 5B5PA 3EDHA 3HY9A 5I3MA 3LJTA 1G12A 3L0TA 4IUWA 5D7WA 1JJ9A 5LABA 3OHLA 3LIRA 4PKQA 2W13A 4FU4A 3LUNA 1QIAA 3F17A 5CUHA 1FBLA 1IAEA 4PKUA 2OXWA 1HOVA 2WOAA 2D1NA 1D5JA 2E2DA 4XBHA 2KRJA 1JH1A 2OXZA 1SLNA 3UVCA 1XFYA 3HDAP 4XCTA 4AYKA 1HFSA 3O2XA 2X3CA 1JK3A 4CTHA 3V96B 4WKEA 1EUBA 2OW2A 1IACA 4R3VA 1Q3AA 1G49A 2CKIA 2DW1A 4JIJA 1ZXCA 2OVXA 3ELMA 3ZXHA 1Y93A 1AYKA 4GR3A 1SMPA 4EFSA 4WF6A 3K7NA 1JAPA 1UTTA 3USNA 1Y0VA 4HX3A 1C3IA 1XFXA 1KUKA 1MNCA 1GE5A 3LJZA 1BZSA 3BA0A 1D8FA 1IABA 4A3WA 4PKWA 3TSKA 1ZTQA 3RTSA 1KAPP 1XFZA 1PWVA 2J83A 1USNA 1IADA 4AXQA 5I2ZA 4G0DA 2WO8A 2OI0A 5L7FA 4JP4A 2MLSA 2X7MA 4GR0A 2J0TA 1BKCE 2OW1A 1I76A 3DPEA 5BPAA 1KUIA 2OVZA 4GF1A 3EHXA 3KMCA 1XUCA 3LK8A 1OM6A 2MLRA 3DL1A 3L0VA 456CA 1C8TA 1JAOA 1O0QA 3Q2GA 2Z2DA 3LUMA 5BOTA 5BOYA 2W12A 1QJIA 3P24A 3TT4A 3LIKA 4PKSA 2O36A 3KMEA 4DPEA 3HB2P 1MMQA 2WO9A 3B8ZA 3LQ0A 3LEAA 1GE6A 5I4OA 3HYGA 1HY7A 1OS9A 3KWVC 1XUDA 4PKVA 2X3BA 2MZIA 5D1TA 3LJGA 4JPAA 3SHIA 1AKLA 4IJOA 1JIWP 3VI1A 4FXQA 1ATLA 1JANA 1CXVA 3AYUA 3N2UA 2DDYA 1G05A 2K9CA 2OW0A 5H8XA 2O3EA 5I0LA 2A8HA 1RM8A 4JQGA 5CZMA 1JAQA 1A86A 1CGFA 4DF9A 1I1IP 4GWNA 3HBUP 1CGLA 5D3CA 3AYKA 1BIWA 1YP1A 4WK7A 2E3XA 3GBOA 1QUAA 2L0RA 2RJQA 4WZVA 4GWMA 3B2ZA 2OZRA 3DSLA 3Q2HA 1IAGA 1QIBA 1AF0A 1XFUA 1WNIA 1HFCA 966CA 2TCLA 2OW9A 1B8YA 2JIHA 4G9LA 1YOUA 2OXUA 1ZS0A 1K7QA 4DV8A 2X3AA 3AIGA 4H82A 4A7BA 5I12A 4L63A 2PJTA 4GQLA 1DTHA 3N2VA 1JKYA 4H2EA 1XFVA 2QPJA 1ZVXA 2W0DA 3CKIA 1KUFA 3TS4A 3F15A 3LGPA 1CGEA 1SLMA 1K7IA 1PWUA 2CLTA 3OHOA 1PWWA 5D1SA 1S4BP 1SU3A 1PWQA 1IAAA 4AIGA 1SRPA 3EWJA 3KEJA 1GO8P 1OMJA 1GKCA 1ROSA 2YB9A 2FV9A 2MZHA 1JIZA 1G9KA 3K7LA 2XS3A 3F18A 2ERQA 3E8RA 1KUGA 1BM6A 3F1AA 1L6JA 2AIGP 1Y8JA 3EHYA 1UEAA 4XM8A 4L19A 1O0TA 1R54A 3RTTA 1CK7A 4ON1A 3U1RA 3ZVSA 1BKCI 2JNPA 3EDGA 1ZXVA 1GE7A 1PWPA 4GUYA 1D8MA 3LMCA 1UMSA 1FLSA 1UTZA 2DDFA 3O64A 4H1QA 4FXYP 1G4KA 3B92A 1OM7A 3F19A 4FVLA 2RJPA 3DPFA 4PKTA 5I43A 1Z3JA 2D1OA 1BSWA 3WV1A 1DMTA 1MMPA 1OS2A 1H71P 4AUOA 1CIZA 5B5OA 1SATA 2AYKA 1YCMA 1KUHA 1ASTA 3LE9A 1R1JA 3DNGA 2YIGA 1RMZA 3I7IA 3HDBA 3KRYA 2EROA 4XM6A 2W15A 1BUVM 4H84A 3KHIA 1GKDA 1YQYA 3EDIA 2JT5A 2I47A 1B3DA 1C7KA 1R55A 1OO9A 830CA 1J7NA 1GXDA 4H76A 4HMAA 1CAQA 4I35A 1XFWA 1MMRA 4ZR5A 2OY2A 3HY7A 2Y6CA 1BQQM 1QICA 2SRTA 3NX7A 2FV5A 3VTGA 2N8RA 1ND1A 1MMBA 5JMYA 4Q1LA 1I73A 5L79A 4H49A 1R1HA 2Y6DA 3ZUKA 4XM7A 1KBCA 2ERPA 4JA1A 1XURA 3HBVP 4ILWD 3DWBA 1HTDA 4J4MA 3WV2A 2W14A 2V4BA 2XS4A 1BKCA 3LKAA 2POJA 4H3XA 3LILA 5CXAA 2K2GA 1EB6A 3G42A 2JT6A 2DW2A 3KECA 1R1IA 3KEKA 5D1UA 2HU6A 2USNA 3LQBA 1HV5A 2JSDA 4QKZA 4I03A 3TVCA 1FM1A 1D7XA
chains in the Genus database with same CATH superfamily
