3LUMA

Structure of ulilysin mutant m290l
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
262
structure length
262
Chain Sequence
RMEIVKIPVVVHVVWNEEEENISDAQIQSQIDILNKDFRKLNSDVSQVPSVWSNLIADLGIEFFLATKDPNGNQTTGITRTQTSVTFFTTSDEVKFASSGGEDAWPADRYLNIWVCHVLKSEIGQDILGYAQFPGGPAETDGVVIVDAAFGTTGTALPPFDKGRTATHEIGHWLNLYHIWGDELRFEDPCSRSDEVDDTPNQADPNFGCPSYPHVSCSNGPNGDMFMNYLDYVDDKCMVMFTQGQATRVNACLDGPRSSFLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ulilysin
publication title On the relevance of the Met-turn methionine in metzincins.
pubmed doi rcsb
source organism Methanosarcina acetivorans
total genus 87
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2010-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3lumA00
1JK3A 2SRTA 2ERPA 3I7GA 1OM7A 4PKWA 1AF0A 1EAKA 3I7IA 2OXUA 2Z2DA 1R1HA 5JMYA 1UMSA 4IUWA 3E8RA 3LILA 3K7LA 1JAPA 5LABA 2O3EA 1SLMA 1BUVM 1C3IA 1Q3AA 1G05A 3F16A 1EB6A 5BOTA 3AIGA 3TSKA 1JAQA 4L63A 1UEAA 2OVXA 1OM8A 3HY9A 3EHYA 4G0DA 4HX3A 2KRJA 1BM6A 1D8FA 3L0VA 3AYUA 3TS4A 1G4KA 1JH1A 4XM8A 2AIGP 1R54A 4H49A 5D1SA 2OW1A 4Q1LA 1R55A 1CK7A 3F17A 1ASTA 3DSLA 3MA2A 4QKZA 1GO7P 1SATA 4WF6A 4EFSA 1AKLA 5I0LA 1EUBA 1BKCI 2RJPA 3EDZA 3GBOA 3LKAA 4WKEA 3LJZA 2K9CA 2FV9A 5BPAA 3KMCA 4XM7A 1Y93A 1K7IA 3NX7A 2X7MA 3HBVP 1JJ9A 1BIWA 966CA 2AYKA 5H8XA 2MLSA 3HDAP 1XFWA 1XFXA 1G9KA 2WO8A 2JNPA 3BA0A 1Z3JA 5I12A 1KUFA 4XBHA 2O36A 1FM1A 3Q2GA 5I3MA 1XUDA 2W15A 1MMPA 4H76A 3HYGA 1MMBA 1KUIA 1R1IA 3V96B 3LQ0A 4DPEA 2USNA 3SHIA 2V4BA 1YOUA 4CTHA 4PKTA 2OW9A 1K7QA 2DDYA 5D1UA 3TVCA 1YCMA 1IADA 3HDBA 1QIBA 1GO8P 1GKDA 2OI0A 5BOYA 1GE6A 4FU4A 3OHOA 1KBCA 2POJA 1HTDA 1SRPA 2W13A 1JIZA 5I4OA 1DTHA 830CA 3B2ZA 1SU3A 1ZXVA 456CA 3KHIA 1BSWA 3VTGA 1MNCA 3P1VA 2J83A 4WZVA 1D5JA 1H71P 1XUCA 2OVZA 2YB9A 1GKCA 4A7BA 1Y0VA 5CXAA 1BUDA 3EDIA 1OO9A 3F15A 4GR8A 1PWPA 4HMAA 4I03A 2WOAA 3LIKA 2HU6A 1CXVA 3B8ZA 2K2GA 1JANA 3LQBA 1XFVA 2OW0A 3WV2A 1KAPP 1XFUA 3LGPA 1QUAA 1JAOA 4H30A 2OXWA 1OS2A 4FXYP 2DW0A 2X3BA 1BQOA 1C7KA 4GWMA 2MLRA 1USNA 4PKVA 2D1NA 1I73A 3LEAA 1XFZA 4G9LA 3LUNA 1ROSA 4IN9A 4WKIA 1QJIA 1OMJA 1SLNA 1G49A 2E2DA 1OS9A 3WV1A 1HOVA 1R1JA 2QPJA 4H82A 4AXQA 1KUKA 1Y8JA 1G12A 1PWWA 4PKSA 1GE5A 2W12A 4H84A 3DPFA 4XM6A 3LE9A 4DD8A 1L6JA 2Y6DA 4XCTA 1BQQM 1KUHA 1CIZA 2OY4A 5CZMA 1QIAA 4DV8A 1YQYA 3KRYA 2EROA 2XS3A 3F19A 4GQLA 3LMCA 3LUMA 3L0TA 1IABA 3DNGA 2MZHA 1B8YA 3N2UA 3N2VA 3G5CA 2X3AA 1HV5A 3CKIA 4R3VA 2D1OA 1IAEA 3AYKA 4AYKA 1I76A 1FLSA 1BKCA 1FBLA 1B3DA 2I47A 3LK8A 3LIRA 3USNA 1J7NA 1RM8A 2JT6A 3F1AA 3KEJA 1KUGA 1JIWP 1I1IP 1CGEA 1ZTQA 1IAAA 4GWNA 2PJTA 1K7GA 3KECA 1MMQA 3RTTA 4JPAA 1BZSA 3WV3A 3HY7A 4H2EA 4DF9A 4L19A 1O0QA 2TCLA 3KEKA 2X3CA 1PWQA 2W0DA 2A8HA 4A3WA 1O0TA 2JT5A 3O2XA 5L79A 1CGLA 1MMRA 1IACA 4GR3A 1BKCE 4JP4A 3TT4A 1PWUA 4PKUA 