2JNPA

Solution structure of matrix metalloproteinase 3 (mmp-3) in the presence of n-isobutyl-n-[4-methoxyphenylsulfonyl]glycyl hydroxamic acid (nngh)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
161
structure length
161
Chain Sequence
GIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Matrix metalloproteinase-3
publication title Matrix metalloproteinase-inhibitor interaction: the solution structure of the catalytic domain of human matrix metalloproteinase-3 with different inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 161
sequence length 161
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2jnpA00
3G5CA 3KEKA 1BZSA 1OS9A 2O3EA 1Y0VA 1UTZA 4DPEA 3LEAA 4JPAA 1OO9A 1DTHA 3K7NA 2RJPA 1KUHA 1RM8A 4GQLA 4H30A 5D1UA 3DSLA 4GR3A 2A8HA 1BKCA 3F19A 1DMTA 3HDBA 2TCLA 1XUDA 5L79A 1GE6A 2W0DA 3EDHA 2ERPA 4H2EA 3OHOA 1JIWP 1ZS0A 1IACA 1KUIA 4WK7A 1AF0A 3CKIA 4QKZA 3AYKA 5JMYA 4WKEA 1R1IA 4XCTA 2FV9A 1YQYA 2OXUA 1BUDA 4H1QA 3N2UA 4H76A 4XBHA 1CK7A 2X7MA 4XM8A 3VI1A 1BQOA 3LJGA 4GWMA 2DDYA 3KECA 3O2XA 3E8RA 1WNIA 3LE9A 1A86A 3LIRA 2OW0A 966CA 4GR8A 1EUBA 4DD8A 1MMPA 2ERQA 4L6TA 2DW0A 1C7KA 5D1SA 1CAQA 5I2ZA 2CKIA 5CXAA 2OVZA 830CA 3LUNA 1RMZA 2HU6A 2J0TA 4H82A 1IAEA 2OW1A 3TS4A 5D7WA 1FBLA 1ROSA 4L63A 1IAGA 4XM6A 1A85A 1ZP5A 2Z2DA 4IN9A 4PKWA 5B5PA 3EHXA 4DV8A 1R55A 1PWUA 1K7QA 4GUYA 3MA2A 3HB2P 3F18A 1K7IA 1R1HA 3KEJA 3EHYA 3UVCA 3LQBA 4FXQA 1HFCA 1JJ9A 1O0QA 1PWQA 3LMCA 3L0VA 3KWVC 1HOVA 3KRYA 456CA 1BKCI 2MZEA 2MZIA 2L0RA 4JA1A 3F15A 5BOTA 2XS3A 2E2DA 1XUCA 1HTDA 3Q2GA 3LJZA 1EB6A 1G4KA 1JIZA 4G9LA 1QJIA 2K9CA 5BOYA 1R54A 1QIAA 3HDAP 3KHIA 1J7NA 1C3IA 2AYKA 1GKCA 1GE5A 1KUGA 1O0TA 2YB9A 2WOAA 1HV5A 3EDIA 4GWNA 4Q1LA 4G0DA 3GBOA 1CIZA 1JAQA 1XFXA 4AUOA 3LJTA 1SRPA 1I76A 3WV1A 2X3BA 5D3CA 3P1VA 2JT6A 3HBVP 1Y8JA 1D7XA 3LILA 3WV2A 4ON1A 2D1NA 1BKCE 3KMEA 4CTHA 2W13A 1K7GA 1FM1A 2OVXA 4PKVA 5L7FA 1MMQA 4JQGA 2QPJA 2Y6DA 4I35A 4FVLA 4L19A 3N2VA 3DL1A 3ZXHA 1ASTA 4FXYP 1OM7A 2X3AA 3LQ0A 1OM6A 1XFUA 4H84A 1XFZA 1QICA 4H49A 4JP4A 1D8MA 2KRJA 3LKAA 1IADA 1UEAA 3V96B 1D8FA 1PWPA 1GO7P 3F17A 3B92A 4IJOA 1YCMA 3SHIA 1KBCA 1PWVA 4ZR5A 1ZVXA 5I4OA 4AYKA 2W12A 3BA0A 2USNA 1BSWA 2DW2A 1KAPP 1YOUA 3DPEA 1OM8A 5LABA 1G12A 1GXDA 4H3XA 1XFVA 1KUFA 2MLRA 2PJTA 3HYGA 2Y6CA 1BIWA 2JT5A 2MLSA 2N8RA 3ELMA 1Z3JA 3HY7A 2CLTA 2OZRA 4AXQA 1H71P 1EAKA 3LK8A 1OMJA 2X3CA 3EWJA 4IUWA 2OXZA 1S4BP 3AYUA 3HY9A 2JIHA 1XFYA 5H8XA 3HBUP 3P24A 3LIKA 2JNPA 1SATA 3AIGA 1CQRA 1B8YA 5BPAA 1BQQM 4WF6A 2V4BA 1SU3A 1PWWA 5I43A 1QJJA 3KMCA 2E3XA 1Q3AA 2OW2A 1KUKA 3TT4A 1AKLA 4I03A 1UTTA 2SRTA 3DPFA 4PKQA 4GF1A 2J83A 1JH1A 1JANA 3G42A 2D1OA 1JAOA 1I73A 1SLNA 1UMTA 2OXWA 4EFSA 1OS2A 3VTGA 1MNCA 3I7GA 3ZUKA 5I12A 1Y93A 1GKDA 2OY4A 4PKTA 1G05A 1XFWA 1L6JA 1UMSA 