3F16A 4PKRA 1CQRA 3WV3A 4DD8A 1QJJA 2DW0A 5D2BA 3G5CA 4IN9A 4L6TA 2MZEA 1K7GA 3EDZA 1UMTA 1BQOA 1A85A 4GR8A 1EAKA 1OM8A 3I7GA 4H30A 2OY4A 3P1VA 3MA2A 1GO7P 1ZP5A 4WKIA 1BUDA 5B5PA 3EDHA 3HY9A 5I3MA 3LJTA 1G12A 3L0TA 4IUWA 5D7WA 1JJ9A 5LABA 3OHLA 3LIRA 4PKQA 2W13A 4FU4A 3LUNA 1QIAA 3F17A 5CUHA 1FBLA 1IAEA 4PKUA 2OXWA 1HOVA 2WOAA 2D1NA 1D5JA 2E2DA 4XBHA 2KRJA 1JH1A 2OXZA 1SLNA 3UVCA 1XFYA 3HDAP 4XCTA 4AYKA 1HFSA 3O2XA 2X3CA 1JK3A 4CTHA 3V96B 4WKEA 1EUBA 2OW2A 1IACA 4R3VA 1Q3AA 1G49A 2CKIA 2DW1A 4JIJA 1ZXCA 2OVXA 3ELMA 3ZXHA 1Y93A 1AYKA 4GR3A 1SMPA 4EFSA 4WF6A 3K7NA 1JAPA 1UTTA 3USNA 1Y0VA 4HX3A 1C3IA 1XFXA 1KUKA 1MNCA 1GE5A 3LJZA 1BZSA 3BA0A 1D8FA 1IABA 4A3WA 4PKWA 3TSKA 1ZTQA 3RTSA 1KAPP 1XFZA 1PWVA 2J83A 1USNA 1IADA 4AXQA 5I2ZA 4G0DA 2WO8A 2OI0A 5L7FA 4JP4A 3DTKA 2MLSA 2X7MA 4GR0A 2J0TA 1BKCE 2OW1A 1I76A 4L7AA 3DPEA 5BPAA 1KUIA 1XM5A 2OVZA 4GF1A 3EHXA 3KMCA 1XUCA 3LK8A 1OM6A 2MLRA 3DL1A 3L0VA 456CA 1C8TA 1JAOA 1O0QA 3Q2GA 2Z2DA 3LUMA 5BOTA 5BOYA 2W12A 1QJIA 3P24A 3TT4A 3LIKA 4PKSA 2O36A 3KMEA 4DPEA 3HB2P 1MMQA 2WO9A 3B8ZA 3LQ0A 3LEAA 1GE6A 5I4OA 3HYGA 1HY7A 1OS9A 3KWVC 1XUDA 4PKVA 2X3BA 2MZIA 5D1TA 3LJGA 4JPAA 3SHIA 1AKLA 4IJOA 1JIWP 3VI1A 4FXQA 1ATLA 1JANA 1CXVA 3AYUA 3N2UA 2DDYA 1G05A 2K9CA 2OW0A 5H8XA 2O3EA 5I0LA 2A8HA 1RM8A 4JQGA 5CZMA 1JAQA 1A86A 1CGFA 3DTIA 4DF9A 1I1IP 4GWNA 3HBUP 1CGLA 5D3CA 3AYKA 1BIWA 1YP1A 4WK7A 2E3XA 3GBOA 1QUAA 2L0RA 2RJQA 4WZVA 4GWMA 3B2ZA 2OZRA 3DSLA 3Q2HA 1IAGA 1QIBA 1AF0A 1XFUA 1WNIA 1HFCA 966CA 2TCLA 2OW9A 1B8YA 2JIHA 4G9LA 1YOUA 2OXUA 1ZS0A 1K7QA 4DV8A 2X3AA 3AIGA 4H82A 4A7BA 5I12A 4L63A 2PJTA 4GQLA 1DTHA 3N2VA 1JKYA 4H2EA 1XFVA 2QPJA 3DTEA 1ZVXA 2W0DA 3CKIA 1KUFA 3TS4A 3F15A 1TVIA 3LGPA 1CGEA 1SLMA 1K7IA 1PWUA 2CLTA 3OHOA 1PWWA 5D1SA 1S4BP 1SU3A 1PWQA 1IAAA 4AIGA 1SRPA 3EWJA 3KEJA 1GO8P 1OMJA 1GKCA 1ROSA 2YB9A 2FV9A 2MZHA 1JIZA 1G9KA 3K7LA 1OZ9A 2XS3A 3F18A 2ERQA 3E8RA 1KUGA 1BM6A 3F1AA 1L6JA 2AIGP 1Y8JA 3EHYA 1UEAA 4XM8A 4L19A 1O0TA 1R54A 3RTTA 1CK7A 4ON1A 3U1RA 3ZVSA 1BKCI 2JNPA 3EDGA 1ZXVA 1GE7A 1PWPA 4GUYA 1D8MA 3LMCA 1XAXA 1UMSA 1FLSA 1UTZA 2DDFA 3O64A 4H1QA 4FXYP 1G4KA 3B92A 1OM7A 3F19A 4FVLA 2RJPA 3DPFA 4PKTA 5I43A 1Z3JA 2D1OA 1BSWA 3WV1A 1DMTA 1MMPA 1OS2A 1H71P 4AUOA 1CIZA 5B5OA 1SATA 2AYKA 1YCMA 1KUHA 1ASTA 3LE9A 1R1JA 3DNGA 2YIGA 1RMZA 3I7IA 3HDBA 3KRYA 2EROA 4XM6A 2W15A 1BUVM 4H84A 3KHIA 1GKDA 1YQYA 3EDIA 2JT5A 2I47A 1B3DA 1C7KA 1R55A 1OO9A 830CA 1J7NA 1GXDA 4H76A 4HMAA 1CAQA 4I35A 1XFWA 1MMRA 4ZR5A 2OY2A 3HY7A 2Y6CA 1BQQM 1QICA 2SRTA 3NX7A 2FV5A 3VTGA 2N8RA 1ND1A 1MMBA 5JMYA 4Q1LA 1I73A 5L79A 4H49A 1R1HA 2Y6DA 3ZUKA 4XM7A 1KBCA 2ERPA 4JA1A 1XURA 3HBVP 4ILWD 3DWBA 1HTDA 4J4MA 3WV2A 2W14A 2V4BA 2XS4A 1BKCA 3LKAA 2POJA 4H3XA 3LILA 5CXAA 2K2GA 1EB6A 3G42A 2JT6A 2DW2A 3KECA 1R1IA 3KEKA 5D1UA 2YUFA 2HU6A 2USNA 3LQBA 1HV5A 2JSDA 4QKZA 4I03A 3TVCA 1FM1A 1D7XA
