2N8RA

Productive complex between mmp-12 and synthetic triple-helical collagen, revealed through paramagnetic nmr
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
FREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/structural protein
molecule keywords Macrophage metalloelastase
publication title Path to Collagenolysis: COLLAGEN V TRIPLE-HELIX MODEL BOUND PRODUCTIVELY AND IN ENCOUNTERS BY MATRIX METALLOPROTEINASE-12.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 164
sequence length 164
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2015-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2n8rA00
4GQLA 3E8RA 1GO8P 1O0TA 1ZS0A 1CGLA 1FBLA 1BQOA 1JAPA 1GKCA 3Q2HA 1JIZA 2E3XA 2W13A 3EHXA 2MZEA 3HY7A 3OHOA 2D1NA 1C8TA 1Y93A 4ZR5A 2DW2A 4JIJA 3KEKA 2DW0A 2X3AA 1BQQM 4DV8A 3KEJA 4DF9A 2E2DA 1GE5A 3GBOA 1G9KA 2V4BA 2OI0A 1OM6A 1YQYA 2W0DA 3HBUP 1QJIA 5CXAA 2CLTA 2ERPA 1I1IP 3G42A 3P1VA 5I2ZA 4PKTA 1IACA 1YCMA 2OW0A 1CAQA 1PWPA 3WV1A 1S4BP 1JANA 2K2GA 1CXVA 1BZSA 4PKVA 5BOYA 1BUVM 1PWUA 2SRTA 3LUMA 4G0DA 3LILA 2MLSA 4H82A 2W14A 4L63A 3EWJA 3P24A 5BOTA 1KBCA 2OZRA 2I47A 1C7KA 2DDYA 2MZIA 4L6TA 3VI1A 3DL1A 3OHLA 1UTZA 4AXQA 1ZXVA 3L0TA 3L0VA 1OMJA 3KRYA 2POJA 1EUBA 2RJQA 3EDZA 2JNPA 4WF6A 5I12A 5BPAA 5D3CA 830CA 2YIGA 2FV9A 1H71P 4DD8A 5I3MA 4GR0A 4PKUA 1K7QA 1JAQA 1ASTA 1HTDA 5D1SA 2USNA 1GKDA 1ZVXA 4G9LA 4GUYA 2KRJA 1Y8JA 4A3WA 1PWVA 4H2EA 2AIGP 1AKLA 3LIRA 1BKCA 4AYKA 2Y6CA 3F15A 4AIGA 4H76A 1R55A 3KMEA 3I7GA 3LJGA 1R54A 3K7NA 1D8MA 1XFUA 2OVXA 3LQBA 2OXUA 1IAAA 1G05A 1AYKA 1SU3A 3Q2GA 5CZMA 4A7BA 2OXZA 5D1UA 1KUGA 3RTTA 2AYKA 3TS4A 3CKIA 4R3VA 1I73A 1A86A 3LE9A 1QUAA 3ZVSA 2JSDA 1QICA 4FXYP 3EHYA 2OVZA 1OM7A 3UVCA 1G4KA 1MMQA 4AUOA 4IUWA 1GE6A 2W15A 4FVLA 2JT5A 4GR8A 2N8RA 2OXWA 4WKEA 1SMPA 1KUKA 966CA 3ZUKA 1QJJA 1QIAA 2X7MA 1JKYA 1MNCA 1ZXCA 3USNA 456CA 1BUDA 1K7IA 3ZXHA 1BKCI 2ERQA 5I4OA 1GO7P 1SRPA 1OS9A 1I76A 2CKIA 3F18A 5LABA 1DTHA 2XS3A 2JIHA 2JT6A 4H49A 1D7XA 4QKZA 2K9CA 2DDFA 1KUIA 4IN9A 3KWVC 3EDGA 1UEAA 3F1AA 3LGPA 4DPEA 3LIKA 