3TVCA 5I0LA 2AIGP 4FU4A 1CGEA 4XM7A 3LGPA 1AYKA 1QIBA 3LUMA 1HFSA 4WKIA 4A3WA 2MZHA 3Q2HA 1JKYA 2W14A 1BM6A 1GO8P 1HY7A 1XURA 1SMPA 3DNGA 3L0TA 3NX7A 1ZXVA 2RJQA 3TSKA 1CXVA 4A7BA 3F1AA 1IAAA 5B5OA 4PKSA 2DDFA 4PKUA 3WV3A 1FLSA 1IABA 1GE7A 1USNA 4ILWD 2K2GA 1D5JA 2FV5A 3RTTA 1C8TA 1JK3A 2OY2A 3B2ZA 4JIJA 1JAPA 1SLMA 4WZVA 5CZMA 1CGLA 5D2BA 3USNA 1MMRA 2YIGA 3I7IA 1YP1A 4R3VA 1CGFA 3O64A 1ND1A 3OHLA 2XS4A 4HX3A 2OW9A 4DF9A 1ATLA 1ZXCA 2POJA 4GR0A 2EROA 1I1IP 4PKRA 3DWBA 5I3MA 3F16A 3U1RA 3EDZA 1B3DA 2W15A 1QUAA 2O36A 2WO8A 2DW1A 2I47A 3RTSA 2JSDA 5CUHA 4HMAA 1G49A 3K7LA 1R1JA 1MMBA 4J4MA 5D1TA 2OI0A 4AIGA 3ZVSA 3B8ZA 2WO9A 1G9KA 3EDGA 1ZTQA 1BUVM
chains in the Genus database with same CATH superfamily
3G5CA 3KEKA 1BZSA 1OS9A 2O3EA 1Y0VA 1UTZA 4DPEA 3LEAA 4JPAA 1OO9A 1DTHA 3K7NA 2RJPA 1KUHA 1RM8A 4GQLA 4H30A 5D1UA 3DSLA 4GR3A 2A8HA 1BKCA 3F19A 1DMTA 3HDBA 2TCLA 1XUDA 5L79A 1GE6A 2W0DA 3EDHA 2ERPA 4H2EA 3OHOA 1JIWP 1ZS0A 1IACA 1KUIA 4WK7A 1AF0A 3CKIA 4QKZA 3AYKA 5JMYA 4WKEA 1R1IA 4XCTA 2FV9A 1YQYA 2OXUA 1BUDA 4H1QA 3N2UA 4H76A 4XBHA 1CK7A 2X7MA 4XM8A 3VI1A 1BQOA 3LJGA 4GWMA 2DDYA 3KECA 3O2XA 3E8RA 1WNIA 3LE9A 1A86A 3LIRA 2OW0A 966CA 4GR8A 1EUBA 4DD8A 1MMPA 2ERQA 4L6TA 2DW0A 1C7KA 5D1SA 1CAQA 5I2ZA 2CKIA 5CXAA 2OVZA 830CA 3LUNA 1RMZA 2HU6A 2J0TA 4H82A 1IAEA 2OW1A 3TS4A 5D7WA 1FBLA 1ROSA 4L63A 1TVIA 1IAGA 4XM6A 1A85A 1ZP5A 2Z2DA 4IN9A 4PKWA 5B5PA 3EHXA 4DV8A 1R55A 1PWUA 1K7QA 4GUYA 3MA2A 3HB2P 3F18A 1K7IA 1R1HA 3KEJA 3EHYA 3UVCA 3LQBA 4FXQA 1HFCA 1JJ9A 1O0QA 1PWQA 3LMCA 3L0VA 3KWVC 1HOVA 3KRYA 456CA 1BKCI 2MZEA 2MZIA 2L0RA 3DTEA 4JA1A 3F15A 5BOTA 2XS3A 2E2DA 1XUCA 1HTDA 3Q2GA 3LJZA 1EB6A 1G4KA 1JIZA 4G9LA 1QJIA 2K9CA 5BOYA 1R54A 1QIAA 3HDAP 3KHIA 1J7NA 1C3IA 2AYKA 1GKCA 1GE5A 1KUGA 1O0TA 2YB9A 2WOAA 1HV5A 3EDIA 4GWNA 4Q1LA 4G0DA 3GBOA 1CIZA 1JAQA 1XFXA 4AUOA 3LJTA 1SRPA 1I76A 3WV1A 2X3BA 5D3CA 3P1VA 2JT6A 3HBVP 1Y8JA 1D7XA 3LILA 3WV2A 4ON1A 2D1NA 1BKCE 3KMEA 4CTHA 2W13A 1K7GA 1FM1A 2OVXA 1XM5A 4PKVA 5L7FA 1MMQA 4JQGA 2QPJA 2Y6DA 4I35A 4FVLA 2YUFA 3N2VA 4L19A 3DL1A 3ZXHA 1ASTA 4FXYP 1OM7A 2X3AA 3LQ0A 1OM6A 1XFUA 4H84A 1XFZA 1QICA 4H49A 4JP4A 1D8MA 2KRJA 3LKAA 1IADA 3DTIA 1UEAA 3V96B 1D8FA 1PWPA 1GO7P 3F17A 3B92A 4IJOA 1YCMA 3SHIA 1KBCA 1PWVA 4ZR5A 1ZVXA 5I4OA 4AYKA 2W12A 3BA0A 2USNA 1BSWA 2DW2A 1KAPP 1YOUA 1OZ9A 3DPEA 1OM8A 5LABA 1G12A 1GXDA 4H3XA 1XFVA 1KUFA 2MLRA 2PJTA 3HYGA 2Y6CA 1BIWA 2JT5A 2MLSA 2N8RA 3ELMA 1Z3JA 3HY7A 2CLTA 2OZRA 4AXQA 1H71P 1EAKA 3LK8A 1OMJA 2X3CA 3EWJA 4IUWA 2OXZA 1S4BP 3AYUA 3HY9A 2JIHA 1XFYA 5H8XA 3HBUP 3P24A 4L7AA 3LIKA 2JNPA 1SATA 3AIGA 1CQRA 1B8YA 5BPAA 1BQQM 4WF6A 2V4BA 1SU3A 1PWWA 5I43A 1QJJA 3KMCA 2E3XA 1Q3AA 2OW2A 1KUKA 3TT4A 1AKLA 4I03A 1UTTA 2SRTA 3DPFA 4PKQA 4GF1A 2J83A 1JH1A 1JANA 3G42A 2D1OA 