chains in the Genus database with same CATH topology
3F16A 4PKRA 1CQRA 3WV3A 4DD8A 1QJJA 2DW0A 5D2BA 3G5CA 4IN9A 4L6TA 2MZEA 1K7GA 3EDZA 1UMTA 1BQOA 1A85A 4GR8A 1EAKA 1OM8A 3I7GA 4H30A 2OY4A 3P1VA 3MA2A 1GO7P 1ZP5A 4WKIA 1BUDA 5B5PA 3EDHA 3HY9A 5I3MA 3LJTA 1G12A 3L0TA 4IUWA 5D7WA 1JJ9A 5LABA 3OHLA 3LIRA 4PKQA 2W13A 4FU4A 3LUNA 1QIAA 3F17A 5CUHA 1FBLA 1IAEA 4PKUA 2OXWA 1HOVA 2WOAA 2D1NA 1D5JA 2E2DA 4XBHA 2KRJA 1JH1A 2OXZA 1SLNA 3UVCA 1XFYA 3HDAP 4XCTA 4AYKA 1HFSA 3O2XA 2X3CA 1JK3A 4CTHA 3V96B 4WKEA 1EUBA 2OW2A 1IACA 4R3VA 1Q3AA 1G49A 2CKIA 2DW1A 4JIJA 1ZXCA 2OVXA 3ELMA 3ZXHA 1Y93A 1AYKA 4GR3A 1SMPA 4EFSA 4WF6A 3K7NA 1JAPA 1UTTA 3USNA 1Y0VA 4HX3A 1C3IA 1XFXA 1KUKA 1MNCA 1GE5A 3LJZA 1BZSA 3BA0A 1D8FA 1IABA 4A3WA 4PKWA 3TSKA 1ZTQA 3RTSA 1KAPP 1XFZA 1PWVA 2J83A 1USNA 1IADA 4AXQA 5I2ZA 4G0DA 2WO8A 2OI0A 5L7FA 4JP4A 3DTKA 2MLSA 2X7MA 4GR0A 2J0TA 1BKCE 2OW1A 1I76A 4L7AA 3DPEA 5BPAA 1KUIA 2OVZA 4GF1A 3EHXA 3KMCA 1XUCA 3LK8A 1OM6A 2MLRA 3DL1A 3L0VA 456CA 1C8TA 1JAOA 1O0QA 3Q2GA 2Z2DA 3LUMA 5BOTA 5BOYA 2W12A 1QJIA 3P24A 3TT4A 3LIKA 4PKSA 2O36A 3KMEA 4DPEA 3HB2P 1MMQA 2WO9A 3B8ZA 3LQ0A 3LEAA 1GE6A 5I4OA 3HYGA 1HY7A 1OS9A 3KWVC 1XUDA 4PKVA 2X3BA 2MZIA 5D1TA 3LJGA 4JPAA 3SHIA 1AKLA 4IJOA 1JIWP 3VI1A 4FXQA 1ATLA 1JANA 1CXVA 3AYUA 3N2UA 2DDYA 1G05A 2K9CA 2OW0A 5H8XA 2O3EA 5I0LA 2A8HA 1RM8A 4JQGA 5CZMA 1JAQA 1A86A 1CGFA 3DTIA 4DF9A 1I1IP 4GWNA 3HBUP 1CGLA 5D3CA 3AYKA 1BIWA 1YP1A 4WK7A 2E3XA 3GBOA 1QUAA 2L0RA 2RJQA 4WZVA 4GWMA 3B2ZA 2OZRA 3DSLA 3Q2HA 1IAGA 1QIBA 1AF0A 1XFUA 1WNIA 1HFCA 966CA 2TCLA 2OW9A 1B8YA 2JIHA 4G9LA 1YOUA 2OXUA 1ZS0A 1K7QA 4DV8A 2X3AA 3AIGA 4H82A 4A7BA 5I12A 4L63A 2PJTA 4GQLA 1DTHA 3N2VA 1JKYA 4H2EA 1XFVA 2QPJA 3DTEA 1ZVXA 2W0DA 3CKIA 1KUFA 3TS4A 3F15A 3LGPA 1CGEA 1SLMA 1K7IA 1PWUA 2CLTA 3OHOA 1PWWA 5D1SA 1S4BP 1SU3A 1PWQA 1IAAA 4AIGA 1SRPA 3EWJA 3KEJA 1GO8P 1OMJA 1GKCA 1ROSA 2YB9A 2FV9A 2MZHA 1JIZA 1G9KA 3K7LA 2XS3A 3F18A 2ERQA 3E8RA 1KUGA 1BM6A 3F1AA 1L6JA 2AIGP 1Y8JA 3EHYA 1UEAA 4XM8A 4L19A 1O0TA 1R54A 3RTTA 1CK7A 4ON1A 3U1RA 3ZVSA 1BKCI 2JNPA 3EDGA 1ZXVA 1GE7A 1PWPA 4GUYA 1D8MA 3LMCA 1UMSA 1FLSA 1UTZA 2DDFA 3O64A 4H1QA 4FXYP 1G4KA 3B92A 1OM7A 3F19A 4FVLA 2RJPA 3DPFA 4PKTA 5I43A 1Z3JA 2D1OA 1BSWA 3WV1A 1DMTA 1MMPA 1OS2A 1H71P 4AUOA 1CIZA 5B5OA 1SATA 2AYKA 1YCMA 1KUHA 1ASTA 3LE9A 1R1JA 3DNGA 2YIGA 1RMZA 3I7IA 3HDBA 3KRYA 2EROA 4XM6A 2W15A 1BUVM 4H84A 3KHIA 1GKDA 1YQYA 3EDIA 2JT5A 2I47A 1B3DA 1C7KA 1R55A 1OO9A 830CA 1J7NA 1GXDA 4H76A 4HMAA 