1XURA 3LJGA 3KMEA 4J4MA 2FV5A 4PKQA 2OY2A 2N8RA 3ZXHA 1GXDA 1OM6A 3UVCA 2MZIA 3KWVC 1PWVA 3EHXA 3B92A 2L0RA 1DMTA 2JIHA 1ATLA 5D1TA 5D3CA 2DDFA 3HBUP 2DW1A 3RTSA 1HFCA 2OZRA 1YP1A 1RMZA 1S4BP 3Q2HA 3F18A 2J0TA 3EDGA 4ZR5A 4AIGA 1C8TA 4WK7A 5I2ZA 3ZUKA 4ILWD 4JA1A 3LJTA 2ERQA 1ZVXA 2OXZA 2CKIA 3K7NA 2DW2A 4FVLA 1ZXCA 4GUYA 3DL1A 1UTTA 3U1RA 1D7XA 4H3XA 3P24A 1QICA 1UTZA 1WNIA 1GE7A 2OW2A 3VI1A 2MZEA 5CUHA 1A85A 1IAGA 1A86A 3EWJA 3HB2P 4I35A 1ND1A 1CAQA 3DPEA 1CGFA 1CQRA 3OHLA 4L6TA 2CLTA 5D7WA 3DWBA 3EDHA 2WO9A 3ZVSA 4AUOA 1D8MA 3ELMA 1ZP5A 5I43A 5B5PA 2RJQA 2XS4A 5L7FA 1AYKA 4PKRA 5B5OA 5D2BA 1XFYA 2E3XA 4GR0A 1JKYA 2W14A 3O64A 4IJOA 2YIGA 1QJJA 1ZS0A 4GF1A 4ON1A 1SMPA 4JQGA 4FXQA 1HFSA 3G42A 1UMTA 1HY7A 4JIJA 2JSDA 4H1QA 2Y6CA
chains in the Genus database with same CATH superfamily
1JK3A 2SRTA 2ERPA 3I7GA 1OM7A 4PKWA 1AF0A 1EAKA 3I7IA 2OXUA 2Z2DA 1R1HA 5JMYA 1UMSA 4IUWA 3E8RA 3LILA 3K7LA 1JAPA 5LABA 2O3EA 1SLMA 1BUVM 1C3IA 1Q3AA 1G05A 3F16A 1EB6A 5BOTA 3AIGA 3TSKA 1JAQA 4L63A 1UEAA 2OVXA 1OM8A 3HY9A 3EHYA 4G0DA 4HX3A 2KRJA 1BM6A 1D8FA 3L0VA 3AYUA 3TS4A 1XM5A 1G4KA 1JH1A 4XM8A 2AIGP 1R54A 1XAXA 4H49A 5D1SA 2OW1A 4Q1LA 1R55A 3F17A 1CK7A 2YUFA 1ASTA 3DSLA 3MA2A 4QKZA 1GO7P 1SATA 4WF6A 4EFSA 1AKLA 5I0LA 1EUBA 1BKCI 2RJPA 3EDZA 3GBOA 3LKAA 4WKEA 3LJZA 2K9CA 2FV9A 5BPAA 3KMCA 4XM7A 1Y93A 1K7IA 3NX7A 2X7MA 3HBVP 1JJ9A 1BIWA 966CA 2AYKA 5H8XA 2MLSA 3HDAP 1XFWA 1XFXA 1G9KA 2WO8A 2JNPA 3BA0A 1Z3JA 5I12A 1KUFA 4XBHA 2O36A 1FM1A 3Q2GA 5I3MA 1XUDA 2W15A 1MMPA 4H76A 3HYGA 1MMBA 1KUIA 1R1IA 3V96B 3LQ0A 4DPEA 2USNA 3SHIA 2V4BA 1YOUA 4CTHA 4PKTA 2OW9A 1K7QA 4L7AA 2DDYA 5D1UA 3TVCA 1YCMA 1IADA 3HDBA 1QIBA 1GO8P 1GKDA 2OI0A 5BOYA 1GE6A 4FU4A 3OHOA 1KBCA 2POJA 1HTDA 1SRPA 2W13A 1OZ9A 1JIZA 5I4OA 3DTIA 1DTHA 830CA 3B2ZA 1SU3A 1ZXVA 456CA 3KHIA 1BSWA 3VTGA 1MNCA 3P1VA 2J83A 4WZVA 1D5JA 1H71P 1XUCA 2OVZA 2YB9A 1GKCA 4A7BA 1Y0VA 5CXAA 1BUDA 3EDIA 1OO9A 3F15A 4GR8A 1PWPA 4HMAA 4I03A 2WOAA 3LIKA 2HU6A 1CXVA 3B8ZA 2K2GA 1JANA 3LQBA 1XFVA 2OW0A 3WV2A 1KAPP 1XFUA 3LGPA 1QUAA 1JAOA 4H30A 2OXWA 1OS2A 4FXYP 2DW0A 2X3BA 1BQOA 1C7KA 4GWMA 2MLRA 1USNA 4PKVA 2D1NA 1I73A 3LEAA 1XFZA 4G9LA 3LUNA 1ROSA 4IN9A 4WKIA 1QJIA 1OMJA 1SLNA 1G49A 2E2DA 1OS9A 3WV1A 1HOVA 1R1JA 2QPJA 4H82A 4AXQA 1KUKA 1Y8JA 1G12A 1PWWA 4PKSA 1GE5A 2W12A 4H84A 3DPFA 4XM6A 3LE9A 4DD8A 1L6JA 2Y6DA 4XCTA 1BQQM 1KUHA 1CIZA 2OY4A 5CZMA 1QIAA 4DV8A 1YQYA 3KRYA 2EROA 2XS3A 3F19A 4GQLA 3LMCA 3LUMA 3L0TA 1IABA 3DNGA 2MZHA 1B8YA 3N2UA 3N2VA 3G5CA 2X3AA 1HV5A 3CKIA 4R3VA 2D1OA 1IAEA 3AYKA 4AYKA 1I76A 1FLSA 1BKCA 1FBLA 1B3DA 2I47A 3LK8A 3LIRA 3USNA 1J7NA 3F1AA 1RM8A 2JT6A 3DTKA 3KEJA 1KUGA 1JIWP 1I1IP 1CGEA 1ZTQA 1IAAA 4GWNA 2PJTA 1K7GA 3KECA 1MMQA 3RTTA 4JPAA 1BZSA 3WV3A 3HY7A 4H2EA 4DF9A 4L19A 1O0QA 2TCLA 