1JAOA 1I73A 1SLNA 1UMTA 2OXWA 4EFSA 1OS2A 3VTGA 1MNCA 3I7GA 3ZUKA 5I12A 1Y93A 1GKDA 2OY4A 4PKTA 1G05A 1XFWA 1L6JA 1UMSA 3TVCA 5I0LA 2AIGP 4FU4A 1CGEA 4XM7A 3LGPA 1AYKA 1QIBA 3LUMA 1HFSA 4WKIA 4A3WA 2MZHA 3Q2HA 1JKYA 2W14A 1BM6A 1GO8P 1HY7A 1XURA 1SMPA 3DNGA 3L0TA 3NX7A 1ZXVA 2RJQA 3TSKA 1CXVA 4A7BA 3F1AA 1IAAA 5B5OA 4PKSA 2DDFA 1XAXA 4PKUA 3WV3A 1FLSA 1IABA 1GE7A 1USNA 4ILWD 2K2GA 1D5JA 2FV5A 3RTTA 1C8TA 1JK3A 2OY2A 3B2ZA 4JIJA 1JAPA 1SLMA 4WZVA 5CZMA 1CGLA 5D2BA 3USNA 1MMRA 2YIGA 3I7IA 1YP1A 4R3VA 1CGFA 3O64A 1ND1A 3OHLA 2XS4A 4HX3A 2OW9A 4DF9A 1ATLA 1ZXCA 2POJA 4GR0A 2EROA 1I1IP 4PKRA 3DWBA 5I3MA 3F16A 3U1RA 3EDZA 1B3DA 2W15A 1QUAA 2O36A 2WO8A 2DW1A 2I47A 3RTSA 2JSDA 5CUHA 4HMAA 1G49A 3K7LA 3DTKA 1R1JA 1MMBA 4J4MA 5D1TA 2OI0A 4AIGA 3ZVSA 3B8ZA 2WO9A 1G9KA 3EDGA 1ZTQA 1BUVM
chains in the Genus database with same CATH topology
3G5CA 3KEKA 1BZSA 1OS9A 2O3EA 1Y0VA 1UTZA 4DPEA 3LEAA 4JPAA 1OO9A 1DTHA 3K7NA 2RJPA 1KUHA 1RM8A 4GQLA 4H30A 5D1UA 3DSLA 4GR3A 2A8HA 1BKCA 3F19A 1DMTA 3HDBA 2TCLA 1XUDA 5L79A 1GE6A 2W0DA 3EDHA 2ERPA 4H2EA 3OHOA 1JIWP 1ZS0A 1IACA 1KUIA 4WK7A 1AF0A 3CKIA 4QKZA 3AYKA 5JMYA 4WKEA 1R1IA 4XCTA 2FV9A 1YQYA 2OXUA 1BUDA 4H1QA 3N2UA 4H76A 4XBHA 1CK7A 2X7MA 4XM8A 3VI1A 1BQOA 3LJGA 4GWMA 2DDYA 3KECA 3O2XA 3E8RA 1WNIA 3LE9A 1A86A 3LIRA 2OW0A 966CA 4GR8A 1EUBA 4DD8A 1MMPA 2ERQA 4L6TA 2DW0A 1C7KA 5D1SA 1CAQA 5I2ZA 2CKIA 5CXAA 2OVZA 830CA 3LUNA 1RMZA 2HU6A 2J0TA 4H82A 1IAEA 2OW1A 3TS4A 5D7WA 1FBLA 1ROSA 4L63A 1IAGA 4XM6A 1A85A 1ZP5A 2Z2DA 4IN9A 4PKWA 5B5PA 3EHXA 4DV8A 1R55A 1PWUA 1K7QA 4GUYA 3MA2A 3HB2P 3F18A 1K7IA 1R1HA 3KEJA 3EHYA 3UVCA 3LQBA 4FXQA 1HFCA 1JJ9A 1O0QA 1PWQA 3LMCA 3L0VA 3KWVC 1HOVA 3KRYA 456CA 1BKCI 2MZEA 2MZIA 2L0RA 3DTEA 4JA1A 3F15A 5BOTA 2XS3A 2E2DA 1XUCA 1HTDA 3Q2GA 3LJZA 1EB6A 1G4KA 1JIZA 4G9LA 1QJIA 2K9CA 5BOYA 1R54A 1QIAA 3HDAP 3KHIA 1J7NA 1C3IA 2AYKA 1GKCA 1GE5A 1KUGA 1O0TA 2YB9A 2WOAA 1HV5A 3EDIA 4GWNA 4Q1LA 4G0DA 3GBOA 1CIZA 1JAQA 1XFXA 4AUOA 3LJTA 1SRPA 1I76A 3WV1A 2X3BA 5D3CA 3P1VA 2JT6A 3HBVP 1Y8JA 1D7XA 3LILA 3WV2A 4ON1A 2D1NA 1BKCE 3KMEA 4CTHA 2W13A 1K7GA 1FM1A 2OVXA 4PKVA 5L7FA 1MMQA 4JQGA 2QPJA 2Y6DA 4I35A 4FVLA 2YUFA 3N2VA 4L19A 3DL1A 3ZXHA 1ASTA 4FXYP 1OM7A 2X3AA 3LQ0A 1OM6A 1XFUA 4H84A 1XFZA 1QICA 4H49A 4JP4A 1D8MA 2KRJA 3LKAA 1IADA 3DTIA 1UEAA 3V96B 1D8FA 1PWPA 1GO7P 3F17A 3B92A 4IJOA 1YCMA 3SHIA 1KBCA 1PWVA 4ZR5A 1ZVXA 5I4OA 4AYKA 2W12A 3BA0A 2USNA 1BSWA 2DW2A 1KAPP 1YOUA 3DPEA 1OM8A 5LABA 1G12A 1GXDA 4H3XA 1XFVA 1KUFA 2MLRA 2PJTA 3HYGA 2Y6CA 1BIWA 2JT5A 2MLSA 2N8RA 3ELMA 1Z3JA 3HY7A 2CLTA 2OZRA 4AXQA 1H71P 1EAKA 3LK8A 1OMJA 2X3CA 3EWJA 4IUWA 2OXZA 1S4BP 3AYUA 3HY9A 2JIHA 1XFYA 5H8XA 3HBUP 3P24A 4L7AA 3LIKA 2JNPA 1SATA 3AIGA 1CQRA 1B8YA 5BPAA 1BQQM 4WF6A 2V4BA 1SU3A 1PWWA 5I43A 