1IADA

Refined 1.8 angstroms x-ray crystal structure of astacin, a zinc-endopeptidase from the crayfish astacus astacus l. structure determination, refinement, molecular structure and comparison to thermolysin
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
AAILGDEYLWSGGVIPYTFAGVSGADQSAILSGMQELEEKTCIRFVPRTTESDYVEIFTSGSGCWSYVGRISGAQQVSLQANGCVYHGTIIHELMHAIGFYHEHTRMDRDNYVTINYQNVDPSMTSNFDIDTYSRYVGEDYQYYSIMHYGKYSFSIQWGVLETIVPLQNGIDLTDPYDKAHMLQTDANQINNLYTNECSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASTACIN
publication title Refined 1.8 A X-ray crystal structure of astacin, a zinc-endopeptidase from the crayfish Astacus astacus L. Structure determination, refinement, molecular structure and comparison with thermolysin.
pubmed doi rcsb
source organism Astacus astacus
molecule tags Zinc endopeptidase
total genus 64
structure length 200
sequence length 200
ec nomenclature ec 3.4.24.21: Astacin.
pdb deposition date 1994-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1iadA00
2W13A 4GWNA 3WV1A 1AKLA 1DMTA 1K7GA 2Z2DA 3TT4A 1DTHA 4CTHA 2E3XA 3HDAP 5I0LA 3OHLA 3N2VA 4PKTA 1D8FA 2OW2A 4L6TA 2TCLA 4A3WA 5D2BA 1EUBA 2AYKA 2WO8A 2J0TA 1FLSA 4R3VA 1GXDA 2N8RA 3AYUA 5I3MA 1UTZA 1FBLA 2WOAA 4PKUA 1CIZA 1PWUA 2CLTA 5LABA 3LE9A 3ELMA 1BIWA 4FXYP 1ZP5A 3EHYA 4GWMA 2OVXA 1EAKA 2JIHA 1B3DA 2JT5A 2EROA 2FV5A 1K7IA 4FU4A 3F17A 1JH1A 4AYKA 1D8MA 1BQQM 1RMZA 3Q2HA 3AIGA 2HU6A 1SLMA 2DW0A 4HX3A 1B8YA 1IAEA 1ATLA 4PKRA 1G05A 3SHIA 1XFXA 1WNIA 1Y93A 3EDGA 2JSDA 3LUMA 3VTGA 1XFWA 3LILA 1JANA 3MA2A 1IABA 1S4BP 1AF0A 5D1TA 1HV5A 4DV8A 4A7BA 3DPFA 4FXQA 1I1IP 3ZXHA 1EB6A 2Y6DA 2DDFA 1JAQA 1UMSA 2D1OA 5D3CA 1QJJA 1CGLA 3Q2GA 3E8RA 4XM8A 3DL1A 4GR0A 4XM6A 1KUGA 4H84A 3LIRA 4AUOA 1I76A 1OM6A 4WKEA 1JAOA 3KRYA 4H2EA 1MMPA 2DDYA 3LJGA 1XFUA 5H8XA 1KAPP 3K7NA 456CA 1HOVA 1I73A 4L63A 5D1SA 5B5PA 3G5CA 3F19A 5I43A 2DW2A 1JJ9A 1SMPA 1BUVM 1YQYA 1KUKA 3EDIA 4JA1A 2OXUA 1HTDA 4PKSA 2JNPA 966CA 1BQOA 1KBCA 4JPAA 3HB2P 4JP4A 1H71P 1CGEA 2X3CA 1ASTA 2K2GA 1GO8P 3L0TA 2AIGP 5D7WA 3RTTA 3EWJA 4ZR5A 4GF1A 1OM8A 4H30A 4H49A 1PWPA 1OS9A 1QUAA 1IADA 1MMRA 3DNGA 3KMCA 3LKAA 2L0RA 3RTSA 1BKCA 1HFCA 1SLNA 1YCMA 4H3XA 3EDZA 3KMEA 3P24A 2A8HA 2KRJA 2X3BA 1G12A 1CQRA 3ZVSA 3HDBA 3CKIA 3K7LA 1BUDA 2OZRA 4ON1A 3AYKA 1BSWA 1XFYA 2USNA 4DF9A 2E2DA 4XM7A 1C3IA 3B2ZA 1JIWP 2I47A 3LQ0A 1O0QA 4GR8A 1KUHA 1R1HA 4IJOA 4JIJA 2PJTA 3V96B 2D1NA 3WV2A 2OXZA 3KWVC 3KHIA 1HY7A 4PKQA 3ZUKA 1OM7A 1R54A 3OHOA 3HY7A 3LJTA 1KUFA 1QJIA 2OW0A 1IAAA 1UTTA 3U1RA 3HBVP 2X3AA 3EHXA 1YOUA 2OVZA 3B92A 4I35A 4PKVA 4AIGA 1ROSA 4XBHA 5I4OA 4G0DA 1O0TA 1XURA 2WO9A 2X7MA 4H1QA 1BM6A 2RJPA 5L79A 2JT6A 1MMQA 1MNCA 1PWVA 3KEKA 2K9CA 1L6JA 4H82A 1JK3A 1G4KA 3LIKA 1QICA 1OMJA 1A85A 3BA0A 2OXWA 2MLSA 3B8ZA 1BZSA 1HFSA 4EFSA 1GE6A 2OY4A 1MMBA 2XS4A 