3KEKA 2X3CA 1PWQA 2W0DA 2A8HA 4A3WA 1O0TA 2JT5A 3O2XA 5L79A 1CGLA 1MMRA 1IACA 1TVIA 4GR3A 1BKCE 4JP4A 3TT4A 1PWUA 4PKUA 1XURA 3LJGA 3KMEA 4J4MA 2FV5A 4PKQA 2OY2A 2N8RA 3ZXHA 1GXDA 1OM6A 3UVCA 2MZIA 3KWVC 1PWVA 3EHXA 3B92A 2L0RA 1DMTA 2JIHA 1ATLA 5D1TA 5D3CA 2DDFA 3HBUP 2DW1A 3RTSA 1HFCA 2OZRA 1YP1A 1RMZA 1S4BP 3Q2HA 3F18A 2J0TA 3EDGA 3DTEA 4ZR5A 4AIGA 1C8TA 4WK7A 5I2ZA 3ZUKA 4ILWD 4JA1A 3LJTA 2ERQA 1ZVXA 2OXZA 2CKIA 3K7NA 2DW2A 4FVLA 1ZXCA 4GUYA 3DL1A 1UTTA 3U1RA 1D7XA 4H3XA 3P24A 1QICA 1UTZA 1WNIA 1GE7A 2OW2A 3VI1A 2MZEA 5CUHA 1A85A 1IAGA 1A86A 3EWJA 3HB2P 4I35A 1ND1A 1CAQA 3DPEA 1CGFA 1CQRA 3OHLA 4L6TA 2CLTA 5D7WA 3DWBA 3EDHA 2WO9A 3ZVSA 4AUOA 1D8MA 3ELMA 1ZP5A 5I43A 5B5PA 2RJQA 2XS4A 5L7FA 1AYKA 4PKRA 5B5OA 5D2BA 1XFYA 2E3XA 4GR0A 1JKYA 2W14A 3O64A 4IJOA 2YIGA 1QJJA 1ZS0A 4GF1A 4ON1A 1SMPA 4JQGA 4FXQA 1HFSA 3G42A 1UMTA 1HY7A 4JIJA 2JSDA 4H1QA 2Y6CA
chains in the Genus database with same CATH topology
1JK3A 2SRTA 2ERPA 3I7GA 1OM7A 4PKWA 1AF0A 1EAKA 3I7IA 2OXUA 2Z2DA 1R1HA 5JMYA 1UMSA 4IUWA 3E8RA 3LILA 3K7LA 1JAPA 5LABA 2O3EA 1SLMA 1BUVM 1C3IA 1Q3AA 1G05A 3F16A 1EB6A 5BOTA 3AIGA 3TSKA 1JAQA 4L63A 1UEAA 2OVXA 1OM8A 3HY9A 3EHYA 4G0DA 4HX3A 2KRJA 1BM6A 1D8FA 3L0VA 3AYUA 3TS4A 1G4KA 1JH1A 4XM8A 2AIGP 1R54A 4H49A 5D1SA 2OW1A 4Q1LA 1R55A 3F17A 1CK7A 2YUFA 1ASTA 3DSLA 3MA2A 4QKZA 1GO7P 1SATA 4WF6A 4EFSA 1AKLA 5I0LA 1EUBA 1BKCI 2RJPA 3EDZA 3GBOA 3LKAA 4WKEA 3LJZA 2K9CA 2FV9A 5BPAA 3KMCA 4XM7A 1Y93A 1K7IA 3NX7A 2X7MA 3HBVP 1JJ9A 1BIWA 966CA 2AYKA 5H8XA 2MLSA 3HDAP 1XFWA 1XFXA 1G9KA 2WO8A 2JNPA 3BA0A 1Z3JA 5I12A 1KUFA 4XBHA 2O36A 1FM1A 3Q2GA 5I3MA 1XUDA 2W15A 1MMPA 4H76A 3HYGA 1MMBA 1KUIA 1R1IA 3V96B 3LQ0A 4DPEA 2USNA 3SHIA 2V4BA 1YOUA 4CTHA 4PKTA 2OW9A 1K7QA 4L7AA 2DDYA 5D1UA 3TVCA 1YCMA 1IADA 3HDBA 1QIBA 1GO8P 1GKDA 2OI0A 5BOYA 1GE6A 4FU4A 3OHOA 1KBCA 2POJA 1HTDA 1SRPA 2W13A 1JIZA 5I4OA 3DTIA 1DTHA 830CA 3B2ZA 1SU3A 1ZXVA 456CA 3KHIA 1BSWA 3VTGA 1MNCA 3P1VA 2J83A 4WZVA 1D5JA 1H71P 1XUCA 2OVZA 2YB9A 1GKCA 4A7BA 1Y0VA 5CXAA 1BUDA 3EDIA 1OO9A 3F15A 4GR8A 1PWPA 4HMAA 4I03A 2WOAA 3LIKA 2HU6A 1CXVA 3B8ZA 2K2GA 1JANA 3LQBA 1XFVA 2OW0A 3WV2A 1KAPP 1XFUA 3LGPA 1QUAA 1JAOA 4H30A 2OXWA 1OS2A 4FXYP 2DW0A 2X3BA 1BQOA 1C7KA 4GWMA 2MLRA 1USNA 4PKVA 2D1NA 1I73A 3LEAA 1XFZA 4G9LA 3LUNA 1ROSA 4IN9A 4WKIA 1QJIA 1OMJA 1SLNA 1G49A 2E2DA 1OS9A 3WV1A 1HOVA 1R1JA 2QPJA 4H82A 4AXQA 1KUKA 1Y8JA 1G12A 1PWWA 4PKSA 1GE5A 2W12A 4H84A 3DPFA 4XM6A 3LE9A 4DD8A 1L6JA 2Y6DA 4XCTA 1BQQM 1KUHA 1CIZA 2OY4A 5CZMA 1QIAA 4DV8A 1YQYA 3KRYA 2EROA 2XS3A 3F19A 4GQLA 3LMCA 3LUMA 3L0TA 1IABA 3DNGA 2MZHA 1B8YA 3N2UA 3N2VA 3G5CA 2X3AA 1HV5A 3CKIA 4R3VA 2D1OA 1IAEA 3AYKA 4AYKA 1I76A 1FLSA 1BKCA 1FBLA 1B3DA 2I47A 3LK8A 3LIRA 3USNA 1J7NA 3F1AA 1RM8A 2JT6A 3DTKA 3KEJA 1KUGA 1JIWP 1I1IP 1CGEA 1ZTQA 