1CAQA 4I35A 1XFWA 1MMRA 4ZR5A 2OY2A 3HY7A 2Y6CA 1BQQM 1QICA 2SRTA 3NX7A 2FV5A 3VTGA 2N8RA 1ND1A 1MMBA 5JMYA 4Q1LA 1I73A 5L79A 4H49A 1R1HA 2Y6DA 3ZUKA 4XM7A 1KBCA 2ERPA 4JA1A 1XURA 3HBVP 4ILWD 3DWBA 1HTDA 4J4MA 3WV2A 2W14A 2V4BA 2XS4A 1BKCA 3LKAA 2POJA 4H3XA 3LILA 5CXAA 2K2GA 1EB6A 3G42A 2JT6A 2DW2A 3KECA 1R1IA 3KEKA 5D1UA 2YUFA 2HU6A 2USNA 3LQBA 1HV5A 2JSDA 4QKZA 4I03A 3TVCA 1FM1A 1D7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F16 A;  4PKR A;  1CQR A;  3WV3 A;  4DD8 A;  1QJJ A;  2DW0 A;  5D2B A;  3G5C A;  4IN9 A;  4L6T A;  2MZE A;  1K7G A;  3EDZ A;  1UMT A;  1BQO A;  1A85 A;  4GR8 A;  1EAK A;  1OM8 A;  3I7G A;  4H30 A;  2OY4 A;  3P1V A;  3MA2 A;  1GO7 P;  1ZP5 A;  4WKI A;  1BUD A;  5B5P A;  3EDH A;  3HY9 A;  5I3M A;  3LJT A;  1G12 A;  3L0T A;  4IUW A;  5D7W A;  1JJ9 A;  5LAB A;  3OHL A;  3LIR A;  4PKQ A;  2W13 A;  4FU4 A;  3LUN A;  1QIA A;  3F17 A;  5CUH A;  1FBL A;  1IAE A;  4PKU A;  2OXW A;  1HOV A;  2WOA A;  2D1N A;  1D5J A;  2E2D A;  4XBH A;  2KRJ A;  1JH1 A;  2OXZ A;  1SLN A;  3UVC A;  1XFY A;  3HDA P;  4XCT A;  4AYK A;  1HFS A;  3O2X A;  2X3C A;  1JK3 A;  4CTH A;  3V96 B;  4WKE A;  1EUB A;  2OW2 A;  1IAC A;  4R3V A;  1Q3A A;  1G49 A;  2CKI A;  2DW1 A;  4JIJ A;  1ZXC A;  2OVX A;  3ELM A;  3ZXH A;  1Y93 A;  1AYK A;  4GR3 A;  1SMP A;  4EFS A;  4WF6 A;  3K7N A;  1JAP A;  1UTT A;  3USN A;  1Y0V A;  4HX3 A;  1C3I A;  1XFX A;  1KUK A;  1MNC A;  1GE5 A;  3LJZ A;  1BZS A;  3BA0 A;  1D8F A;  1IAB A;  4A3W A;  4PKW A;  3TSK A;  1ZTQ A;  3RTS A;  1KAP P;  1XFZ A;  1PWV A;  2J83 A;  1USN A;  1IAD A;  4AXQ A;  5I2Z A;  4G0D A;  2WO8 A;  2OI0 A;  5L7F A;  4JP4 A;  2MLS A;  2X7M A;  4GR0 A;  2J0T A;  1BKC E;  2OW1 A;  1I76 A;  3DPE A;  5BPA A;  1KUI A;  2OVZ A;  4GF1 A;  3EHX A;  3KMC A;  1XUC A;  3LK8 A;  1OM6 A;  2MLR A;  3DL1 A;  3L0V A;  456C A;  1C8T A;  1JAO A;  1O0Q A;  3Q2G A;  2Z2D A;  3LUM A;  5BOT A;  5BOY A;  2W12 A;  1QJI A;  3P24 A;  3TT4 A;  3LIK A;  4PKS A;  2O36 A;  3KME A;  4DPE A;  3HB2 P;  1MMQ A;  2WO9 A;  3B8Z A;  3LQ0 A;  3LEA A;  1GE6 A;  5I4O A;  3HYG A;  1HY7 A;  1OS9 A;  3KWV C;  1XUD A;  4PKV A;  2X3B A;  2MZI A;  5D1T A;  3LJG A;  4JPA A;  3SHI A;  1AKL A;  4IJO A;  1JIW P;  3VI1 A;  4FXQ A;  1ATL A;  1JAN A;  1CXV A;  3AYU A;  3N2U A;  2DDY A;  1G05 A;  2K9C A;  2OW0 A;  5H8X A;  2O3E A;  5I0L A;  2A8H A;  1RM8 A;  4JQG A;  5CZM A;  1JAQ A;  1A86 A;  1CGF A;  4DF9 A;  1I1I P;  4GWN A;  3HBU P;  1CGL A;  5D3C A;  3AYK A;  1BIW A;  1YP1 A;  4WK7 A;  2E3X A;  3GBO A;  1QUA A;  2L0R A;  2RJQ A;  4WZV A;  4GWM A;  3B2Z A;  2OZR A;  3DSL A;  3Q2H A;  1IAG A;  1QIB A;  1AF0 A;  1XFU A;  1WNI A;  1HFC