1SATA 2V4BA 1AYKA 5CZMA 1XUDA 1A86A 2MLRA 2W12A 1K7QA 4IUWA 1SRPA 1XFZA 3F1AA 5BOYA 3USNA 2OW1A 1JIZA 1UEAA 3TS4A 1D7XA 1CK7A 1GKCA 1UMTA 2ERQA 4WKIA 1GO7P 3TVCA 5BOTA 5I12A 2XS3A 2OY2A 1CAQA 1R1IA 1C8TA 1KUIA 1CXVA 1ZVXA 3L0VA 3I7GA 5CXAA 4GQLA 2W0DA 2MZHA 3DSLA 2OW9A 1QIBA 4Q1LA 1FM1A 5CUHA 2O3EA 1ND1A 4WK7A 5B5OA 1PWQA 3DWBA 3N2UA 4HMAA 1Z3JA 4L19A 5BPAA 3LUNA 3GBOA 5L7FA 3VI1A 1BKCI 4FVLA 1G49A 1BKCE 3LJZA 3DPEA 2Y6CA 5D1UA 2YB9A 4I03A 4XCTA 4DPEA 3F15A 4GR3A 2OI0A 3KECA 3TSKA 3O64A 2O36A 1GKDA 1OS2A 1YP1A 1USNA 1QIAA 1XFVA 4GUYA 1C7KA 4WF6A 1ZXCA 3F16A 1IACA 4J4MA 3LMCA 1GE7A 4JQGA 3HYGA 1RM8A 2ERPA 1JKYA 1ZS0A 3P1VA 1G9KA 4ILWD 4IN9A 1XUCA 1IAGA 1R1JA 5JMYA 3NX7A 2W14A 3LQBA 2RJQA 3G42A 1R55A 2MZIA 4WZVA 1SU3A 2J83A 4G9LA 1ZTQA 3UVCA 3HY9A 1Y8JA 2W15A 2MZEA 4QKZA 4H76A 3KEJA 3LEAA 1D5JA 3F18A 4DD8A 5I2ZA 1OO9A 2POJA 830CA 1JAPA 1CGFA 1Y0VA 3LK8A 3HBUP 1Q3AA 3I7IA 1PWWA 2DW1A 2YIGA 3EDHA 1ZXVA 1GE5A 3WV3A 4PKWA 4AXQA 2FV9A 2QPJA 2SRTA 1J7NA 3LGPA 3O2XA 2CKIA
chains in the Genus database with same CATH superfamily
2W13A 4GWNA 3WV1A 1AKLA 1DMTA 1K7GA 2Z2DA 3TT4A 1DTHA 4CTHA 2E3XA 3HDAP 5I0LA 3OHLA 3N2VA 4PKTA 1D8FA 2OW2A 4L6TA 2TCLA 4A3WA 5D2BA 1EUBA 2AYKA 2WO8A 2J0TA 1FLSA 4R3VA 1GXDA 2N8RA 3AYUA 5I3MA 1UTZA 1FBLA 2WOAA 4PKUA 1CIZA 1PWUA 2CLTA 5LABA 3LE9A 3ELMA 1BIWA 4FXYP 1ZP5A 3EHYA 4GWMA 2OVXA 1EAKA 2JIHA 1B3DA 2JT5A 2EROA 2FV5A 1K7IA 4FU4A 3F17A 1JH1A 4AYKA 1D8MA 1BQQM 1RMZA 3Q2HA 3AIGA 2HU6A 1SLMA 2DW0A 4HX3A 1B8YA 1IAEA 1ATLA 4PKRA 1G05A 3SHIA 1XFXA 1WNIA 1Y93A 3EDGA 2JSDA 3LUMA 3VTGA 1XFWA 3LILA 1JANA 3MA2A 1IABA 1S4BP 1AF0A 5D1TA 1HV5A 4DV8A 4A7BA 3DPFA 4FXQA 1I1IP 3ZXHA 1EB6A 2Y6DA 3DTKA 2DDFA 1JAQA 1UMSA 2D1OA 5D3CA 1QJJA 1CGLA 3Q2GA 3E8RA 4XM8A 3DL1A 4GR0A 4XM6A 1KUGA 4H84A 3LIRA 4AUOA 1I76A 1OM6A 4WKEA 1JAOA 3KRYA 4H2EA 1MMPA 2DDYA 3LJGA 3DTEA 1XFUA 5H8XA 1KAPP 3K7NA 456CA 1HOVA 1I73A 1XM5A 4L63A 5D1SA 5B5PA 3G5CA 3F19A 5I43A 2DW2A 1JJ9A 1SMPA 1BUVM 1YQYA 1KUKA 3EDIA 4JA1A 2OXUA 1HTDA 4PKSA 2JNPA 966CA 1BQOA 1KBCA 4JPAA 3HB2P 4JP4A 1H71P 1CGEA 2X3CA 1ASTA 2K2GA 1GO8P 3L0TA 2AIGP 5D7WA 3RTTA 3EWJA 4ZR5A 4GF1A 4L7AA 1OM8A 4H30A 4H49A 1PWPA 1OS9A 1QUAA 1IADA 1MMRA 3DNGA 3KMCA 3LKAA 2L0RA 3RTSA 1BKCA 1HFCA 1SLNA 1YCMA 4H3XA 3EDZA 2YUFA 3KMEA 3P24A 2A8HA 2KRJA 2X3BA 1G12A 1CQRA 3ZVSA 3HDBA 3CKIA 3K7LA 1BUDA 2OZRA 4ON1A 3AYKA 1BSWA 1XFYA 2USNA 4DF9A 2E2DA 4XM7A 1C3IA 3B2ZA 1JIWP 2I47A 3LQ0A 1O0QA 4GR8A 1KUHA 1R1HA 4IJOA 4JIJA 2PJTA 3V96B 2D1NA 3WV2A 2OXZA 3KWVC 3KHIA 1HY7A 4PKQA 3ZUKA 1OM7A 1R54A 3OHOA 3HY7A 3LJTA 1KUFA 1QJIA 2OW0A 1IAAA 1UTTA 3U1RA 3HBVP 2X3AA 3EHXA 1YOUA 2OVZA 3B92A 4I35A 4PKVA 4AIGA 1ROSA 4XBHA 5I4OA 4G0DA 1O0TA 1XURA 2WO9A 2X7MA 4H1QA 1BM6A 2RJPA 5L79A 2JT6A 1MMQA 1MNCA 1PWVA 3KEKA 2K9CA 1L6JA 4H82A 1JK3A 1G4KA 3LIKA 1QICA 1OMJA 1A85A 