1IAAA 4GWNA 2PJTA 1K7GA 3KECA 1MMQA 3RTTA 4JPAA 1BZSA 3WV3A 3HY7A 4H2EA 4DF9A 4L19A 1O0QA 2TCLA 3KEKA 2X3CA 1PWQA 2W0DA 2A8HA 4A3WA 1O0TA 2JT5A 3O2XA 5L79A 1CGLA 1MMRA 1IACA 4GR3A 1BKCE 4JP4A 3TT4A 1PWUA 4PKUA 1XURA 3LJGA 3KMEA 4J4MA 2FV5A 4PKQA 2OY2A 2N8RA 3ZXHA 1GXDA 1OM6A 3UVCA 2MZIA 3KWVC 1PWVA 3EHXA 3B92A 2L0RA 1DMTA 2JIHA 1ATLA 5D1TA 5D3CA 2DDFA 3HBUP 2DW1A 3RTSA 1HFCA 2OZRA 1YP1A 1RMZA 1S4BP 3Q2HA 3F18A 2J0TA 3EDGA 3DTEA 4ZR5A 4AIGA 1C8TA 4WK7A 5I2ZA 3ZUKA 4ILWD 4JA1A 3LJTA 2ERQA 1ZVXA 2OXZA 2CKIA 3K7NA 2DW2A 4FVLA 1ZXCA 4GUYA 3DL1A 1UTTA 3U1RA 1D7XA 4H3XA 3P24A 1QICA 1UTZA 1WNIA 1GE7A 2OW2A 3VI1A 2MZEA 5CUHA 1A85A 1IAGA 1A86A 3EWJA 3HB2P 4I35A 1ND1A 1CAQA 3DPEA 1CGFA 1CQRA 3OHLA 4L6TA 2CLTA 5D7WA 3DWBA 3EDHA 2WO9A 3ZVSA 4AUOA 1D8MA 3ELMA 1ZP5A 5I43A 5B5PA 2RJQA 2XS4A 5L7FA 1AYKA 4PKRA 5B5OA 5D2BA 1XFYA 2E3XA 4GR0A 1JKYA 2W14A 3O64A 4IJOA 2YIGA 1QJJA 1ZS0A 4GF1A 4ON1A 1SMPA 4JQGA 4FXQA 1HFSA 3G42A 1UMTA 1HY7A 4JIJA 2JSDA 4H1QA 2Y6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JK3 A;  2SRT A;  2ERP A;  3I7G A;  1OM7 A;  4PKW A;  1AF0 A;  1EAK A;  3I7I A;  2OXU A;  2Z2D A;  1R1H A;  5JMY A;  1UMS A;  4IUW A;  3E8R A;  3LIL A;  3K7L A;  1JAP A;  5LAB A;  2O3E A;  1SLM A;  1BUV M;  1C3I A;  1Q3A A;  1G05 A;  3F16 A;  1EB6 A;  5BOT A;  3AIG A;  3TSK A;  1JAQ A;  4L63 A;  1UEA A;  2OVX A;  1OM8 A;  3HY9 A;  3EHY A;  4G0D A;  4HX3 A;  2KRJ A;  1BM6 A;  1D8F A;  3L0V A;  3AYU A;  3TS4 A;  1G4K A;  1JH1 A;  4XM8 A;  2AIG P;  1R54 A;  4H49 A;  5D1S A;  2OW1 A;  4Q1L A;  1R55 A;  1CK7 A;  3F17 A;  1AST A;  3DSL A;  3MA2 A;  4QKZ A;  1GO7 P;  1SAT A;  4WF6 A;  4EFS A;  1AKL A;  5I0L A;  1EUB A;  1BKC I;  2RJP A;  3EDZ A;  3GBO A;  3LKA A;  4WKE A;  3LJZ A;  2K9C A;  2FV9 A;  5BPA A;  3KMC A;  4XM7 A;  1Y93 A;  1K7I A;  3NX7 A;  2X7M A;  3HBV P;  1JJ9 A;  1BIW A;  966C A;  2AYK A;  5H8X A;  2MLS A;  3HDA P;  1XFW A;  1XFX A;  1G9K A;  2WO8 A;  2JNP A;  3BA0 A;  1Z3J A;  5I12 A;  1KUF A;  4XBH A;  2O36 A;  1FM1 A;  3Q2G A;  5I3M A;  1XUD A;  2W15 A;  1MMP A;  4H76 A;  3HYG A;  1MMB A;  1KUI A;  1R1I A;  3V96 B;  3LQ0 A;  4DPE A;  2USN A;  3SHI A;  2V4B A;  1YOU A;  4CTH A;  4PKT A;  2OW9 A;  1K7Q A;  2DDY A;  5D1U A;  3TVC A;  1YCM A;  1IAD A;  3HDB A;  1QIB A;  1GO8 P;  1GKD A;  2OI0 A;  5BOY A;  1GE6 A;  4FU4 A;  3OHO A;  1KBC A;  2POJ A;  1HTD A;  1SRP A;  2W13 A;  1JIZ A;  5I4O A;  1DTH A;  830C A;  3B2Z A;  1SU3 A;  1ZXV A;  456C A;  3KHI A;  1BSW A;  3VTG A;  1MNC A;  3P1V A;  2J83 A;  4WZV A;  1D5J A;  1H71 P;  1XUC A;  2OVZ A;  2YB9 A;  1GKC A;  4A7B A;  1Y0V A;  5CXA A;  1BUD A;  3EDI A;  1OO9 A;  3F15 A;  4GR8 A;  1PWP A;  4HMA A;  4I03 A;  2WOA A;  3LIK A;  2HU6 A;  1CXV A;  3B8Z A;  2K2G A;  1JAN A;  3LQB A;  1XFV A;  2OW0 