1QJJA 3KMCA 2E3XA 1Q3AA 2OW2A 1KUKA 3TT4A 1AKLA 4I03A 1UTTA 2SRTA 3DPFA 4PKQA 4GF1A 2J83A 1JH1A 1JANA 3G42A 2D1OA 1JAOA 1I73A 1SLNA 1UMTA 2OXWA 4EFSA 1OS2A 3VTGA 1MNCA 3I7GA 3ZUKA 5I12A 1Y93A 1GKDA 2OY4A 4PKTA 1G05A 1XFWA 1L6JA 1UMSA 3TVCA 5I0LA 2AIGP 4FU4A 1CGEA 4XM7A 3LGPA 1AYKA 1QIBA 3LUMA 1HFSA 4WKIA 4A3WA 2MZHA 3Q2HA 1JKYA 2W14A 1BM6A 1GO8P 1HY7A 1XURA 1SMPA 3DNGA 3L0TA 3NX7A 1ZXVA 2RJQA 3TSKA 1CXVA 4A7BA 3F1AA 1IAAA 5B5OA 4PKSA 2DDFA 4PKUA 3WV3A 1FLSA 1IABA 1GE7A 1USNA 4ILWD 2K2GA 1D5JA 2FV5A 3RTTA 1C8TA 1JK3A 2OY2A 3B2ZA 4JIJA 1JAPA 1SLMA 4WZVA 5CZMA 1CGLA 5D2BA 3USNA 1MMRA 2YIGA 3I7IA 1YP1A 4R3VA 1CGFA 3O64A 1ND1A 3OHLA 2XS4A 4HX3A 2OW9A 4DF9A 1ATLA 1ZXCA 2POJA 4GR0A 2EROA 1I1IP 4PKRA 3DWBA 5I3MA 3F16A 3U1RA 3EDZA 1B3DA 2W15A 1QUAA 2O36A 2WO8A 2DW1A 2I47A 3RTSA 2JSDA 5CUHA 4HMAA 1G49A 3K7LA 3DTKA 1R1JA 1MMBA 4J4MA 5D1TA 2OI0A 4AIGA 3ZVSA 3B8ZA 2WO9A 1G9KA 3EDGA 1ZTQA 1BUVM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G5C A;  3KEK A;  1BZS A;  1OS9 A;  2O3E A;  1Y0V A;  1UTZ A;  4DPE A;  3LEA A;  4JPA A;  1OO9 A;  1DTH A;  3K7N A;  2RJP A;  1KUH A;  1RM8 A;  4GQL A;  4H30 A;  5D1U A;  3DSL A;  4GR3 A;  2A8H A;  1BKC A;  3F19 A;  1DMT A;  3HDB A;  2TCL A;  1XUD A;  5L79 A;  1GE6 A;  2W0D A;  3EDH A;  2ERP A;  4H2E A;  3OHO A;  1JIW P;  1ZS0 A;  1IAC A;  1KUI A;  4WK7 A;  1AF0 A;  3CKI A;  4QKZ A;  3AYK A;  5JMY A;  4WKE A;  1R1I A;  4XCT A;  2FV9 A;  1YQY A;  2OXU A;  1BUD A;  4H1Q A;  3N2U A;  4H76 A;  4XBH A;  1CK7 A;  2X7M A;  4XM8 A;  3VI1 A;  1BQO A;  3LJG A;  4GWM A;  2DDY A;  3KEC A;  3O2X A;  3E8R A;  1WNI A;  3LE9 A;  1A86 A;  3LIR A;  2OW0 A;  966C A;  4GR8 A;  1EUB A;  4DD8 A;  1MMP A;  2ERQ A;  4L6T A;  2DW0 A;  1C7K A;  5D1S A;  1CAQ A;  5I2Z A;  2CKI A;  5CXA A;  2OVZ A;  830C A;  3LUN A;  1RMZ A;  2HU6 A;  2J0T A;  4H82 A;  1IAE A;  2OW1 A;  3TS4 A;  5D7W A;  1FBL A;  1ROS A;  4L63 A;  1IAG A;  4XM6 A;  1A85 A;  1ZP5 A;  2Z2D A;  4IN9 A;  4PKW A;  5B5P A;  3EHX A;  4DV8 A;  1R55 A;  1PWU A;  1K7Q A;  4GUY A;  3MA2 A;  3HB2 P;  3F18 A;  1K7I A;  1R1H A;  3KEJ A;  3EHY A;  3UVC A;  3LQB A;  4FXQ A;  1HFC A;  1JJ9 A;  1O0Q A;  1PWQ A;  3LMC A;  3L0V A;  3KWV C;  1HOV A;  3KRY A;  456C A;  1BKC I;  2MZE A;  2MZI A;  2L0R A;  4JA1 A;  3F15 A;  5BOT A;  2XS3 A;  2E2D A;  1XUC A;  1HTD A;  3Q2G A;  3LJZ A;  1EB6 A;  1G4K A;  1JIZ A;  4G9L A;  1QJI A;  2K9C A;  5BOY A;  1R54 A;  1QIA A;  3HDA P;  3KHI A;  1J7N A;  1C3I A;  2AYK A;  1GKC A;  1GE5 A;  1KUG A;  1O0T A;  2YB9 A;  2WOA A;  1HV5 A;  3EDI A;  4GWN A;  4Q1L A;  4G0D A;  3GBO A;  1CIZ A;  1JAQ A;  1XFX A;  4AUO A;  3LJT A;  1SRP A;  1I76 A;  3WV1 A;  2X3B A;  5D3C A;  3P1V A;  2JT6 A;  3HBV P;  1Y8J A;  1D7X A;  3LIL A;  3WV2 A;  4ON1 A;  2D1N A;  