3BA0A 2OXWA 2MLSA 3B8ZA 1BZSA 1HFSA 4EFSA 1GE6A 2OY4A 1MMBA 2XS4A 1SATA 2V4BA 1AYKA 5CZMA 1XUDA 1A86A 2MLRA 2W12A 1K7QA 4IUWA 1SRPA 1XFZA 3F1AA 3DTIA 5BOYA 1OZ9A 3USNA 2OW1A 1JIZA 1UEAA 3TS4A 1D7XA 1CK7A 1GKCA 1UMTA 2ERQA 4WKIA 1GO7P 3TVCA 5BOTA 5I12A 2XS3A 2OY2A 1CAQA 1R1IA 1C8TA 1KUIA 1CXVA 1ZVXA 3L0VA 3I7GA 5CXAA 4GQLA 2W0DA 2MZHA 3DSLA 2OW9A 1QIBA 4Q1LA 1FM1A 5CUHA 2O3EA 1ND1A 4WK7A 5B5OA 1PWQA 3DWBA 3N2UA 4HMAA 1Z3JA 4L19A 5BPAA 3LUNA 1XAXA 3GBOA 5L7FA 3VI1A 1BKCI 4FVLA 1G49A 1BKCE 3LJZA 3DPEA 2Y6CA 5D1UA 2YB9A 4I03A 1TVIA 4XCTA 4DPEA 3F15A 4GR3A 2OI0A 3KECA 3TSKA 3O64A 2O36A 1GKDA 1OS2A 1YP1A 1USNA 1QIAA 1XFVA 4GUYA 1C7KA 4WF6A 1ZXCA 3F16A 1IACA 4J4MA 3LMCA 1GE7A 4JQGA 3HYGA 1RM8A 2ERPA 1JKYA 1ZS0A 3P1VA 1G9KA 4ILWD 4IN9A 1XUCA 1IAGA 1R1JA 5JMYA 3NX7A 2W14A 3LQBA 2RJQA 3G42A 1R55A 2MZIA 4WZVA 1SU3A 2J83A 4G9LA 1ZTQA 3UVCA 3HY9A 1Y8JA 2W15A 2MZEA 4QKZA 4H76A 3KEJA 3LEAA 1D5JA 3F18A 4DD8A 5I2ZA 1OO9A 2POJA 830CA 1JAPA 1CGFA 1Y0VA 3LK8A 3HBUP 1Q3AA 3I7IA 1PWWA 2DW1A 2YIGA 3EDHA 1ZXVA 1GE5A 3WV3A 4PKWA 4AXQA 2FV9A 2QPJA 2SRTA 1J7NA 3LGPA 3O2XA 2CKIA
chains in the Genus database with same CATH topology
2W13A 4GWNA 3WV1A 1AKLA 1DMTA 1K7GA 2Z2DA 3TT4A 1DTHA 4CTHA 2E3XA 3HDAP 5I0LA 3OHLA 3N2VA 4PKTA 1D8FA 2OW2A 4L6TA 2TCLA 4A3WA 5D2BA 1EUBA 2AYKA 2WO8A 2J0TA 1FLSA 4R3VA 1GXDA 2N8RA 3AYUA 5I3MA 1UTZA 1FBLA 2WOAA 4PKUA 1CIZA 1PWUA 2CLTA 5LABA 3LE9A 3ELMA 1BIWA 4FXYP 1ZP5A 3EHYA 4GWMA 2OVXA 1EAKA 2JIHA 1B3DA 2JT5A 2EROA 2FV5A 1K7IA 4FU4A 3F17A 1JH1A 4AYKA 1D8MA 1BQQM 1RMZA 3Q2HA 3AIGA 2HU6A 1SLMA 2DW0A 4HX3A 1B8YA 1IAEA 1ATLA 4PKRA 1G05A 3SHIA 1XFXA 1WNIA 1Y93A 3EDGA 2JSDA 3LUMA 3VTGA 1XFWA 3LILA 1JANA 3MA2A 1IABA 1S4BP 1AF0A 5D1TA 1HV5A 4DV8A 4A7BA 3DPFA 4FXQA 1I1IP 3ZXHA 1EB6A 2Y6DA 3DTKA 2DDFA 1JAQA 1UMSA 2D1OA 5D3CA 1QJJA 1CGLA 3Q2GA 3E8RA 4XM8A 3DL1A 4GR0A 4XM6A 1KUGA 4H84A 3LIRA 4AUOA 1I76A 1OM6A 4WKEA 1JAOA 3KRYA 4H2EA 1MMPA 2DDYA 3LJGA 3DTEA 1XFUA 5H8XA 1KAPP 3K7NA 456CA 1HOVA 1I73A 4L63A 5D1SA 5B5PA 3G5CA 3F19A 5I43A 2DW2A 1JJ9A 1SMPA 1BUVM 1YQYA 1KUKA 3EDIA 4JA1A 2OXUA 1HTDA 4PKSA 2JNPA 966CA 1BQOA 1KBCA 4JPAA 3HB2P 4JP4A 1H71P 1CGEA 2X3CA 1ASTA 2K2GA 1GO8P 3L0TA 2AIGP 5D7WA 3RTTA 3EWJA 4ZR5A 4GF1A 4L7AA 1OM8A 4H30A 4H49A 1PWPA 1OS9A 1QUAA 1IADA 1MMRA 3DNGA 3KMCA 3LKAA 2L0RA 3RTSA 1BKCA 1HFCA 1SLNA 1YCMA 4H3XA 3EDZA 2YUFA 3KMEA 3P24A 2A8HA 2KRJA 2X3BA 1G12A 1CQRA 3ZVSA 3HDBA 3CKIA 3K7LA 1BUDA 2OZRA 4ON1A 3AYKA 1BSWA 1XFYA 2USNA 4DF9A 2E2DA 4XM7A 1C3IA 3B2ZA 1JIWP 2I47A 3LQ0A 1O0QA 4GR8A 1KUHA 1R1HA 4IJOA 4JIJA 2PJTA 3V96B 2D1NA 3WV2A 2OXZA 3KWVC 3KHIA 1HY7A 4PKQA 3ZUKA 1OM7A 1R54A 3OHOA 3HY7A 3LJTA 1KUFA 1QJIA 2OW0A 1IAAA 1UTTA 3U1RA 3HBVP 2X3AA 3EHXA 1YOUA 2OVZA 3B92A 4I35A 4PKVA 4AIGA 1ROSA 4XBHA 5I4OA 4G0DA 1O0TA 1XURA 2WO9A 2X7MA 4H1QA 1BM6A 2RJPA 5L79A 2JT6A 