A;  966C A;  2TCL A;  2OW9 A;  1B8Y A;  2JIH A;  4G9L A;  1YOU A;  2OXU A;  1ZS0 A;  1K7Q A;  4DV8 A;  2X3A A;  3AIG A;  4H82 A;  4A7B A;  5I12 A;  4L63 A;  2PJT A;  4GQL A;  1DTH A;  3N2V A;  1JKY A;  4H2E A;  1XFV A;  2QPJ A;  1ZVX A;  2W0D A;  3CKI A;  1KUF A;  3TS4 A;  3F15 A;  3LGP A;  1CGE A;  1SLM A;  1K7I A;  1PWU A;  2CLT A;  3OHO A;  1PWW A;  5D1S A;  1S4B P;  1SU3 A;  1PWQ A;  1IAA A;  4AIG A;  1SRP A;  3EWJ A;  3KEJ A;  1GO8 P;  1OMJ A;  1GKC A;  1ROS A;  2YB9 A;  2FV9 A;  2MZH A;  1JIZ A;  1G9K A;  3K7L A;  2XS3 A;  3F18 A;  2ERQ A;  3E8R A;  1KUG A;  1BM6 A;  3F1A A;  1L6J A;  2AIG P;  1Y8J A;  3EHY A;  1UEA A;  4XM8 A;  4L19 A;  1O0T A;  1R54 A;  3RTT A;  1CK7 A;  4ON1 A;  3U1R A;  3ZVS A;  1BKC I;  2JNP A;  3EDG A;  1ZXV A;  1GE7 A;  1PWP A;  4GUY A;  1D8M A;  3LMC A;  1UMS A;  1FLS A;  1UTZ A;  2DDF A;  3O64 A;  4H1Q A;  4FXY P;  1G4K A;  3B92 A;  1OM7 A;  3F19 A;  4FVL A;  2RJP A;  3DPF A;  4PKT A;  5I43 A;  1Z3J A;  2D1O A;  1BSW A;  3WV1 A;  1DMT A;  1MMP A;  1OS2 A;  1H71 P;  4AUO A;  1CIZ A;  5B5O A;  1SAT A;  2AYK A;  1YCM A;  1KUH A;  1AST A;  3LE9 A;  1R1J A;  3DNG A;  2YIG A;  1RMZ A;  3I7I A;  3HDB A;  3KRY A;  2ERO A;  4XM6 A;  2W15 A;  1BUV M;  4H84 A;  3KHI A;  1GKD A;  1YQY A;  3EDI A;  2JT5 A;  2I47 A;  1B3D A;  1C7K A;  1R55 A;  1OO9 A;  830C A;  1J7N A;  1GXD A;  4H76 A;  4HMA A;  1CAQ A;  4I35 A;  1XFW A;  1MMR A;  4ZR5 A;  2OY2 A;  3HY7 A;  2Y6C A;  1BQQ M;  1QIC A;  2SRT A;  3NX7 A;  2FV5 A;  3VTG A;  2N8R A;  1ND1 A;  1MMB A;  5JMY A;  4Q1L A;  1I73 A;  5L79 A;  4H49 A;  1R1H A;  2Y6D A;  3ZUK A;  4XM7 A;  1KBC A;  2ERP A;  4JA1 A;  1XUR A;  3HBV P;  4ILW D;  3DWB A;  1HTD A;  4J4M A;  3WV2 A;  2W14 A;  2V4B A;  2XS4 A;  1BKC A;  3LKA A;  2POJ A;  4H3X A;  3LIL A;  5CXA A;  2K2G A;  1EB6 A;  3G42 A;  2JT6 A;  2DW2 A;  3KEC A;  1R1I A;  3KEK A;  5D1U A;  2HU6 A;  2USN A;  3LQB A;  1HV5 A;  2JSD A;  4QKZ A;  4I03 A;  3TVC A;  1FM1 A;  1D7X A; 
#chains in the Genus database with same CATH topology
 3F16 A;  4PKR A;  1CQR A;  3WV3 A;  4DD8 A;  1QJJ A;  2DW0 A;  5D2B A;  3G5C A;  4IN9 A;  4L6T A;  2MZE A;  1K7G A;  3EDZ A;  1UMT A;  1BQO A;  1A85 A;  4GR8 A;  1EAK A;  1OM8 A;  3I7G A;  4H30 A;  2OY4 A;  3P1V A;  3MA2 A;  1GO7 P;  1ZP5 A;  4WKI A;  1BUD A;  5B5P A;  3EDH A;  3HY9 A;  5I3M A;  3LJT A;  1G12 A;  3L0T A;  4IUW A;  5D7W A;  1JJ9 A;  5LAB A;  3OHL A;  3LIR A;  4PKQ A;  2W13 A;  4FU4 A;  3LUN A;  1QIA A;  3F17 A;  5CUH A;  1FBL A;  1IAE A;  4PKU A;  2OXW A;  1HOV A;  2WOA A;  2D1N A;  1D5J A;  2E2D A;  4XBH A;  2KRJ A;  1JH1 A;  2OXZ A;  1SLN A;  3UVC A;  1XFY A;  3HDA P;  4XCT A;  