1BKC E;  3KME A;  4CTH A;  2W13 A;  1K7G A;  1FM1 A;  2OVX A;  4PKV A;  5L7F A;  1MMQ A;  4JQG A;  2QPJ A;  2Y6D A;  4I35 A;  4FVL A;  4L19 A;  3N2V A;  3DL1 A;  3ZXH A;  1AST A;  4FXY P;  1OM7 A;  2X3A A;  3LQ0 A;  1OM6 A;  1XFU A;  4H84 A;  1XFZ A;  1QIC A;  4H49 A;  4JP4 A;  1D8M A;  2KRJ A;  3LKA A;  1IAD A;  1UEA A;  3V96 B;  1D8F A;  1PWP A;  1GO7 P;  3F17 A;  3B92 A;  4IJO A;  1YCM A;  3SHI A;  1KBC A;  1PWV A;  4ZR5 A;  1ZVX A;  5I4O A;  4AYK A;  2W12 A;  3BA0 A;  2USN A;  1BSW A;  2DW2 A;  1KAP P;  1YOU A;  3DPE A;  1OM8 A;  5LAB A;  1G12 A;  1GXD A;  4H3X A;  1XFV A;  1KUF A;  2MLR A;  2PJT A;  3HYG A;  2Y6C A;  1BIW A;  2JT5 A;  2MLS A;  2N8R A;  3ELM A;  1Z3J A;  3HY7 A;  2CLT A;  2OZR A;  4AXQ A;  1H71 P;  1EAK A;  3LK8 A;  1OMJ A;  2X3C A;  3EWJ A;  4IUW A;  2OXZ A;  1S4B P;  3AYU A;  3HY9 A;  2JIH A;  1XFY A;  5H8X A;  3HBU P;  3P24 A;  3LIK A;  2JNP A;  1SAT A;  3AIG A;  1CQR A;  1B8Y A;  5BPA A;  1BQQ M;  4WF6 A;  2V4B A;  1SU3 A;  1PWW A;  5I43 A;  1QJJ A;  3KMC A;  2E3X A;  1Q3A A;  2OW2 A;  1KUK A;  3TT4 A;  1AKL A;  4I03 A;  1UTT A;  2SRT A;  3DPF A;  4PKQ A;  4GF1 A;  2J83 A;  1JH1 A;  1JAN A;  3G42 A;  2D1O A;  1JAO A;  1I73 A;  1SLN A;  1UMT A;  2OXW A;  4EFS A;  1OS2 A;  3VTG A;  1MNC A;  3I7G A;  3ZUK A;  5I12 A;  1Y93 A;  1GKD A;  2OY4 A;  4PKT A;  1G05 A;  1XFW A;  1L6J A;  1UMS A;  3TVC A;  5I0L A;  2AIG P;  4FU4 A;  1CGE A;  4XM7 A;  3LGP A;  1AYK A;  1QIB A;  3LUM A;  1HFS A;  4WKI A;  4A3W A;  2MZH A;  3Q2H A;  1JKY A;  2W14 A;  1BM6 A;  1GO8 P;  1HY7 A;  1XUR A;  1SMP A;  3DNG A;  3L0T A;  3NX7 A;  1ZXV A;  2RJQ A;  3TSK A;  1CXV A;  4A7B A;  3F1A A;  1IAA A;  5B5O A;  4PKS A;  2DDF A;  4PKU A;  3WV3 A;  1FLS A;  1IAB A;  1GE7 A;  1USN A;  4ILW D;  2K2G A;  1D5J A;  2FV5 A;  3RTT A;  1C8T A;  1JK3 A;  2OY2 A;  3B2Z A;  4JIJ A;  1JAP A;  1SLM A;  4WZV A;  5CZM A;  1CGL A;  5D2B A;  3USN A;  1MMR A;  2YIG A;  3I7I A;  1YP1 A;  4R3V A;  1CGF A;  3O64 A;  1ND1 A;  3OHL A;  2XS4 A;  4HX3 A;  2OW9 A;  4DF9 A;  1ATL A;  1ZXC A;  2POJ A;  4GR0 A;  2ERO A;  1I1I P;  4PKR A;  3DWB A;  5I3M A;  3F16 A;  3U1R A;  3EDZ A;  1B3D A;  2W15 A;  1QUA A;  2O36 A;  2WO8 A;  2DW1 A;  2I47 A;  3RTS A;  2JSD A;  5CUH A;  4HMA A;  1G49 A;  3K7L A;  1R1J A;  1MMB A;  4J4M A;  5D1T A;  2OI0 A;  4AIG A;  3ZVS A;  3B8Z A;  2WO9 A;  1G9K A;  3EDG A;  1ZTQ A;  1BUV M; 
#chains in the Genus database with same CATH topology