1MMQA 1MNCA 1PWVA 3KEKA 2K9CA 1L6JA 4H82A 1JK3A 1G4KA 3LIKA 1QICA 1OMJA 1A85A 3BA0A 2OXWA 2MLSA 3B8ZA 1BZSA 1HFSA 4EFSA 1GE6A 2OY4A 1MMBA 2XS4A 1SATA 2V4BA 1AYKA 5CZMA 1XUDA 1A86A 2MLRA 2W12A 1K7QA 4IUWA 1SRPA 1XFZA 3F1AA 3DTIA 5BOYA 3USNA 2OW1A 1JIZA 1UEAA 3TS4A 1D7XA 1CK7A 1GKCA 1UMTA 2ERQA 4WKIA 1GO7P 3TVCA 5BOTA 5I12A 2XS3A 2OY2A 1CAQA 1R1IA 1C8TA 1KUIA 1CXVA 1ZVXA 3L0VA 3I7GA 5CXAA 4GQLA 2W0DA 2MZHA 3DSLA 2OW9A 1QIBA 4Q1LA 1FM1A 5CUHA 2O3EA 1ND1A 4WK7A 5B5OA 1PWQA 3DWBA 3N2UA 4HMAA 1Z3JA 4L19A 5BPAA 3LUNA 3GBOA 5L7FA 3VI1A 1BKCI 4FVLA 1G49A 1BKCE 3LJZA 3DPEA 2Y6CA 5D1UA 2YB9A 4I03A 4XCTA 4DPEA 3F15A 4GR3A 2OI0A 3KECA 3TSKA 3O64A 2O36A 1GKDA 1OS2A 1YP1A 1USNA 1QIAA 1XFVA 4GUYA 1C7KA 4WF6A 1ZXCA 3F16A 1IACA 4J4MA 3LMCA 1GE7A 4JQGA 3HYGA 1RM8A 2ERPA 1JKYA 1ZS0A 3P1VA 1G9KA 4ILWD 4IN9A 1XUCA 1IAGA 1R1JA 5JMYA 3NX7A 2W14A 3LQBA 2RJQA 3G42A 1R55A 2MZIA 4WZVA 1SU3A 2J83A 4G9LA 1ZTQA 3UVCA 3HY9A 1Y8JA 2W15A 2MZEA 4QKZA 4H76A 3KEJA 3LEAA 1D5JA 3F18A 4DD8A 5I2ZA 1OO9A 2POJA 830CA 1JAPA 1CGFA 1Y0VA 3LK8A 3HBUP 1Q3AA 3I7IA 1PWWA 2DW1A 2YIGA 3EDHA 1ZXVA 1GE5A 3WV3A 4PKWA 4AXQA 2FV9A 2QPJA 2SRTA 1J7NA 3LGPA 3O2XA 2CKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W13 A;  4GWN A;  3WV1 A;  1AKL A;  1DMT A;  1K7G A;  2Z2D A;  3TT4 A;  1DTH A;  4CTH A;  2E3X A;  3HDA P;  5I0L A;  3OHL A;  3N2V A;  4PKT A;  1D8F A;  2OW2 A;  4L6T A;  2TCL A;  4A3W A;  5D2B A;  1EUB A;  2AYK A;  2WO8 A;  2J0T A;  1FLS A;  4R3V A;  1GXD A;  2N8R A;  3AYU A;  5I3M A;  1UTZ A;  1FBL A;  2WOA A;  4PKU A;  1CIZ A;  1PWU A;  2CLT A;  5LAB A;  3LE9 A;  3ELM A;  1BIW A;  4FXY P;  1ZP5 A;  3EHY A;  4GWM A;  2OVX A;  1EAK A;  2JIH A;  1B3D A;  2JT5 A;  2ERO A;  2FV5 A;  1K7I A;  4FU4 A;  3F17 A;  1JH1 A;  4AYK A;  1D8M A;  1BQQ M;  1RMZ A;  3Q2H A;  3AIG A;  2HU6 A;  1SLM A;  2DW0 A;  4HX3 A;  1B8Y A;  1IAE A;  1ATL A;  4PKR A;  1G05 A;  3SHI A;  1XFX A;  1WNI A;  1Y93 A;  3EDG A;  2JSD A;  3LUM A;  3VTG A;  1XFW A;  3LIL A;  1JAN A;  3MA2 A;  1IAB A;  1S4B P;  1AF0 A;  5D1T A;  1HV5 A;  4DV8 A;  4A7B A;  3DPF A;  4FXQ A;  1I1I P;  3ZXH A;  1EB6 A;  2Y6D A;  2DDF A;  1JAQ A;  1UMS A;  2D1O A;  5D3C A;  1QJJ A;  1CGL A;  3Q2G A;  3E8R A;  4XM8 A;  3DL1 A;  4GR0 A;  4XM6 A;  1KUG A;  4H84 A;  3LIR A;  4AUO A;  1I76 A;  1OM6 A;  4WKE A;  1JAO A;  3KRY A;  4H2E A;  1MMP A;  2DDY A;  3LJG A;  1XFU A;  5H8X A;  1KAP P;  3K7N A;  456C A;  1HOV A;  1I73 A;  4L63 A;  5D1S A;  5B5P A;  3G5C A;  3F19 A;  5I43 A;  2DW2 A;  1JJ9 A;  1SMP A;  1BUV M;  1YQY A;  1KUK A;  3EDI A;  4JA1 A;  2OXU A;  1HTD A;  4PKS A;  2JNP A;  966C A;  1BQO A;  1KBC A;  4JPA A;  3HB2 P;  4JP4 A;  1H71 P;  1CGE A;  2X3C A;  1AST A;  2K2G A;  1GO8 P;  3L0T A;  2AIG P;  5D7W A;  3RTT A;  3EWJ A;  4ZR5 A;  4GF1 A;  1OM8 A;  4H30 A;  4H49 A;  