3HYGA 3ELMA 1XURA 1RM8A 2A8HA 1JAOA 4JA1A 1XFZA 4ON1A 3DSLA 1Z3JA 5B5OA 4H3XA 1B3DA 1C3IA 3N2UA 2X3CA 3LJZA 4WK7A 2MZHA 2QPJA 1JH1A 4I35A 3F16A 4XM8A 4I03A 1CIZA 1QIBA 1R1IA 3RTSA 3EDHA 3KECA 4GR3A 2RJPA 1YP1A 3DNGA 2OW1A 1KUFA 1J7NA 1XUCA 1YOUA 1ND1A 5D2BA 3F17A 4GF1A 4XCTA 4Q1LA 1BKCE 3AIGA 3LMCA 2WO9A 2YB9A 2PJTA 5B5PA 5JMYA 1BM6A 4HX3A 2Y6DA 1Q3AA 1USNA 1HY7A 1CQRA 5CUHA 4HMAA 1IABA 3I7IA 3O2XA 2J83A 4CTHA 2TCLA 1KAPP 2DW1A 3B92A 2WO8A 3TT4A 1WNIA 3B8ZA 3LJTA 1D8FA 3KHIA 1CGFA 2D1OA 1O0QA 1HOVA 1RMZA 3V96B 1CK7A 3TSKA 1KUHA 3LKAA 4GWMA 4JP4A 2Z2DA 1ROSA 2O36A 3HDAP 4PKSA 1Y0VA 2FV5A 2HU6A 3MA2A 1UMSA 1A85A 3LQ0A 1MMRA 3B2ZA 3U1RA 4IJOA 5L7FA 1HFSA 1XFYA 1L6JA 4L19A 1K7GA 1CGEA 3DPEA 1D5JA 1FLSA 1R1JA 5L79A 4XBHA 4JPAA 1HFCA 4ILWD 1IAEA 2WOAA 1UTTA 3N2VA 1PWWA 1XFWA 1JIWP 3NX7A 3DPFA 4FU4A 3EDIA 1EAKA 2EROA 1XFXA 2X3BA 1IAGA 1MMPA 1MMBA 3KMCA 4PKQA 3LUNA 1FM1A 1PWQA 5D7WA 2OW9A 4WKIA 3SHIA 3AYUA 1OS2A 3F19A 1XFVA 1R1HA 4EFSA 1EB6A 5D1TA 4PKWA 1SLMA 1AF0A 1ZTQA 3BA0A 3G5CA 2W12A 1JJ9A 1B8YA 4XM7A 3HBVP 3HDBA 4GWNA 5I0LA 3TVCA 1UMTA 3K7LA 2MLRA 1OO9A 1GE7A 3LK8A 1XUDA 2O3EA 1ZP5A 3DWBA 1DMTA 3HB2P 4XM6A 1SLNA 1BSWA 1JK3A 1G49A 4J4MA 4JQGA 4PKRA 1OM8A 3WV2A 2OY4A 4H30A 3AYKA 3LEAA 1BIWA 2L0RA 2OY2A 1HV5A 3HY9A 4FXQA 4H84A 2J0TA 3WV3A 4H1QA 2XS4A 1SATA 1ATLA 5H8XA 3VTGA 1IADA 1GXDA 5I43A 3O64A 4WZVA 1G12A 2OW2A
chains in the Genus database with same CATH superfamily
4GQLA 3E8RA 1GO8P 1O0TA 1ZS0A 1CGLA 1FBLA 1BQOA 1JAPA 1TVIA 1GKCA 3Q2HA 1JIZA 2E3XA 2W13A 3EHXA 2MZEA 3HY7A 3OHOA 2D1NA 1C8TA 1Y93A 4ZR5A 2DW2A 4JIJA 3KEKA 2DW0A 2X3AA 1BQQM 4DV8A 3KEJA 4DF9A 2E2DA 1GE5A 3GBOA 1G9KA 2V4BA 2OI0A 1OM6A 1YQYA 4L7AA 2W0DA 3HBUP 1QJIA 5CXAA 2CLTA 2ERPA 1I1IP 3G42A 3P1VA 5I2ZA 4PKTA 1IACA 1YCMA 2OW0A 1CAQA 1PWPA 3WV1A 1S4BP 1JANA 2K2GA 1CXVA 1BZSA 4PKVA 5BOYA 1BUVM 1PWUA 2SRTA 3LUMA 4G0DA 3LILA 2MLSA 4H82A 2W14A 4L63A 3EWJA 3P24A 3DTEA 5BOTA 1KBCA 2OZRA 2I47A 1C7KA 2DDYA 2MZIA 4L6TA 3VI1A 3DL1A 3OHLA 1UTZA 4AXQA 1ZXVA 3L0TA 3L0VA 1OMJA 3KRYA 2POJA 1EUBA 2RJQA 3EDZA 