 3G5C A;  3KEK A;  1BZS A;  1OS9 A;  2O3E A;  1Y0V A;  1UTZ A;  4DPE A;  3LEA A;  4JPA A;  1OO9 A;  1DTH A;  3K7N A;  2RJP A;  1KUH A;  1RM8 A;  4GQL A;  4H30 A;  5D1U A;  3DSL A;  4GR3 A;  2A8H A;  1BKC A;  3F19 A;  1DMT A;  3HDB A;  2TCL A;  1XUD A;  5L79 A;  1GE6 A;  2W0D A;  3EDH A;  2ERP A;  4H2E A;  3OHO A;  1JIW P;  1ZS0 A;  1IAC A;  1KUI A;  4WK7 A;  1AF0 A;  3CKI A;  4QKZ A;  3AYK A;  5JMY A;  4WKE A;  1R1I A;  4XCT A;  2FV9 A;  1YQY A;  2OXU A;  1BUD A;  4H1Q A;  3N2U A;  4H76 A;  4XBH A;  1CK7 A;  2X7M A;  4XM8 A;  3VI1 A;  1BQO A;  3LJG A;  4GWM A;  2DDY A;  3KEC A;  3O2X A;  3E8R A;  1WNI A;  3LE9 A;  1A86 A;  3LIR A;  2OW0 A;  966C A;  4GR8 A;  1EUB A;  4DD8 A;  1MMP A;  2ERQ A;  4L6T A;  2DW0 A;  1C7K A;  5D1S A;  1CAQ A;  5I2Z A;  2CKI A;  5CXA A;  2OVZ A;  830C A;  3LUN A;  1RMZ A;  2HU6 A;  2J0T A;  4H82 A;  1IAE A;  2OW1 A;  3TS4 A;  5D7W A;  1FBL A;  1ROS A;  4L63 A;  1TVI A;  1IAG A;  4XM6 A;  1A85 A;  1ZP5 A;  2Z2D A;  4IN9 A;  4PKW A;  5B5P A;  3EHX A;  4DV8 A;  1R55 A;  1PWU A;  1K7Q A;  4GUY A;  3MA2 A;  3HB2 P;  3F18 A;  1K7I A;  1R1H A;  3KEJ A;  3EHY A;  3UVC A;  3LQB A;  4FXQ A;  1HFC A;  1JJ9 A;  1O0Q A;  1PWQ A;  3LMC A;  3L0V A;  3KWV C;  1HOV A;  3KRY A;  456C A;  1BKC I;  2MZE A;  2MZI A;  2L0R A;  3DTE A;  4JA1 A;  3F15 A;  5BOT A;  2XS3 A;  2E2D A;  1XUC A;  1HTD A;  3Q2G A;  3LJZ A;  1EB6 A;  1G4K A;  1JIZ A;  4G9L A;  1QJI A;  2K9C A;  5BOY A;  1R54 A;  1QIA A;  3HDA P;  3KHI A;  1J7N A;  1C3I A;  2AYK A;  1GKC A;  1GE5 A;  1KUG A;  1O0T A;  2YB9 A;  2WOA A;  1HV5 A;  3EDI A;  4GWN A;  4Q1L A;  4G0D A;  3GBO A;  1CIZ A;  1JAQ A;  1XFX A;  4AUO A;  3LJT A;  1SRP A;  1I76 A;  3WV1 A;  2X3B A;  5D3C A;  3P1V A;  2JT6 A;  3HBV P;  1Y8J A;  1D7X A;  3LIL A;  3WV2 A;  4ON1 A;  2D1N A;  1BKC E;  3KME A;  4CTH A;  2W13 A;  1K7G A;  1FM1 A;  2OVX A;  1XM5 A;  4PKV A;  5L7F A;  1MMQ A;  4JQG A;  2QPJ A;  2Y6D A;  4I35 A;  4FVL A;  2YUF A;  3N2V A;  4L19 A;  3DL1 A;  3ZXH A;  1AST A;  4FXY P;  1OM7 A;  2X3A A;  3LQ0 A;  1OM6 A;  1XFU A;  4H84 A;  1XFZ A;  1QIC A;  4H49 A;  4JP4 A;  1D8M A;  2KRJ A;  3LKA A;  1IAD A;  3DTI A;  1UEA A;  3V96 B;  1D8F A;  1PWP A;  1GO7 P;  3F17 A;  3B92 A;  4IJO A;  1YCM A;  3SHI A;  1KBC A;  1PWV A;  4ZR5 A;  1ZVX A;  5I4O A;  4AYK A;  2W12 A;  3BA0 A;  2USN A;  1BSW A;  2DW2 A;  1KAP P;  1YOU A;  1OZ9 A;  3DPE A;  1OM8 A;  5LAB A;  1G12 A;  1GXD A;  4H3X A;  1XFV A;  1KUF A;  2MLR A;  2PJT A;  3HYG A;  2Y6C A;  1BIW A;  2JT5 A;  2MLS A;  2N8R A;  3ELM A;  1Z3J A;  3HY7 A;  2CLT A;  2OZR A;  4AXQ A;  1H71 P;  1EAK A;  3LK8 A;  1OMJ A;  2X3C A;  3EWJ A;  4IUW A;  2OXZ A;  1S4B P;  3AYU A;  3HY9 A;  2JIH A;  1XFY A;  5H8X A;  3HBU P;  3P24 A;  4L7A A;  3LIK A;  2JNP A;  1SAT A;  3AIG A;  1CQR A;  1B8Y A;  5BPA A;  1BQQ M;  4WF6 A;  2V4B A;  1SU3 A;  1PWW A;  5I43 A;  1QJJ A;  3KMC A;  2E3X A;  1Q3A A;  2OW2 A;  1KUK A;  3TT4 A;  1AKL A;  4I03 A;  1UTT A;  2SRT A;  3DPF A;  4PKQ A;  4GF1 A;  2J83 A;  1JH1 A;  1JAN A;  3G42 A;  2D1O A;  1JAO A;  1I73 A;  1SLN A;  1UMT