4AYK A;  1HFS A;  3O2X A;  2X3C A;  1JK3 A;  4CTH A;  3V96 B;  4WKE A;  1EUB A;  2OW2 A;  1IAC A;  4R3V A;  1Q3A A;  1G49 A;  2CKI A;  2DW1 A;  4JIJ A;  1ZXC A;  2OVX A;  3ELM A;  3ZXH A;  1Y93 A;  1AYK A;  4GR3 A;  1SMP A;  4EFS A;  4WF6 A;  3K7N A;  1JAP A;  1UTT A;  3USN A;  1Y0V A;  4HX3 A;  1C3I A;  1XFX A;  1KUK A;  1MNC A;  1GE5 A;  3LJZ A;  1BZS A;  3BA0 A;  1D8F A;  1IAB A;  4A3W A;  4PKW A;  3TSK A;  1ZTQ A;  3RTS A;  1KAP P;  1XFZ A;  1PWV A;  2J83 A;  1USN A;  1IAD A;  4AXQ A;  5I2Z A;  4G0D A;  2WO8 A;  2OI0 A;  5L7F A;  4JP4 A;  3DTK A;  2MLS A;  2X7M A;  4GR0 A;  2J0T A;  1BKC E;  2OW1 A;  1I76 A;  4L7A A;  3DPE A;  5BPA A;  1KUI A;  1XM5 A;  2OVZ A;  4GF1 A;  3EHX A;  3KMC A;  1XUC A;  3LK8 A;  1OM6 A;  2MLR A;  3DL1 A;  3L0V A;  456C A;  1C8T A;  1JAO A;  1O0Q A;  3Q2G A;  2Z2D A;  3LUM A;  5BOT A;  5BOY A;  2W12 A;  1QJI A;  3P24 A;  3TT4 A;  3LIK A;  4PKS A;  2O36 A;  3KME A;  4DPE A;  3HB2 P;  1MMQ A;  2WO9 A;  3B8Z A;  3LQ0 A;  3LEA A;  1GE6 A;  5I4O A;  3HYG A;  1HY7 A;  1OS9 A;  3KWV C;  1XUD A;  4PKV A;  2X3B A;  2MZI A;  5D1T A;  3LJG A;  4JPA A;  3SHI A;  1AKL A;  4IJO A;  1JIW P;  3VI1 A;  4FXQ A;  1ATL A;  1JAN A;  1CXV A;  3AYU A;  3N2U A;  2DDY A;  1G05 A;  2K9C A;  2OW0 A;  5H8X A;  2O3E A;  5I0L A;  2A8H A;  1RM8 A;  4JQG A;  5CZM A;  1JAQ A;  1A86 A;  1CGF A;  3DTI A;  4DF9 A;  1I1I P;  4GWN A;  3HBU P;  1CGL A;  5D3C A;  3AYK A;  1BIW A;  1YP1 A;  4WK7 A;  2E3X A;  3GBO A;  1QUA A;  2L0R A;  2RJQ A;  4WZV A;  4GWM A;  3B2Z A;  2OZR A;  3DSL A;  3Q2H A;  1IAG A;  1QIB A;  1AF0 A;  1XFU A;  1WNI A;  1HFC A;  966C A;  2TCL A;  2OW9 A;  1B8Y A;  2JIH A;  4G9L A;  1YOU A;  2OXU A;  1ZS0 A;  1K7Q A;  4DV8 A;  2X3A A;  3AIG A;  4H82 A;  4A7B A;  5I12 A;  4L63 A;  2PJT A;  4GQL A;  1DTH A;  3N2V A;  1JKY A;  4H2E A;  1XFV A;  2QPJ A;  3DTE A;  1ZVX A;  2W0D A;  3CKI A;  1KUF A;  3TS4 A;  3F15 A;  1TVI A;  3LGP A;  1CGE A;  1SLM A;  1K7I A;  1PWU A;  2CLT A;  3OHO A;  1PWW A;  5D1S A;  1S4B P;  1SU3 A;  1PWQ A;  1IAA A;  4AIG A;  1SRP A;  3EWJ A;  3KEJ A;  1GO8 P;  1OMJ A;  1GKC A;  1ROS A;  2YB9 A;  2FV9 A;  2MZH A;  1JIZ A;  1G9K A;  3K7L A;  1OZ9 A;  2XS3 A;  3F18 A;  2ERQ A;  3E8R A;  1KUG A;  1BM6 A;  3F1A A;  1L6J A;  2AIG P;  1Y8J A;  3EHY A;  1UEA A;  4XM8 A;  4L19 A;  1O0T A;  1R54 A;  3RTT A;  1CK7 A;  4ON1 A;  3U1R A;  3ZVS A;  1BKC I;  2JNP A;  3EDG A;  1ZXV A;  1GE7 A;  1PWP A;  4GUY A;  1D8M A;  3LMC A;  1XAX A;  1UMS A;  1FLS A;  1UTZ A;  2DDF A;  3O64 A;  4H1Q A;  4FXY P;  1G4K A;  3B92 A;  1OM7 A;  3F19 A;  4FVL A;  2RJP A;  3DPF A;  4PKT A;  5I43 A;  1Z3J A;  2D1O A;  1BSW A;  3WV1 