2JNPA 4WF6A 5I12A 5BPAA 5D3CA 830CA 2YIGA 2YUFA 2FV9A 1H71P 4DD8A 5I3MA 4GR0A 4PKUA 1K7QA 1JAQA 1ASTA 1HTDA 5D1SA 2USNA 1GKDA 1ZVXA 4G9LA 4GUYA 2KRJA 1Y8JA 4A3WA 1PWVA 4H2EA 2AIGP 1AKLA 3LIRA 1BKCA 4AYKA 1OZ9A 2Y6CA 3F15A 4AIGA 4H76A 1R55A 3KMEA 3I7GA 3LJGA 1R54A 3K7NA 1D8MA 1XFUA 2OVXA 3LQBA 2OXUA 1IAAA 1G05A 1AYKA 1SU3A 3Q2GA 5CZMA 4A7BA 2OXZA 5D1UA 1KUGA 3RTTA 2AYKA 3TS4A 3CKIA 4R3VA 1I73A 1A86A 3LE9A 1QUAA 3ZVSA 2JSDA 1QICA 3DTIA 4FXYP 3EHYA 2OVZA 1OM7A 3UVCA 1G4KA 1MMQA 4AUOA 4IUWA 1GE6A 2W15A 4FVLA 2JT5A 4GR8A 2N8RA 2OXWA 4WKEA 1SMPA 1KUKA 966CA 3ZUKA 1QJJA 1QIAA 2X7MA 1JKYA 1MNCA 1ZXCA 3USNA 456CA 1BUDA 1K7IA 3ZXHA 1BKCI 2ERQA 5I4OA 1GO7P 1SRPA 1OS9A 1I76A 2CKIA 3F18A 5LABA 1DTHA 2XS3A 2JIHA 2JT6A 4H49A 1D7XA 4QKZA 2K9CA 2DDFA 1KUIA 4IN9A 3KWVC 3EDGA 1UEAA 3F1AA 3LGPA 4DPEA 3LIKA 3HYGA 3ELMA 1XURA 1RM8A 2A8HA 1JAOA 4JA1A 1XFZA 4ON1A 3DSLA 1Z3JA 5B5OA 4H3XA 1B3DA 1C3IA 3N2UA 2X3CA 3LJZA 4WK7A 2MZHA 2QPJA 1JH1A 4I35A 3F16A 4XM8A 4I03A 1CIZA 1QIBA 1R1IA 3RTSA 3EDHA 3KECA 4GR3A 2RJPA 1YP1A 3DNGA 2OW1A 1KUFA 1J7NA 1XUCA 1YOUA 1ND1A 5D2BA 3F17A 4GF1A 4XCTA 4Q1LA 1BKCE 3AIGA 3LMCA 2WO9A 2YB9A 2PJTA 5B5PA 5JMYA 1BM6A 4HX3A 2Y6DA 1Q3AA 1USNA 1HY7A 1CQRA 5CUHA 4HMAA 1IABA 3I7IA 3O2XA 2J83A 4CTHA 2TCLA 1KAPP 2DW1A 3B92A 2WO8A 3TT4A 1WNIA 3B8ZA 3LJTA 1D8FA 3KHIA 1CGFA 2D1OA 1O0QA 1HOVA 1RMZA 3V96B 1CK7A 3TSKA 1KUHA 3LKAA 4GWMA 4JP4A 2Z2DA 1ROSA 2O36A 3HDAP 4PKSA 1Y0VA 2FV5A 2HU6A 1XM5A 3MA2A 1UMSA 1A85A 3LQ0A 1MMRA 3B2ZA 3U1RA 4IJOA 5L7FA 1HFSA 1XFYA 1L6JA 4L19A 1K7GA 1CGEA 3DPEA 1D5JA 1FLSA 1R1JA 5L79A 4XBHA 4JPAA 1HFCA 4ILWD 1IAEA 2WOAA 1UTTA 3N2VA 1PWWA 1XFWA 1JIWP 3NX7A 3DPFA 4FU4A 3EDIA 1EAKA 2EROA 1XFXA 2X3BA 1IAGA 1MMPA 1MMBA 3KMCA 4PKQA 3LUNA 1FM1A 1PWQA 5D7WA 2OW9A 4WKIA 3SHIA 3AYUA 1OS2A 3F19A 1XFVA 1R1HA 4EFSA 1EB6A 5D1TA 4PKWA 1SLMA 1AF0A 1ZTQA 3BA0A 3G5CA 2W12A 1JJ9A 1B8YA 4XM7A 3HBVP 3HDBA 4GWNA 5I0LA 3TVCA 1UMTA 3K7LA 2MLRA 1OO9A 1GE7A 3LK8A 1XUDA 2O3EA 1ZP5A 3DWBA 3DTKA 1DMTA 3HB2P 4XM6A 1SLNA 1BSWA 1JK3A 1G49A 4J4MA 4JQGA 4PKRA 1OM8A 3WV2A 2OY4A 4H30A 3AYKA 3LEAA 1BIWA 2L0RA 2OY2A 1HV5A 3HY9A 4FXQA 4H84A 2J0TA 3WV3A 4H1QA 2XS4A 1SATA 1ATLA 5H8XA 3VTGA 1IADA 1GXDA 5I43A 1XAXA 3O64A 4WZVA 1G12A 2OW2A