A;  3WV2 A;  1KAP P;  1XFU A;  3LGP A;  1QUA A;  1JAO A;  4H30 A;  2OXW A;  1OS2 A;  4FXY P;  2DW0 A;  2X3B A;  1BQO A;  1C7K A;  4GWM A;  2MLR A;  1USN A;  4PKV A;  2D1N A;  1I73 A;  3LEA A;  1XFZ A;  4G9L A;  3LUN A;  1ROS A;  4IN9 A;  4WKI A;  1QJI A;  1OMJ A;  1SLN A;  1G49 A;  2E2D A;  1OS9 A;  3WV1 A;  1HOV A;  1R1J A;  2QPJ A;  4H82 A;  4AXQ A;  1KUK A;  1Y8J A;  1G12 A;  1PWW A;  4PKS A;  1GE5 A;  2W12 A;  4H84 A;  3DPF A;  4XM6 A;  3LE9 A;  4DD8 A;  1L6J A;  2Y6D A;  4XCT A;  1BQQ M;  1KUH A;  1CIZ A;  2OY4 A;  5CZM A;  1QIA A;  4DV8 A;  1YQY A;  3KRY A;  2ERO A;  2XS3 A;  3F19 A;  4GQL A;  3LMC A;  3LUM A;  3L0T A;  1IAB A;  3DNG A;  2MZH A;  1B8Y A;  3N2U A;  3N2V A;  3G5C A;  2X3A A;  1HV5 A;  3CKI A;  4R3V A;  2D1O A;  1IAE A;  3AYK A;  4AYK A;  1I76 A;  1FLS A;  1BKC A;  1FBL A;  1B3D A;  2I47 A;  3LK8 A;  3LIR A;  3USN A;  1J7N A;  1RM8 A;  2JT6 A;  3F1A A;  3KEJ A;  1KUG A;  1JIW P;  1I1I P;  1CGE A;  1ZTQ A;  1IAA A;  4GWN A;  2PJT A;  1K7G A;  3KEC A;  1MMQ A;  3RTT A;  4JPA A;  1BZS A;  3WV3 A;  3HY7 A;  4H2E A;  4DF9 A;  4L19 A;  1O0Q A;  2TCL A;  3KEK A;  2X3C A;  1PWQ A;  2W0D A;  2A8H A;  4A3W A;  1O0T A;  2JT5 A;  3O2X A;  5L79 A;  1CGL A;  1MMR A;  1IAC A;  4GR3 A;  1BKC E;  4JP4 A;  3TT4 A;  1PWU A;  4PKU A;  1XUR A;  3LJG A;  3KME A;  4J4M A;  2FV5 A;  4PKQ A;  2OY2 A;  2N8R A;  3ZXH A;  1GXD A;  1OM6 A;  3UVC A;  2MZI A;  3KWV C;  1PWV A;  3EHX A;  3B92 A;  2L0R A;  1DMT A;  2JIH A;  1ATL A;  5D1T A;  5D3C A;  2DDF A;  3HBU P;  2DW1 A;  3RTS A;  1HFC A;  2OZR A;  1YP1 A;  1RMZ A;  1S4B P;  3Q2H A;  3F18 A;  2J0T A;  3EDG A;  4ZR5 A;  4AIG A;  1C8T A;  4WK7 A;  5I2Z A;  3ZUK A;  4ILW D;  4JA1 A;  3LJT A;  2ERQ A;  1ZVX A;  2OXZ A;  2CKI A;  3K7N A;  2DW2 A;  4FVL A;  1ZXC A;  4GUY A;  3DL1 A;  1UTT A;  3U1R A;  1D7X A;  4H3X A;  3P24 A;  1QIC A;  1UTZ A;  1WNI A;  1GE7 A;  2OW2 A;  3VI1 A;  2MZE A;  5CUH A;  1A85 A;  1IAG A;  1A86 A;  3EWJ A;  3HB2 P;  4I35 A;  1ND1 A;  1CAQ A;  3DPE A;  1CGF A;  1CQR A;  3OHL A;  4L6T A;  2CLT A;  5D7W A;  3DWB A;  3EDH A;  2WO9 A;  3ZVS A;  4AUO A;  1D8M A;  3ELM A;  1ZP5 A;  5I43 A;  5B5P A;  2RJQ A;  2XS4 A;  5L7F A;  1AYK A;  4PKR A;  5B5O A;  5D2B A;  1XFY A;  2E3X A;  4GR0 A;  1JKY A;  2W14 A;  3O64 A;  4IJO A;  2YIG A;  1QJJ A;  1ZS0 A;  4GF1 A;  4ON1 A;  1SMP A;  4JQG A;  4FXQ A;  1HFS A;  3G42 A;  1UMT A;  1HY7 A;  4JIJ A;  2JSD A;  4H1Q A;  2Y6C A; 
#chains in the Genus database with same CATH topology