1PWP A;  1OS9 A;  1QUA A;  1IAD A;  1MMR A;  3DNG A;  3KMC A;  3LKA A;  2L0R A;  3RTS A;  1BKC A;  1HFC A;  1SLN A;  1YCM A;  4H3X A;  3EDZ A;  3KME A;  3P24 A;  2A8H A;  2KRJ A;  2X3B A;  1G12 A;  1CQR A;  3ZVS A;  3HDB A;  3CKI A;  3K7L A;  1BUD A;  2OZR A;  4ON1 A;  3AYK A;  1BSW A;  1XFY A;  2USN A;  4DF9 A;  2E2D A;  4XM7 A;  1C3I A;  3B2Z A;  1JIW P;  2I47 A;  3LQ0 A;  1O0Q A;  4GR8 A;  1KUH A;  1R1H A;  4IJO A;  4JIJ A;  2PJT A;  3V96 B;  2D1N A;  3WV2 A;  2OXZ A;  3KWV C;  3KHI A;  1HY7 A;  4PKQ A;  3ZUK A;  1OM7 A;  1R54 A;  3OHO A;  3HY7 A;  3LJT A;  1KUF A;  1QJI A;  2OW0 A;  1IAA A;  1UTT A;  3U1R A;  3HBV P;  2X3A A;  3EHX A;  1YOU A;  2OVZ A;  3B92 A;  4I35 A;  4PKV A;  4AIG A;  1ROS A;  4XBH A;  5I4O A;  4G0D A;  1O0T A;  1XUR A;  2WO9 A;  2X7M A;  4H1Q A;  1BM6 A;  2RJP A;  5L79 A;  2JT6 A;  1MMQ A;  1MNC A;  1PWV A;  3KEK A;  2K9C A;  1L6J A;  4H82 A;  1JK3 A;  1G4K A;  3LIK A;  1QIC A;  1OMJ A;  1A85 A;  3BA0 A;  2OXW A;  2MLS A;  3B8Z A;  1BZS A;  1HFS A;  4EFS A;  1GE6 A;  2OY4 A;  1MMB A;  2XS4 A;  1SAT A;  2V4B A;  1AYK A;  5CZM A;  1XUD A;  1A86 A;  2MLR A;  2W12 A;  1K7Q A;  4IUW A;  1SRP A;  1XFZ A;  3F1A A;  5BOY A;  3USN A;  2OW1 A;  1JIZ A;  1UEA A;  3TS4 A;  1D7X A;  1CK7 A;  1GKC A;  1UMT A;  2ERQ A;  4WKI A;  1GO7 P;  3TVC A;  5BOT A;  5I12 A;  2XS3 A;  2OY2 A;  1CAQ A;  1R1I A;  1C8T A;  1KUI A;  1CXV A;  1ZVX A;  3L0V A;  3I7G A;  5CXA A;  4GQL A;  2W0D A;  2MZH A;  3DSL A;  2OW9 A;  1QIB A;  4Q1L A;  1FM1 A;  5CUH A;  2O3E A;  1ND1 A;  4WK7 A;  5B5O A;  1PWQ A;  3DWB A;  3N2U A;  4HMA A;  1Z3J A;  4L19 A;  5BPA A;  3LUN A;  3GBO A;  5L7F A;  3VI1 A;  1BKC I;  4FVL A;  1G49 A;  1BKC E;  3LJZ A;  3DPE A;  2Y6C A;  5D1U A;  2YB9 A;  4I03 A;  4XCT A;  4DPE A;  3F15 A;  4GR3 A;  2OI0 A;  3KEC A;  3TSK A;  3O64 A;  2O36 A;  1GKD A;  1OS2 A;  1YP1 A;  1USN A;  1QIA A;  1XFV A;  4GUY A;  1C7K A;  4WF6 A;  1ZXC A;  3F16 A;  1IAC A;  4J4M A;  3LMC A;  1GE7 A;  4JQG A;  3HYG A;  1RM8 A;  2ERP A;  1JKY A;  1ZS0 A;  3P1V A;  1G9K A;  4ILW D;  4IN9 A;  1XUC A;  1IAG A;  1R1J A;  5JMY A;  3NX7 A;  2W14 A;  3LQB A;  2RJQ A;  3G42 A;  1R55 A;  2MZI A;  4WZV A;  1SU3 A;  2J83 A;  4G9L A;  1ZTQ A;  3UVC A;  3HY9 A;  1Y8J A;  2W15 A;  2MZE A;  4QKZ A;  4H76 A;  3KEJ A;  3LEA A;  1D5J A;  3F18 A;  4DD8 A;  5I2Z A;  1OO9 A;  2POJ A;  830C A;  1JAP A;  1CGF A;  1Y0V A;  3LK8 A;  3HBU P;  1Q3A A;  3I7I A;  1PWW A;  2DW1 A;  2YIG A;  3EDH A;  1ZXV A;  1GE5 A;  3WV3 A;  4PKW A;  4AXQ A;  2FV9 A;  2QPJ A;  2SRT A;  1J7N A;  3LGP A;  3O2X A;  2CKI A; 
#chains in the Genus database with same CATH topology