A;  2OXW A;  4EFS A;  1OS2 A;  3VTG A;  1MNC A;  3I7G A;  3ZUK A;  5I12 A;  1Y93 A;  1GKD A;  2OY4 A;  4PKT A;  1G05 A;  1XFW A;  1L6J A;  1UMS A;  3TVC A;  5I0L A;  2AIG P;  4FU4 A;  1CGE A;  4XM7 A;  3LGP A;  1AYK A;  1QIB A;  3LUM A;  1HFS A;  4WKI A;  4A3W A;  2MZH A;  3Q2H A;  1JKY A;  2W14 A;  1BM6 A;  1GO8 P;  1HY7 A;  1XUR A;  1SMP A;  3DNG A;  3L0T A;  3NX7 A;  1ZXV A;  2RJQ A;  3TSK A;  1CXV A;  4A7B A;  3F1A A;  1IAA A;  5B5O A;  4PKS A;  2DDF A;  1XAX A;  4PKU A;  3WV3 A;  1FLS A;  1IAB A;  1GE7 A;  1USN A;  4ILW D;  2K2G A;  1D5J A;  2FV5 A;  3RTT A;  1C8T A;  1JK3 A;  2OY2 A;  3B2Z A;  4JIJ A;  1JAP A;  1SLM A;  4WZV A;  5CZM A;  1CGL A;  5D2B A;  3USN A;  1MMR A;  2YIG A;  3I7I A;  1YP1 A;  4R3V A;  1CGF A;  3O64 A;  1ND1 A;  3OHL A;  2XS4 A;  4HX3 A;  2OW9 A;  4DF9 A;  1ATL A;  1ZXC A;  2POJ A;  4GR0 A;  2ERO A;  1I1I P;  4PKR A;  3DWB A;  5I3M A;  3F16 A;  3U1R A;  3EDZ A;  1B3D A;  2W15 A;  1QUA A;  2O36 A;  2WO8 A;  2DW1 A;  2I47 A;  3RTS A;  2JSD A;  5CUH A;  4HMA A;  1G49 A;  3K7L A;  3DTK A;  1R1J A;  1MMB A;  4J4M A;  5D1T A;  2OI0 A;  4AIG A;  3ZVS A;  3B8Z A;  2WO9 A;  1G9K A;  3EDG A;  1ZTQ A;  1BUV M; 
#chains in the Genus database with same CATH homology
 3G5C A;  3KEK A;  1BZS A;  1OS9 A;  2O3E A;  1Y0V A;  1UTZ A;  4DPE A;  3LEA A;  4JPA A;  1OO9 A;  1DTH A;  3K7N A;  2RJP A;  1KUH A;  1RM8 A;  4GQL A;  4H30 A;  5D1U A;  3DSL A;  4GR3 A;  2A8H A;  1BKC A;  3F19 A;  1DMT A;  3HDB A;  2TCL A;  1XUD A;  5L79 A;  1GE6 A;  2W0D A;  3EDH A;  2ERP A;  4H2E A;  3OHO A;  1JIW P;  1ZS0 A;  1IAC A;  1KUI A;  4WK7 A;  1AF0 A;  3CKI A;  4QKZ A;  3AYK A;  5JMY A;  4WKE A;  1R1I A;  4XCT A;  2FV9 A;  1YQY A;  2OXU A;  1BUD A;  4H1Q A;  3N2U A;  4H76 A;  4XBH A;  1CK7 A;  2X7M A;  4XM8 A;  3VI1 A;  1BQO A;  3LJG A;  4GWM A;  2DDY A;  3KEC A;  3O2X A;  3E8R A;  1WNI A;  3LE9 A;  1A86 A;  3LIR A;  2OW0 A;  966C A;  4GR8 A;  1EUB A;  4DD8 A;  1MMP A;  2ERQ A;  4L6T A;  2DW0 A;  1C7K A;  5D1S A;  1CAQ A;  5I2Z A;  2CKI A;  5CXA A;  2OVZ A;  830C A;  3LUN A;  1RMZ A;  2HU6 A;  2J0T A;  4H82 A;  1IAE A;  2OW1 A;  3TS4 A;  5D7W A;  1FBL A;  1ROS A;  4L63 A;  1IAG A;  4XM6 A;  1A85 A;  1ZP5 A;  2Z2D A;  4IN9 A;  4PKW A;  5B5P A;  3EHX A;  4DV8 A;  1R55 A;  1PWU A;  1K7Q A;  4GUY A;  3MA2 A;  3HB2 P;  3F18 A;  1K7I A;  1R1H A;  3KEJ A;  3EHY A;  3UVC A;  3LQB A;  4FXQ A;  1HFC A;  1JJ9 A;  1O0Q A;  1PWQ A;  3LMC A;  3L0V A;  3KWV C;  1HOV A;  3KRY A;  456C A;  1BKC I;  2MZE A;  2MZI A;  2L0R A;  3DTE A;  4JA1 A;  3F15 A;  5BOT A;  2XS3 A;  2E2D A;  1XUC A;  1HTD A;  3Q2G A;  3LJZ A;  1EB6 A;  1G4K A;  1JIZ A;  4G9L A;  1QJI A;  2K9C A;  5BOY A;  1R54 A;  1QIA A;  3HDA P;  3KHI A;  1J7N A;  1C3I A;  2AYK A;  1GKC A;  