chains in the Genus database with same CATH topology
4GQLA 3E8RA 1GO8P 1O0TA 1ZS0A 1CGLA 1FBLA 1BQOA 1JAPA 1GKCA 3Q2HA 1JIZA 2E3XA 2W13A 3EHXA 2MZEA 3HY7A 3OHOA 2D1NA 1C8TA 1Y93A 4ZR5A 2DW2A 4JIJA 3KEKA 2DW0A 2X3AA 1BQQM 4DV8A 3KEJA 4DF9A 2E2DA 1GE5A 3GBOA 1G9KA 2V4BA 2OI0A 1OM6A 1YQYA 4L7AA 2W0DA 3HBUP 1QJIA 5CXAA 2CLTA 2ERPA 1I1IP 3G42A 3P1VA 5I2ZA 4PKTA 1IACA 1YCMA 2OW0A 1CAQA 1PWPA 3WV1A 1S4BP 1JANA 2K2GA 1CXVA 1BZSA 4PKVA 5BOYA 1BUVM 1PWUA 2SRTA 3LUMA 4G0DA 3LILA 2MLSA 4H82A 2W14A 4L63A 3EWJA 3P24A 3DTEA 5BOTA 1KBCA 2OZRA 2I47A 1C7KA 2DDYA 2MZIA 4L6TA 3VI1A 3DL1A 3OHLA 1UTZA 4AXQA 1ZXVA 3L0TA 3L0VA 1OMJA 3KRYA 2POJA 1EUBA 2RJQA 3EDZA 2JNPA 4WF6A 5I12A 5BPAA 5D3CA 830CA 2YIGA 2YUFA 2FV9A 1H71P 4DD8A 5I3MA 4GR0A 4PKUA 1K7QA 1JAQA 1ASTA 1HTDA 5D1SA 2USNA 1GKDA 1ZVXA 4G9LA 4GUYA 2KRJA 1Y8JA 4A3WA 1PWVA 4H2EA 2AIGP 1AKLA 3LIRA 1BKCA 4AYKA 2Y6CA 3F15A 4AIGA 4H76A 1R55A 3KMEA 3I7GA 3LJGA 1R54A 3K7NA 1D8MA 1XFUA 2OVXA 3LQBA 2OXUA 1IAAA 1G05A 1AYKA 1SU3A 3Q2GA 5CZMA 4A7BA 2OXZA 5D1UA 1KUGA 3RTTA 2AYKA 3TS4A 3CKIA 4R3VA 1I73A 1A86A 3LE9A 1QUAA 3ZVSA 2JSDA 1QICA 3DTIA 4FXYP 3EHYA 2OVZA 1OM7A 3UVCA 1G4KA 1MMQA 4AUOA 4IUWA 1GE6A 2W15A 4FVLA 2JT5A 4GR8A 2N8RA 2OXWA 4WKEA 1SMPA 1KUKA 966CA 3ZUKA 1QJJA 1QIAA 2X7MA 1JKYA 1MNCA 1ZXCA 3USNA 456CA 1BUDA 1K7IA 3ZXHA 1BKCI 2ERQA 5I4OA 1GO7P 1SRPA 1OS9A 1I76A 2CKIA 3F18A 5LABA 1DTHA 2XS3A 2JIHA 2JT6A 4H49A 1D7XA 4QKZA 2K9CA 2DDFA 1KUIA 4IN9A 3KWVC 3EDGA 1UEAA 3F1AA 3LGPA 4DPEA 3LIKA 3HYGA 3ELMA 1XURA 1RM8A 2A8HA 1JAOA 4JA1A 1XFZA 4ON1A 3DSLA 1Z3JA 5B5OA 4H3XA 1B3DA 1C3IA 3N2UA 2X3CA 3LJZA 4WK7A 2MZHA 2QPJA 1JH1A 4I35A 3F16A 4XM8A 4I03A 1CIZA 1QIBA 1R1IA 3RTSA 3EDHA 3KECA 4GR3A 2RJPA 1YP1A 3DNGA 2OW1A 1KUFA 1J7NA 1XUCA 1YOUA 1ND1A 5D2BA 3F17A 4GF1A 4XCTA 4Q1LA 1BKCE 3AIGA 3LMCA 2WO9A 2YB9A 2PJTA 5B5PA 5JMYA 1BM6A 4HX3A 2Y6DA 1Q3AA 1USNA 1HY7A 1CQRA 5CUHA 4HMAA 1IABA 