A;  1DMT A;  1MMP A;  1OS2 A;  1H71 P;  4AUO A;  1CIZ A;  5B5O A;  1SAT A;  2AYK A;  1YCM A;  1KUH A;  1AST A;  3LE9 A;  1R1J A;  3DNG A;  2YIG A;  1RMZ A;  3I7I A;  3HDB A;  3KRY A;  2ERO A;  4XM6 A;  2W15 A;  1BUV M;  4H84 A;  3KHI A;  1GKD A;  1YQY A;  3EDI A;  2JT5 A;  2I47 A;  1B3D A;  1C7K A;  1R55 A;  1OO9 A;  830C A;  1J7N A;  1GXD A;  4H76 A;  4HMA A;  1CAQ A;  4I35 A;  1XFW A;  1MMR A;  4ZR5 A;  2OY2 A;  3HY7 A;  2Y6C A;  1BQQ M;  1QIC A;  2SRT A;  3NX7 A;  2FV5 A;  3VTG A;  2N8R A;  1ND1 A;  1MMB A;  5JMY A;  4Q1L A;  1I73 A;  5L79 A;  4H49 A;  1R1H A;  2Y6D A;  3ZUK A;  4XM7 A;  1KBC A;  2ERP A;  4JA1 A;  1XUR A;  3HBV P;  4ILW D;  3DWB A;  1HTD A;  4J4M A;  3WV2 A;  2W14 A;  2V4B A;  2XS4 A;  1BKC A;  3LKA A;  2POJ A;  4H3X A;  3LIL A;  5CXA A;  2K2G A;  1EB6 A;  3G42 A;  2JT6 A;  2DW2 A;  3KEC A;  1R1I A;  3KEK A;  5D1U A;  2YUF A;  2HU6 A;  2USN A;  3LQB A;  1HV5 A;  2JSD A;  4QKZ A;  4I03 A;  3TVC A;  1FM1 A;  1D7X A; 
#chains in the Genus database with same CATH homology
 3F16 A;  4PKR A;  1CQR A;  3WV3 A;  4DD8 A;  1QJJ A;  2DW0 A;  5D2B A;  3G5C A;  4IN9 A;  4L6T A;  2MZE A;  1K7G A;  3EDZ A;  1UMT A;  1BQO A;  1A85 A;  4GR8 A;  1EAK A;  1OM8 A;  3I7G A;  4H30 A;  2OY4 A;  3P1V A;  3MA2 A;  1GO7 P;  1ZP5 A;  4WKI A;  1BUD A;  5B5P A;  3EDH A;  3HY9 A;  5I3M A;  3LJT A;  1G12 A;  3L0T A;  4IUW A;  5D7W A;  1JJ9 A;  5LAB A;  3OHL A;  3LIR A;  4PKQ A;  2W13 A;  4FU4 A;  3LUN A;  1QIA A;  3F17 A;  5CUH A;  1FBL A;  1IAE A;  4PKU A;  2OXW A;  1HOV A;  2WOA A;  2D1N A;  1D5J A;  2E2D A;  4XBH A;  2KRJ A;  1JH1 A;  2OXZ A;  1SLN A;  3UVC A;  1XFY A;  3HDA P;  4XCT A;  4AYK A;  1HFS A;  3O2X A;  2X3C A;  1JK3 A;  4CTH A;  3V96 B;  4WKE A;  1EUB A;  2OW2 A;  1IAC A;  4R3V A;  1Q3A A;  1G49 A;  2CKI A;  2DW1 A;  4JIJ A;  1ZXC A;  2OVX A;  3ELM A;  3ZXH A;  1Y93 A;  1AYK A;  4GR3 A;  1SMP A;  4EFS A;  4WF6 A;  3K7N A;  1JAP A;  1UTT A;  3USN A;  1Y0V A;  4HX3 A;  1C3I A;  1XFX A;  1KUK A;  1MNC A;  1GE5 A;  3LJZ A;  1BZS A;  3BA0 A;  1D8F A;  1IAB A;  4A3W A;  4PKW A;  3TSK A;  1ZTQ A;  3RTS A;  1KAP P;  1XFZ A;  1PWV A;  2J83 A;  1USN A;  1IAD A;  4AXQ A;  5I2Z A;  4G0D A;  2WO8 A;  2OI0 A;  5L7F A;  4JP4 A;  3DTK A;  2MLS A;  2X7M A;  4GR0 A;  2J0T A;  1BKC E;  2OW1 A;  1I76 A;  4L7A A;  3DPE A;  5BPA A;  1KUI A;  2OVZ A;  4GF1 A;  3EHX A;  3KMC A;  1XUC A;  3LK8 A;  1OM6 A;  2MLR A;  3DL1 A;  3L0V A;  456C A;  1C8T A;  1JAO A;  1O0Q A;  3Q2G A;  2Z2D A;  3LUM A;  5BOT A;  5BOY A;  2W12 A;  1QJI A;  3P24 A;  3TT4 A;  3LIK A;  4PKS A;  2O36 A;  3KME A;  4DPE A;  3HB2 P;  1MMQ A;  2WO9 A;  3B8Z A;  3LQ0 A;  3LEA A;  