 1JK3 A;  2SRT A;  2ERP A;  3I7G A;  1OM7 A;  4PKW A;  1AF0 A;  1EAK A;  3I7I A;  2OXU A;  2Z2D A;  1R1H A;  5JMY A;  1UMS A;  4IUW A;  3E8R A;  3LIL A;  3K7L A;  1JAP A;  5LAB A;  2O3E A;  1SLM A;  1BUV M;  1C3I A;  1Q3A A;  1G05 A;  3F16 A;  1EB6 A;  5BOT A;  3AIG A;  3TSK A;  1JAQ A;  4L63 A;  1UEA A;  2OVX A;  1OM8 A;  3HY9 A;  3EHY A;  4G0D A;  4HX3 A;  2KRJ A;  1BM6 A;  1D8F A;  3L0V A;  3AYU A;  3TS4 A;  1XM5 A;  1G4K A;  1JH1 A;  4XM8 A;  2AIG P;  1R54 A;  1XAX A;  4H49 A;  5D1S A;  2OW1 A;  4Q1L A;  1R55 A;  3F17 A;  1CK7 A;  2YUF A;  1AST A;  3DSL A;  3MA2 A;  4QKZ A;  1GO7 P;  1SAT A;  4WF6 A;  4EFS A;  1AKL A;  5I0L A;  1EUB A;  1BKC I;  2RJP A;  3EDZ A;  3GBO A;  3LKA A;  4WKE A;  3LJZ A;  2K9C A;  2FV9 A;  5BPA A;  3KMC A;  4XM7 A;  1Y93 A;  1K7I A;  3NX7 A;  2X7M A;  3HBV P;  1JJ9 A;  1BIW A;  966C A;  2AYK A;  5H8X A;  2MLS A;  3HDA P;  1XFW A;  1XFX A;  1G9K A;  2WO8 A;  2JNP A;  3BA0 A;  1Z3J A;  5I12 A;  1KUF A;  4XBH A;  2O36 A;  1FM1 A;  3Q2G A;  5I3M A;  1XUD A;  2W15 A;  1MMP A;  4H76 A;  3HYG A;  1MMB A;  1KUI A;  1R1I A;  3V96 B;  3LQ0 A;  4DPE A;  2USN A;  3SHI A;  2V4B A;  1YOU A;  4CTH A;  4PKT A;  2OW9 A;  1K7Q A;  4L7A A;  2DDY A;  5D1U A;  3TVC A;  1YCM A;  1IAD A;  3HDB A;  1QIB A;  1GO8 P;  1GKD A;  2OI0 A;  5BOY A;  1GE6 A;  4FU4 A;  3OHO A;  1KBC A;  2POJ A;  1HTD A;  1SRP A;  2W13 A;  1OZ9 A;  1JIZ A;  5I4O A;  3DTI A;  1DTH A;  830C A;  3B2Z A;  1SU3 A;  1ZXV A;  456C A;  3KHI A;  1BSW A;  3VTG A;  1MNC A;  3P1V A;  2J83 A;  4WZV A;  1D5J A;  1H71 P;  1XUC A;  2OVZ A;  2YB9 A;  1GKC A;  4A7B A;  1Y0V A;  5CXA A;  1BUD A;  3EDI A;  1OO9 A;  3F15 A;  4GR8 A;  1PWP A;  4HMA A;  4I03 A;  2WOA A;  3LIK A;  2HU6 A;  1CXV A;  3B8Z A;  2K2G A;  1JAN A;  3LQB A;  1XFV A;  2OW0 A;  3WV2 A;  1KAP P;  1XFU A;  3LGP A;  1QUA A;  1JAO A;  4H30 A;  2OXW A;  1OS2 A;  4FXY P;  2DW0 A;  2X3B A;  1BQO A;  1C7K A;  4GWM A;  2MLR A;  1USN A;  4PKV A;  2D1N A;  1I73 A;  3LEA A;  1XFZ A;  4G9L A;  3LUN A;  1ROS A;  4IN9 A;  4WKI A;  1QJI A;  1OMJ A;  1SLN A;  1G49 A;  2E2D A;  1OS9 A;  3WV1 A;  1HOV A;  1R1J A;  2QPJ A;  4H82 A;  4AXQ A;  1KUK A;  1Y8J A;  1G12 A;  1PWW A;  4PKS A;  1GE5 A;  2W12 A;  4H84 A;  3DPF A;  4XM6 A;  3LE9 A;  4DD8 A;  1L6J A;  2Y6D A;  4XCT A;  1BQQ M;  1KUH A;  1CIZ A;  2OY4 A;  5CZM A;  1QIA A;  4DV8 A;  1YQY A;  3KRY A;  2ERO A;  2XS3 A;  3F19 A;  4GQL A;  3LMC A;  3LUM A;  3L0T A;  1IAB A;  3DNG A;  2MZH A;  1B8Y A;  3N2U A;  3N2V A;  3G5C A;  2X3A A;  1HV5 A;  3CKI A;  4R3V A;  2D1O A;  1IAE A;  3AYK A;  4AYK A;  1I76 A;  1FLS A;  1BKC A;  1FBL A;  1B3D A;  2I47 A;  3LK8 A;  3LIR A;  3USN A;  1J7N A;  3F1A A;  1RM8 A;  2JT6 A;  3DTK A;  3KEJ A;  1KUG A;  1JIW P;  1I1I P;  1CGE A;  1ZTQ A;  1IAA A;  4GWN A;  2PJT A;  1K7G A;  3KEC A;  1MMQ A;  3RTT A;  4JPA A;  1BZS A;  3WV3 A;  3HY7 A;  4H2E A;  4DF9 A;  4L19 A;  1O0Q A;  2TCL A;  3KEK A;  2X3C A;  1PWQ A;  2W0D A;  2A8H A;  4A3W A;  1O0T A;  2JT5 A;  3O2X A;  5L79 A;  1CGL A;  1MMR A;  1IAC A;  1TVI