3I7IA 3O2XA 2J83A 4CTHA 2TCLA 1KAPP 2DW1A 3B92A 2WO8A 3TT4A 1WNIA 3B8ZA 3LJTA 1D8FA 3KHIA 1CGFA 2D1OA 1O0QA 1HOVA 1RMZA 3V96B 1CK7A 3TSKA 1KUHA 3LKAA 4GWMA 4JP4A 2Z2DA 1ROSA 2O36A 3HDAP 4PKSA 1Y0VA 2FV5A 2HU6A 3MA2A 1UMSA 1A85A 3LQ0A 1MMRA 3B2ZA 3U1RA 4IJOA 5L7FA 1HFSA 1XFYA 1L6JA 4L19A 1K7GA 1CGEA 3DPEA 1D5JA 1FLSA 1R1JA 5L79A 4XBHA 4JPAA 1HFCA 4ILWD 1IAEA 2WOAA 1UTTA 3N2VA 1PWWA 1XFWA 1JIWP 3NX7A 3DPFA 4FU4A 3EDIA 1EAKA 2EROA 1XFXA 2X3BA 1IAGA 1MMPA 1MMBA 3KMCA 4PKQA 3LUNA 1FM1A 1PWQA 5D7WA 2OW9A 4WKIA 3SHIA 3AYUA 1OS2A 3F19A 1XFVA 1R1HA 4EFSA 1EB6A 5D1TA 4PKWA 1SLMA 1AF0A 1ZTQA 3BA0A 3G5CA 2W12A 1JJ9A 1B8YA 4XM7A 3HBVP 3HDBA 4GWNA 5I0LA 3TVCA 1UMTA 3K7LA 2MLRA 1OO9A 1GE7A 3LK8A 1XUDA 2O3EA 1ZP5A 3DWBA 3DTKA 1DMTA 3HB2P 4XM6A 1SLNA 1BSWA 1JK3A 1G49A 4J4MA 4JQGA 4PKRA 1OM8A 3WV2A 2OY4A 4H30A 3AYKA 3LEAA 1BIWA 2L0RA 2OY2A 1HV5A 3HY9A 4FXQA 4H84A 2J0TA 3WV3A 4H1QA 2XS4A 1SATA 1ATLA 5H8XA 3VTGA 1IADA 1GXDA 5I43A 3O64A 4WZVA 1G12A 2OW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GQL A;  3E8R A;  1GO8 P;  1O0T A;  1ZS0 A;  1CGL A;  1FBL A;  1BQO A;  1JAP A;  1GKC A;  3Q2H A;  1JIZ A;  2E3X A;  2W13 A;  3EHX A;  2MZE A;  3HY7 A;  3OHO A;  2D1N A;  1C8T A;  1Y93 A;  4ZR5 A;  2DW2 A;  4JIJ A;  3KEK A;  2DW0 A;  2X3A A;  1BQQ M;  4DV8 A;  3KEJ A;  4DF9 A;  2E2D A;  1GE5 A;  3GBO A;  1G9K A;  2V4B A;  2OI0 A;  1OM6 A;  1YQY A;  2W0D A;  3HBU P;  1QJI A;  5CXA A;  2CLT A;  2ERP A;  1I1I P;  3G42 A;  3P1V A;  5I2Z A;  4PKT A;  1IAC A;  1YCM A;  2OW0 A;  1CAQ A;  1PWP A;  3WV1 A;  1S4B P;  1JAN A;  2K2G A;  1CXV A;  1BZS A;  4PKV A;  5BOY A;  1BUV M;  1PWU A;  2SRT A;  3LUM A;  4G0D A;  3LIL A;  2MLS A;  4H82 A;  2W14 A;  4L63 A;  3EWJ A;  3P24 A;  5BOT A;  1KBC A;  2OZR A;  2I47 A;  1C7K A;  2DDY A;  2MZI A;  4L6T A;  3VI1 A;  3DL1 A;  3OHL A;  1UTZ A;  4AXQ A;  1ZXV A;  3L0T A;  3L0V A;  1OMJ A;  3KRY A;  2POJ A;  1EUB A;  2RJQ A;  3EDZ A;  2JNP A;  4WF6 A;  5I12 A;  5BPA A;  5D3C A;  830C A;  2YIG A;  2FV9 A;  1H71 P;  4DD8 A;  5I3M A;  4GR0 A;  4PKU A;  1K7Q