1GE5 A;  1KUG A;  1O0T A;  2YB9 A;  2WOA A;  1HV5 A;  3EDI A;  4GWN A;  4Q1L A;  4G0D A;  3GBO A;  1CIZ A;  1JAQ A;  1XFX A;  4AUO A;  3LJT A;  1SRP A;  1I76 A;  3WV1 A;  2X3B A;  5D3C A;  3P1V A;  2JT6 A;  3HBV P;  1Y8J A;  1D7X A;  3LIL A;  3WV2 A;  4ON1 A;  2D1N A;  1BKC E;  3KME A;  4CTH A;  2W13 A;  1K7G A;  1FM1 A;  2OVX A;  4PKV A;  5L7F A;  1MMQ A;  4JQG A;  2QPJ A;  2Y6D A;  4I35 A;  4FVL A;  2YUF A;  3N2V A;  4L19 A;  3DL1 A;  3ZXH A;  1AST A;  4FXY P;  1OM7 A;  2X3A A;  3LQ0 A;  1OM6 A;  1XFU A;  4H84 A;  1XFZ A;  1QIC A;  4H49 A;  4JP4 A;  1D8M A;  2KRJ A;  3LKA A;  1IAD A;  3DTI A;  1UEA A;  3V96 B;  1D8F A;  1PWP A;  1GO7 P;  3F17 A;  3B92 A;  4IJO A;  1YCM A;  3SHI A;  1KBC A;  1PWV A;  4ZR5 A;  1ZVX A;  5I4O A;  4AYK A;  2W12 A;  3BA0 A;  2USN A;  1BSW A;  2DW2 A;  1KAP P;  1YOU A;  3DPE A;  1OM8 A;  5LAB A;  1G12 A;  1GXD A;  4H3X A;  1XFV A;  1KUF A;  2MLR A;  2PJT A;  3HYG A;  2Y6C A;  1BIW A;  2JT5 A;  2MLS A;  2N8R A;  3ELM A;  1Z3J A;  3HY7 A;  2CLT A;  2OZR A;  4AXQ A;  1H71 P;  1EAK A;  3LK8 A;  1OMJ A;  2X3C A;  3EWJ A;  4IUW A;  2OXZ A;  1S4B P;  3AYU A;  3HY9 A;  2JIH A;  1XFY A;  5H8X A;  3HBU P;  3P24 A;  4L7A A;  3LIK A;  2JNP A;  1SAT A;  3AIG A;  1CQR A;  1B8Y A;  5BPA A;  1BQQ M;  4WF6 A;  2V4B A;  1SU3 A;  1PWW A;  5I43 A;  1QJJ A;  3KMC A;  2E3X A;  1Q3A A;  2OW2 A;  1KUK A;  3TT4 A;  1AKL A;  4I03 A;  1UTT A;  2SRT A;  3DPF A;  4PKQ A;  4GF1 A;  2J83 A;  1JH1 A;  1JAN A;  3G42 A;  2D1O A;  1JAO A;  1I73 A;  1SLN A;  1UMT A;  2OXW A;  4EFS A;  1OS2 A;  3VTG A;  1MNC A;  3I7G A;  3ZUK A;  5I12 A;  1Y93 A;  1GKD A;  2OY4 A;  4PKT A;  1G05 A;  1XFW A;  1L6J A;  1UMS A;  3TVC A;  5I0L A;  2AIG P;  4FU4 A;  1CGE A;  4XM7 A;  3LGP A;  1AYK A;  1QIB A;  3LUM A;  1HFS A;  4WKI A;  4A3W A;  2MZH A;  3Q2H A;  1JKY A;  2W14 A;  1BM6 A;  1GO8 P;  1HY7 A;  1XUR A;  1SMP A;  3DNG A;  3L0T A;  3NX7 A;  1ZXV A;  2RJQ A;  3TSK A;  1CXV A;  4A7B A;  3F1A A;  1IAA A;  5B5O A;  4PKS A;  2DDF A;  4PKU A;  3WV3 A;  1FLS A;  1IAB A;  1GE7 A;  1USN A;  4ILW D;  2K2G A;  1D5J A;  2FV5 A;  3RTT A;  1C8T A;  1JK3 A;  2OY2 A;  3B2Z A;  4JIJ A;  1JAP A;  1SLM A;  4WZV A;  5CZM A;  1CGL A;  5D2B A;  3USN A;  1MMR A;  2YIG A;  3I7I A;  1YP1 A;  4R3V A;  1CGF A;  3O64 A;  1ND1 A;  3OHL A;  2XS4 A;  4HX3 A;  2OW9 A;  4DF9 A;  1ATL A;  1ZXC A;  2POJ A;  4GR0 A;  2ERO A;  1I1I P;  4PKR A;  3DWB A;  5I3M A;  3F16 A;  3U1R A;  3EDZ A;  1B3D A;  2W15 A;  1QUA A;  2O36 A;  2WO8 A;  2DW1 A;  2I47 A;  3RTS A;  2JSD A;  5CUH A;  4HMA A;  1G49 A;  3K7L A;  3DTK A;  1R1J A;  1MMB A;  4J4M A;  5D1T A;  2OI0 A;  4AIG A;  3ZVS A;  3B8Z A;  2WO9 A;  1G9K A;  3EDG A;  1ZTQ A;  1BUV M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...