 2W13 A;  4GWN A;  3WV1 A;  1AKL A;  1DMT A;  1K7G A;  2Z2D A;  3TT4 A;  1DTH A;  4CTH A;  2E3X A;  3HDA P;  5I0L A;  3OHL A;  3N2V A;  4PKT A;  1D8F A;  2OW2 A;  4L6T A;  2TCL A;  4A3W A;  5D2B A;  1EUB A;  2AYK A;  2WO8 A;  2J0T A;  1FLS A;  4R3V A;  1GXD A;  2N8R A;  3AYU A;  5I3M A;  1UTZ A;  1FBL A;  2WOA A;  4PKU A;  1CIZ A;  1PWU A;  2CLT A;  5LAB A;  3LE9 A;  3ELM A;  1BIW A;  4FXY P;  1ZP5 A;  3EHY A;  4GWM A;  2OVX A;  1EAK A;  2JIH A;  1B3D A;  2JT5 A;  2ERO A;  2FV5 A;  1K7I A;  4FU4 A;  3F17 A;  1JH1 A;  4AYK A;  1D8M A;  1BQQ M;  1RMZ A;  3Q2H A;  3AIG A;  2HU6 A;  1SLM A;  2DW0 A;  4HX3 A;  1B8Y A;  1IAE A;  1ATL A;  4PKR A;  1G05 A;  3SHI A;  1XFX A;  1WNI A;  1Y93 A;  3EDG A;  2JSD A;  3LUM A;  3VTG A;  1XFW A;  3LIL A;  1JAN A;  3MA2 A;  1IAB A;  1S4B P;  1AF0 A;  5D1T A;  1HV5 A;  4DV8 A;  4A7B A;  3DPF A;  4FXQ A;  1I1I P;  3ZXH A;  1EB6 A;  2Y6D A;  3DTK A;  2DDF A;  1JAQ A;  1UMS A;  2D1O A;  5D3C A;  1QJJ A;  1CGL A;  3Q2G A;  3E8R A;  4XM8 A;  3DL1 A;  4GR0 A;  4XM6 A;  1KUG A;  4H84 A;  3LIR A;  4AUO A;  1I76 A;  1OM6 A;  4WKE A;  1JAO A;  3KRY A;  4H2E A;  1MMP A;  2DDY A;  3LJG A;  3DTE A;  1XFU A;  5H8X A;  1KAP P;  3K7N A;  456C A;  1HOV A;  1I73 A;  1XM5 A;  4L63 A;  5D1S A;  5B5P A;  3G5C A;  3F19 A;  5I43 A;  2DW2 A;  1JJ9 A;  1SMP A;  1BUV M;  1YQY A;  1KUK A;  3EDI A;  4JA1 A;  2OXU A;  1HTD A;  4PKS A;  2JNP A;  966C A;  1BQO A;  1KBC A;  4JPA A;  3HB2 P;  4JP4 A;  1H71 P;  1CGE A;  2X3C A;  1AST A;  2K2G A;  1GO8 P;  3L0T A;  2AIG P;  5D7W A;  3RTT A;  3EWJ A;  4ZR5 A;  4GF1 A;  4L7A A;  1OM8 A;  4H30 A;  4H49 A;  1PWP A;  1OS9 A;  1QUA A;  1IAD A;  1MMR A;  3DNG A;  3KMC A;  3LKA A;  2L0R A;  3RTS A;  1BKC A;  1HFC A;  1SLN A;  1YCM A;  4H3X A;  3EDZ A;  2YUF A;  3KME A;  3P24 A;  2A8H A;  2KRJ A;  2X3B A;  1G12 A;  1CQR A;  3ZVS A;  3HDB A;  3CKI A;  3K7L A;  1BUD A;  2OZR A;  4ON1 A;  3AYK A;  1BSW A;  1XFY A;  2USN A;  4DF9 A;  2E2D A;  4XM7 A;  1C3I A;  3B2Z A;  1JIW P;  2I47 A;  3LQ0 A;  1O0Q A;  4GR8 A;  1KUH A;  1R1H A;  4IJO A;  4JIJ A;  2PJT A;  3V96 B;  2D1N A;  3WV2 A;  2OXZ A;  3KWV C;  3KHI A;  1HY7 A;  4PKQ A;  3ZUK A;  1OM7 A;  1R54 A;  3OHO A;  3HY7 A;  3LJT A;  1KUF A;  1QJI A;  2OW0 A;  1IAA A;  1UTT A;  3U1R A;  3HBV P;  2X3A A;  3EHX A;  1YOU A;  2OVZ A;  3B92 A;  4I35 A;  4PKV A;  4AIG A;  1ROS A;  4XBH A;  5I4O A;  4G0D A;  1O0T A;  1XUR A;  2WO9 A;  2X7M A;  4H1Q A;  1BM6 A;  2RJP A;  5L79 A;  2JT6 A;  1MMQ A;  1MNC A;  1PWV A;  3KEK A;  2K9C A;  1L6J A;  4H82 A;  1JK3 A;  1G4K A;  3LIK A;  1QIC A;  1OMJ A;  1A85 A;  3BA0 A;  2OXW A;  2MLS A;  3B8Z A;  1BZS A;  1HFS A;  4EFS A;  1GE6 A;  2OY4 A;  1MMB A;  2XS4 A;  1SAT A;  2V4B A;  1AYK A;  5CZM A;  1XUD A;  1A86 A;  2MLR A;  2W12 A;  1K7Q A;  4IUW A;  1SRP A;  1XFZ A;  3F1A A;  3DTI A;  5BOY A;  1OZ9 A;  3USN A;  2OW1 A;  1JIZ A;  1UEA A;  3TS4 A;  1D7X A;  1CK7 A;  1GKC A;  1UMT A;  2ERQ A;  4WKI A;  1GO7 P;  3TVC A;  