1GE6 A;  5I4O A;  3HYG A;  1HY7 A;  1OS9 A;  3KWV C;  1XUD A;  4PKV A;  2X3B A;  2MZI A;  5D1T A;  3LJG A;  4JPA A;  3SHI A;  1AKL A;  4IJO A;  1JIW P;  3VI1 A;  4FXQ A;  1ATL A;  1JAN A;  1CXV A;  3AYU A;  3N2U A;  2DDY A;  1G05 A;  2K9C A;  2OW0 A;  5H8X A;  2O3E A;  5I0L A;  2A8H A;  1RM8 A;  4JQG A;  5CZM A;  1JAQ A;  1A86 A;  1CGF A;  3DTI A;  4DF9 A;  1I1I P;  4GWN A;  3HBU P;  1CGL A;  5D3C A;  3AYK A;  1BIW A;  1YP1 A;  4WK7 A;  2E3X A;  3GBO A;  1QUA A;  2L0R A;  2RJQ A;  4WZV A;  4GWM A;  3B2Z A;  2OZR A;  3DSL A;  3Q2H A;  1IAG A;  1QIB A;  1AF0 A;  1XFU A;  1WNI A;  1HFC A;  966C A;  2TCL A;  2OW9 A;  1B8Y A;  2JIH A;  4G9L A;  1YOU A;  2OXU A;  1ZS0 A;  1K7Q A;  4DV8 A;  2X3A A;  3AIG A;  4H82 A;  4A7B A;  5I12 A;  4L63 A;  2PJT A;  4GQL A;  1DTH A;  3N2V A;  1JKY A;  4H2E A;  1XFV A;  2QPJ A;  3DTE A;  1ZVX A;  2W0D A;  3CKI A;  1KUF A;  3TS4 A;  3F15 A;  3LGP A;  1CGE A;  1SLM A;  1K7I A;  1PWU A;  2CLT A;  3OHO A;  1PWW A;  5D1S A;  1S4B P;  1SU3 A;  1PWQ A;  1IAA A;  4AIG A;  1SRP A;  3EWJ A;  3KEJ A;  1GO8 P;  1OMJ A;  1GKC A;  1ROS A;  2YB9 A;  2FV9 A;  2MZH A;  1JIZ A;  1G9K A;  3K7L A;  2XS3 A;  3F18 A;  2ERQ A;  3E8R A;  1KUG A;  1BM6 A;  3F1A A;  1L6J A;  2AIG P;  1Y8J A;  3EHY A;  1UEA A;  4XM8 A;  4L19 A;  1O0T A;  1R54 A;  3RTT A;  1CK7 A;  4ON1 A;  3U1R A;  3ZVS A;  1BKC I;  2JNP A;  3EDG A;  1ZXV A;  1GE7 A;  1PWP A;  4GUY A;  1D8M A;  3LMC A;  1UMS A;  1FLS A;  1UTZ A;  2DDF A;  3O64 A;  4H1Q A;  4FXY P;  1G4K A;  3B92 A;  1OM7 A;  3F19 A;  4FVL A;  2RJP A;  3DPF A;  4PKT A;  5I43 A;  1Z3J A;  2D1O A;  1BSW A;  3WV1 A;  1DMT A;  1MMP A;  1OS2 A;  1H71 P;  4AUO A;  1CIZ A;  5B5O A;  1SAT A;  2AYK A;  1YCM A;  1KUH A;  1AST A;  3LE9 A;  1R1J A;  3DNG A;  2YIG A;  1RMZ A;  3I7I A;  3HDB A;  3KRY A;  2ERO A;  4XM6 A;  2W15 A;  1BUV M;  4H84 A;  3KHI A;  1GKD A;  1YQY A;  3EDI A;  2JT5 A;  2I47 A;  1B3D A;  1C7K A;  1R55 A;  1OO9 A;  830C A;  1J7N A;  1GXD A;  4H76 A;  4HMA A;  1CAQ A;  4I35 A;  1XFW A;  1MMR A;  4ZR5 A;  2OY2 A;  3HY7 A;  2Y6C A;  1BQQ M;  1QIC A;  2SRT A;  3NX7 A;  2FV5 A;  3VTG A;  2N8R A;  1ND1 A;  1MMB A;  5JMY A;  4Q1L A;  1I73 A;  5L79 A;  4H49 A;  1R1H A;  2Y6D A;  3ZUK A;  4XM7 A;  1KBC A;  2ERP A;  4JA1 A;  1XUR A;  3HBV P;  4ILW D;  3DWB A;  1HTD A;  4J4M A;  3WV2 A;  2W14 A;  2V4B A;  2XS4 A;  1BKC A;  3LKA A;  2POJ A;  4H3X A;  3LIL A;  5CXA A;  2K2G A;  1EB6 A;  3G42 A;  2JT6 A;  2DW2 A;  3KEC A;  1R1I A;  3KEK A;  5D1U A;  2YUF A;  2HU6 A;  2USN A;  3LQB A;  1HV5 A;  2JSD A;  4QKZ A;  4I03 A;  3TVC A;  1FM1 A;  1D7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...