A;  4GR3 A;  1BKC E;  4JP4 A;  3TT4 A;  1PWU A;  4PKU A;  1XUR A;  3LJG A;  3KME A;  4J4M A;  2FV5 A;  4PKQ A;  2OY2 A;  2N8R A;  3ZXH A;  1GXD A;  1OM6 A;  3UVC A;  2MZI A;  3KWV C;  1PWV A;  3EHX A;  3B92 A;  2L0R A;  1DMT A;  2JIH A;  1ATL A;  5D1T A;  5D3C A;  2DDF A;  3HBU P;  2DW1 A;  3RTS A;  1HFC A;  2OZR A;  1YP1 A;  1RMZ A;  1S4B P;  3Q2H A;  3F18 A;  2J0T A;  3EDG A;  3DTE A;  4ZR5 A;  4AIG A;  1C8T A;  4WK7 A;  5I2Z A;  3ZUK A;  4ILW D;  4JA1 A;  3LJT A;  2ERQ A;  1ZVX A;  2OXZ A;  2CKI A;  3K7N A;  2DW2 A;  4FVL A;  1ZXC A;  4GUY A;  3DL1 A;  1UTT A;  3U1R A;  1D7X A;  4H3X A;  3P24 A;  1QIC A;  1UTZ A;  1WNI A;  1GE7 A;  2OW2 A;  3VI1 A;  2MZE A;  5CUH A;  1A85 A;  1IAG A;  1A86 A;  3EWJ A;  3HB2 P;  4I35 A;  1ND1 A;  1CAQ A;  3DPE A;  1CGF A;  1CQR A;  3OHL A;  4L6T A;  2CLT A;  5D7W A;  3DWB A;  3EDH A;  2WO9 A;  3ZVS A;  4AUO A;  1D8M A;  3ELM A;  1ZP5 A;  5I43 A;  5B5P A;  2RJQ A;  2XS4 A;  5L7F A;  1AYK A;  4PKR A;  5B5O A;  5D2B A;  1XFY A;  2E3X A;  4GR0 A;  1JKY A;  2W14 A;  3O64 A;  4IJO A;  2YIG A;  1QJJ A;  1ZS0 A;  4GF1 A;  4ON1 A;  1SMP A;  4JQG A;  4FXQ A;  1HFS A;  3G42 A;  1UMT A;  1HY7 A;  4JIJ A;  2JSD A;  4H1Q A;  2Y6C A; 
#chains in the Genus database with same CATH homology
 1JK3 A;  2SRT A;  2ERP A;  3I7G A;  1OM7 A;  4PKW A;  1AF0 A;  1EAK A;  3I7I A;  2OXU A;  2Z2D A;  1R1H A;  5JMY A;  1UMS A;  4IUW A;  3E8R A;  3LIL A;  3K7L A;  1JAP A;  5LAB A;  2O3E A;  1SLM A;  1BUV M;  1C3I A;  1Q3A A;  1G05 A;  3F16 A;  1EB6 A;  5BOT A;  3AIG A;  3TSK A;  1JAQ A;  4L63 A;  1UEA A;  2OVX A;  1OM8 A;  3HY9 A;  3EHY A;  4G0D A;  4HX3 A;  2KRJ A;  1BM6 A;  1D8F A;  3L0V A;  3AYU A;  3TS4 A;  1G4K A;  1JH1 A;  4XM8 A;  2AIG P;  1R54 A;  4H49 A;  5D1S A;  2OW1 A;  4Q1L A;  1R55 A;  3F17 A;  1CK7 A;  2YUF A;  1AST A;  3DSL A;  3MA2 A;  4QKZ A;  1GO7 P;  1SAT A;  4WF6 A;  4EFS A;  1AKL A;  5I0L A;  1EUB A;  1BKC I;  2RJP A;  3EDZ A;  3GBO A;  3LKA A;  4WKE A;  3LJZ A;  2K9C A;  2FV9 A;  5BPA A;  3KMC A;  4XM7 A;  1Y93 A;  1K7I A;  3NX7 A;  2X7M A;  3HBV P;  1JJ9 A;  1BIW A;  966C A;  2AYK A;  5H8X A;  2MLS A;  3HDA P;  1XFW A;  1XFX A;  1G9K A;  2WO8 A;  2JNP A;  3BA0 A;  1Z3J A;  5I12 A;  1KUF A;  4XBH A;  2O36 A;  1FM1 A;  3Q2G A;  5I3M A;  1XUD A;  2W15 A;  1MMP A;  4H76 A;  3HYG A;  1MMB A;  1KUI A;  1R1I A;  3V96 B;  3LQ0 A;  4DPE A;  2USN A;  3SHI A;  2V4B A;  1YOU A;  4CTH A;  4PKT A;  2OW9 A;  1K7Q A;  4L7A A;  2DDY A;  5D1U A;  3TVC A;  1YCM A;  1IAD A;  3HDB A;  1QIB A;  1GO8 P;  1GKD A;  2OI0 A;  5BOY A;  1GE6 A;  4FU4 A;  3OHO A;  1KBC A;  2POJ A;  1HTD A;  1SRP A;  2W13 A;  1JIZ A;  5I4O A;  3DTI A;  1DTH A;  830C A;  3B2Z A;  1SU3 A;  1ZXV A;  456C A;  3KHI A;  1BSW A;  3VTG A;  1MNC A;  3P1V A;  2J83 