5BOT A;  5I12 A;  2XS3 A;  2OY2 A;  1CAQ A;  1R1I A;  1C8T A;  1KUI A;  1CXV A;  1ZVX A;  3L0V A;  3I7G A;  5CXA A;  4GQL A;  2W0D A;  2MZH A;  3DSL A;  2OW9 A;  1QIB A;  4Q1L A;  1FM1 A;  5CUH A;  2O3E A;  1ND1 A;  4WK7 A;  5B5O A;  1PWQ A;  3DWB A;  3N2U A;  4HMA A;  1Z3J A;  4L19 A;  5BPA A;  3LUN A;  1XAX A;  3GBO A;  5L7F A;  3VI1 A;  1BKC I;  4FVL A;  1G49 A;  1BKC E;  3LJZ A;  3DPE A;  2Y6C A;  5D1U A;  2YB9 A;  4I03 A;  1TVI A;  4XCT A;  4DPE A;  3F15 A;  4GR3 A;  2OI0 A;  3KEC A;  3TSK A;  3O64 A;  2O36 A;  1GKD A;  1OS2 A;  1YP1 A;  1USN A;  1QIA A;  1XFV A;  4GUY A;  1C7K A;  4WF6 A;  1ZXC A;  3F16 A;  1IAC A;  4J4M A;  3LMC A;  1GE7 A;  4JQG A;  3HYG A;  1RM8 A;  2ERP A;  1JKY A;  1ZS0 A;  3P1V A;  1G9K A;  4ILW D;  4IN9 A;  1XUC A;  1IAG A;  1R1J A;  5JMY A;  3NX7 A;  2W14 A;  3LQB A;  2RJQ A;  3G42 A;  1R55 A;  2MZI A;  4WZV A;  1SU3 A;  2J83 A;  4G9L A;  1ZTQ A;  3UVC A;  3HY9 A;  1Y8J A;  2W15 A;  2MZE A;  4QKZ A;  4H76 A;  3KEJ A;  3LEA A;  1D5J A;  3F18 A;  4DD8 A;  5I2Z A;  1OO9 A;  2POJ A;  830C A;  1JAP A;  1CGF A;  1Y0V A;  3LK8 A;  3HBU P;  1Q3A A;  3I7I A;  1PWW A;  2DW1 A;  2YIG A;  3EDH A;  1ZXV A;  1GE5 A;  3WV3 A;  4PKW A;  4AXQ A;  2FV9 A;  2QPJ A;  2SRT A;  1J7N A;  3LGP A;  3O2X A;  2CKI A; 
#chains in the Genus database with same CATH homology
 2W13 A;  4GWN A;  3WV1 A;  1AKL A;  1DMT A;  1K7G A;  2Z2D A;  3TT4 A;  1DTH A;  4CTH A;  2E3X A;  3HDA P;  5I0L A;  3OHL A;  3N2V A;  4PKT A;  1D8F A;  2OW2 A;  4L6T A;  2TCL A;  4A3W A;  5D2B A;  1EUB A;  2AYK A;  2WO8 A;  2J0T A;  1FLS A;  4R3V A;  1GXD A;  2N8R A;  3AYU A;  5I3M A;  1UTZ A;  1FBL A;  2WOA A;  4PKU A;  1CIZ A;  1PWU A;  2CLT A;  5LAB A;  3LE9 A;  3ELM A;  1BIW A;  4FXY P;  1ZP5 A;  3EHY A;  4GWM A;  2OVX A;  1EAK A;  2JIH A;  1B3D A;  2JT5 A;  2ERO A;  2FV5 A;  1K7I A;  4FU4 A;  3F17 A;  1JH1 A;  4AYK A;  1D8M A;  1BQQ M;  1RMZ A;  3Q2H A;  3AIG A;  2HU6 A;  1SLM A;  2DW0 A;  4HX3 A;  1B8Y A;  1IAE A;  1ATL A;  4PKR A;  1G05 A;  3SHI A;  1XFX A;  1WNI A;  1Y93 A;  3EDG A;  2JSD A;  3LUM A;  3VTG A;  1XFW A;  3LIL A;  1JAN A;  3MA2 A;  1IAB A;  1S4B P;  1AF0 A;  5D1T A;  1HV5 A;  4DV8 A;  4A7B A;  3DPF A;  4FXQ A;  1I1I P;  3ZXH A;  1EB6 A;  2Y6D A;  3DTK A;  2DDF A;  1JAQ A;  1UMS A;  2D1O A;  5D3C A;  1QJJ A;  1CGL A;  3Q2G A;  3E8R A;  4XM8 A;  3DL1 A;  4GR0 A;  4XM6 A;  1KUG A;  4H84 A;  3LIR A;  4AUO A;  1I76 A;  1OM6 A;  4WKE A;  1JAO A;  3KRY A;  4H2E A;  1MMP A;  2DDY A;  3LJG A;  3DTE A;  1XFU A;  5H8X A;  1KAP P;  3K7N A;  456C A;  1HOV A;  1I73 A;  4L63 A;  5D1S A;  5B5P A;  3G5C A;  3F19 A;  5I43 A;  2DW2 A;  1JJ9 A;  1SMP A;  1BUV M;  1YQY A;  1KUK A;  3EDI A;  4JA1 A;  2OXU A;  1HTD A;  4PKS A;  2JNP A;  966C A;  1BQO A;  1KBC A;  4JPA A;  3HB2 P;  4JP4 A;  1H71 P;  1CGE A;  2X3C A;  1AST A;  2K2G A;  1GO8 P;  3L0T A;  2AIG P;  5D7W A;  3RTT A;  3EWJ A;  4ZR5 A;  4GF1 A;  4L7A A;  1OM8 A;  4H30 A;  4H49 A;  1PWP A;  1OS9 A;  1QUA A;  1IAD A;  1MMR A;  3DNG A;  3KMC A;  3LKA A;  2L0R A;  3RTS A;  1BKC A;  1HFC A;  1SLN A;  1YCM A;  4H3X A;  3EDZ A;  2YUF A;  3KME A;  3P24 A;  2A8H A;  2KRJ A;  2X3B A;  1G12 A;  1CQR A;  3ZVS A;  3HDB A;  3CKI A;  3K7L A;  1BUD A;  2OZR A;  4ON1 A;  3AYK A;  1BSW A;  1XFY A;  2USN A;  4DF9 A;  2E2D A;  4XM7 A;  1C3I A;  3B2Z A;  1JIW P;  2I47 A;  3LQ0 A;  1O0Q A;  4GR8 A;  1KUH A;  1R1H A;  4IJO A;  4JIJ A;  2PJT A;  3V96 B;  2D1N A;  3WV2 A;  2OXZ A;  3KWV C;  3KHI A;  1HY7 A;  4PKQ A;  3ZUK A;  1OM7 A;  1R54 A;  3OHO A;  3HY7 A;  3LJT A;  1KUF A;  1QJI A;  2OW0 A;  1IAA A;  1UTT A;  3U1R A;  3HBV P;  2X3A A;  3EHX A;  1YOU A;  2OVZ A;  3B92 A;  4I35 A;  4PKV A;  4AIG A;  1ROS A;  4XBH A;  5I4O A;  4G0D A;  1O0T A;  1XUR A;  2WO9 A;  2X7M A;  4H1Q A;  1BM6 A;  2RJP A;  5L79 A;  2JT6 A;  1MMQ A;  1MNC A;  1PWV A;  3KEK A;  2K9C A;  1L6J A;  4H82 A;  1JK3 A;  1G4K A;  3LIK A;  1QIC A;  1OMJ A;  1A85 A;  3BA0 A;  2OXW A;  2MLS A;  3B8Z A;  1BZS A;  1HFS A;  4EFS A;  1GE6 A;  2OY4 A;  1MMB A;  2XS4 A;  1SAT A;  2V4B A;  1AYK A;  5CZM A;  1XUD A;  1A86 A;  2MLR A;  2W12 A;  1K7Q A;  4IUW A;  1SRP A;  1XFZ A;  3F1A A;  3DTI A;  5BOY A;  3USN A;  2OW1 A;  1JIZ A;  1UEA A;  3TS4 A;  1D7X A;  1CK7 A;  1GKC A;  1UMT A;  2ERQ A;  4WKI A;  1GO7 P;  3TVC A;  5BOT A;  5I12 A;  2XS3 A;  2OY2 A;  1CAQ A;  1R1I A;  1C8T A;  1KUI A;  1CXV A;  1ZVX A;  3L0V A;  3I7G A;  5CXA A;  4GQL A;  2W0D A;  2MZH A;  3DSL A;  2OW9 A;  1QIB A;  4Q1L A;  1FM1 A;  5CUH A;  2O3E A;  1ND1 A;  4WK7 A;  5B5O A;  1PWQ A;  3DWB A;  3N2U A;  4HMA A;  1Z3J A;  4L19 A;  5BPA A;  3LUN A;  3GBO A;  5L7F A;  3VI1 A;  1BKC I;  4FVL A;  1G49 A;  1BKC E;  3LJZ A;  3DPE A;  2Y6C A;  5D1U A;  2YB9 A;  4I03 A;  4XCT A;  4DPE A;  3F15 A;  4GR3 A;  2OI0 A;  3KEC A;  3TSK A;  3O64 A;  2O36 A;  1GKD A;  1OS2 A;  1YP1 A;  1USN A;  1QIA A;  1XFV A;  4GUY A;  1C7K A;  4WF6 A;  1ZXC A;  3F16 A;  1IAC A;  4J4M A;  3LMC A;  1GE7 A;  4JQG A;  3HYG A;  1RM8 A;  2ERP A;  1JKY A;  1ZS0 A;  3P1V A;  1G9K A;  4ILW D;  4IN9 A;  1XUC A;  1IAG A;  1R1J A;  5JMY A;  3NX7 A;  2W14 A;  3LQB A;  2RJQ A;  3G42 A;  1R55 A;  2MZI A;  4WZV A;  1SU3 A;  2J83 A;  4G9L A;  1ZTQ A;  3UVC A;  3HY9 A;  1Y8J A;  2W15 A;  2MZE A;  4QKZ A;  4H76 A;  3KEJ A;  3LEA A;  1D5J A;  3F18 A;  4DD8 A;  5I2Z A;  1OO9 A;  2POJ A;  830C A;  1JAP A;  1CGF A;  1Y0V A;  3LK8 A;  3HBU P;  1Q3A A;  3I7I A;  1PWW A;  2DW1 A;  2YIG A;  3EDH A;  1ZXV A;  1GE5 A;  3WV3 A;  4PKW A;  4AXQ A;  2FV9 A;  2QPJ A;  2SRT A;  1J7N A;  3LGP A;  3O2X A;  2CKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...