A;  4WZV A;  1D5J A;  1H71 P;  1XUC A;  2OVZ A;  2YB9 A;  1GKC A;  4A7B A;  1Y0V A;  5CXA A;  1BUD A;  3EDI A;  1OO9 A;  3F15 A;  4GR8 A;  1PWP A;  4HMA A;  4I03 A;  2WOA A;  3LIK A;  2HU6 A;  1CXV A;  3B8Z A;  2K2G A;  1JAN A;  3LQB A;  1XFV A;  2OW0 A;  3WV2 A;  1KAP P;  1XFU A;  3LGP A;  1QUA A;  1JAO A;  4H30 A;  2OXW A;  1OS2 A;  4FXY P;  2DW0 A;  2X3B A;  1BQO A;  1C7K A;  4GWM A;  2MLR A;  1USN A;  4PKV A;  2D1N A;  1I73 A;  3LEA A;  1XFZ A;  4G9L A;  3LUN A;  1ROS A;  4IN9 A;  4WKI A;  1QJI A;  1OMJ A;  1SLN A;  1G49 A;  2E2D A;  1OS9 A;  3WV1 A;  1HOV A;  1R1J A;  2QPJ A;  4H82 A;  4AXQ A;  1KUK A;  1Y8J A;  1G12 A;  1PWW A;  4PKS A;  1GE5 A;  2W12 A;  4H84 A;  3DPF A;  4XM6 A;  3LE9 A;  4DD8 A;  1L6J A;  2Y6D A;  4XCT A;  1BQQ M;  1KUH A;  1CIZ A;  2OY4 A;  5CZM A;  1QIA A;  4DV8 A;  1YQY A;  3KRY A;  2ERO A;  2XS3 A;  3F19 A;  4GQL A;  3LMC A;  3LUM A;  3L0T A;  1IAB A;  3DNG A;  2MZH A;  1B8Y A;  3N2U A;  3N2V A;  3G5C A;  2X3A A;  1HV5 A;  3CKI A;  4R3V A;  2D1O A;  1IAE A;  3AYK A;  4AYK A;  1I76 A;  1FLS A;  1BKC A;  1FBL A;  1B3D A;  2I47 A;  3LK8 A;  3LIR A;  3USN A;  1J7N A;  3F1A A;  1RM8 A;  2JT6 A;  3DTK A;  3KEJ A;  1KUG A;  1JIW P;  1I1I P;  1CGE A;  1ZTQ A;  1IAA A;  4GWN A;  2PJT A;  1K7G A;  3KEC A;  1MMQ A;  3RTT A;  4JPA A;  1BZS A;  3WV3 A;  3HY7 A;  4H2E A;  4DF9 A;  4L19 A;  1O0Q A;  2TCL A;  3KEK A;  2X3C A;  1PWQ A;  2W0D A;  2A8H A;  4A3W A;  1O0T A;  2JT5 A;  3O2X A;  5L79 A;  1CGL A;  1MMR A;  1IAC A;  4GR3 A;  1BKC E;  4JP4 A;  3TT4 A;  1PWU A;  4PKU A;  1XUR A;  3LJG A;  3KME A;  4J4M A;  2FV5 A;  4PKQ A;  2OY2 A;  2N8R A;  3ZXH A;  1GXD A;  1OM6 A;  3UVC A;  2MZI A;  3KWV C;  1PWV A;  3EHX A;  3B92 A;  2L0R A;  1DMT A;  2JIH A;  1ATL A;  5D1T A;  5D3C A;  2DDF A;  3HBU P;  2DW1 A;  3RTS A;  1HFC A;  2OZR A;  1YP1 A;  1RMZ A;  1S4B P;  3Q2H A;  3F18 A;  2J0T A;  3EDG A;  3DTE A;  4ZR5 A;  4AIG A;  1C8T A;  4WK7 A;  5I2Z A;  3ZUK A;  4ILW D;  4JA1 A;  3LJT A;  2ERQ A;  1ZVX A;  2OXZ A;  2CKI A;  3K7N A;  2DW2 A;  4FVL A;  1ZXC A;  4GUY A;  3DL1 A;  1UTT A;  3U1R A;  1D7X A;  4H3X A;  3P24 A;  1QIC A;  1UTZ A;  1WNI A;  1GE7 A;  2OW2 A;  3VI1 A;  2MZE A;  5CUH A;  1A85 A;  1IAG A;  1A86 A;  3EWJ A;  3HB2 P;  4I35 A;  1ND1 A;  1CAQ A;  3DPE A;  1CGF A;  1CQR A;  3OHL A;  4L6T A;  2CLT A;  5D7W A;  3DWB A;  3EDH A;  2WO9 A;  3ZVS A;  4AUO A;  1D8M A;  3ELM A;  1ZP5 A;  5I43 A;  5B5P A;  2RJQ A;  2XS4 A;  5L7F A;  1AYK A;  4PKR A;  5B5O A;  5D2B A;  1XFY A;  2E3X A;  4GR0 A;  1JKY A;  2W14 A;  3O64 A;  4IJO A;  2YIG A;  1QJJ A;  1ZS0 A;  4GF1 A;  4ON1 A;  1SMP A;  4JQG A;  4FXQ A;  1HFS A;  3G42 A;  1UMT A;  1HY7 A;  4JIJ A;  2JSD A;  4H1Q A;  2Y6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...