A;  1JAQ A;  1AST A;  1HTD A;  5D1S A;  2USN A;  1GKD A;  1ZVX A;  4G9L A;  4GUY A;  2KRJ A;  1Y8J A;  4A3W A;  1PWV A;  4H2E A;  2AIG P;  1AKL A;  3LIR A;  1BKC A;  4AYK A;  2Y6C A;  3F15 A;  4AIG A;  4H76 A;  1R55 A;  3KME A;  3I7G A;  3LJG A;  1R54 A;  3K7N A;  1D8M A;  1XFU A;  2OVX A;  3LQB A;  2OXU A;  1IAA A;  1G05 A;  1AYK A;  1SU3 A;  3Q2G A;  5CZM A;  4A7B A;  2OXZ A;  5D1U A;  1KUG A;  3RTT A;  2AYK A;  3TS4 A;  3CKI A;  4R3V A;  1I73 A;  1A86 A;  3LE9 A;  1QUA A;  3ZVS A;  2JSD A;  1QIC A;  4FXY P;  3EHY A;  2OVZ A;  1OM7 A;  3UVC A;  1G4K A;  1MMQ A;  4AUO A;  4IUW A;  1GE6 A;  2W15 A;  4FVL A;  2JT5 A;  4GR8 A;  2N8R A;  2OXW A;  4WKE A;  1SMP A;  1KUK A;  966C A;  3ZUK A;  1QJJ A;  1QIA A;  2X7M A;  1JKY A;  1MNC A;  1ZXC A;  3USN A;  456C A;  1BUD A;  1K7I A;  3ZXH A;  1BKC I;  2ERQ A;  5I4O A;  1GO7 P;  1SRP A;  1OS9 A;  1I76 A;  2CKI A;  3F18 A;  5LAB A;  1DTH A;  2XS3 A;  2JIH A;  2JT6 A;  4H49 A;  1D7X A;  4QKZ A;  2K9C A;  2DDF A;  1KUI A;  4IN9 A;  3KWV C;  3EDG A;  1UEA A;  3F1A A;  3LGP A;  4DPE A;  3LIK A;  3HYG A;  3ELM A;  1XUR A;  1RM8 A;  2A8H A;  1JAO A;  4JA1 A;  1XFZ A;  4ON1 A;  3DSL A;  1Z3J A;  5B5O A;  4H3X A;  1B3D A;  1C3I A;  3N2U A;  2X3C A;  3LJZ A;  4WK7 A;  2MZH A;  2QPJ A;  1JH1 A;  4I35 A;  3F16 A;  4XM8 A;  4I03 A;  1CIZ A;  1QIB A;  1R1I A;  3RTS A;  3EDH A;  3KEC A;  4GR3 A;  2RJP A;  1YP1 A;  3DNG A;  2OW1 A;  1KUF A;  1J7N A;  1XUC A;  1YOU A;  1ND1 A;  5D2B A;  3F17 A;  4GF1 A;  4XCT A;  4Q1L A;  1BKC E;  3AIG A;  3LMC A;  2WO9 A;  2YB9 A;  2PJT A;  5B5P A;  5JMY A;  1BM6 A;  4HX3 A;  2Y6D A;  1Q3A A;  1USN A;  1HY7 A;  1CQR A;  5CUH A;  4HMA A;  1IAB A;  3I7I A;  3O2X A;  2J83 A;  4CTH A;  2TCL A;  1KAP P;  2DW1 A;  3B92 A;  2WO8 A;  3TT4 A;  1WNI A;  3B8Z A;  3LJT A;  1D8F A;  3KHI A;  1CGF A;  2D1O A;  1O0Q A;  1HOV A;  1RMZ A;  3V96 B;  1CK7 A;  3TSK A;  1KUH A;  3LKA A;  4GWM A;  4JP4 A;  2Z2D A;  1ROS A;  2O36 A;  3HDA P;  4PKS A;  1Y0V A;  2FV5 A;  2HU6 A;  3MA2 A;  1UMS A;  1A85 A;  3LQ0 A;  1MMR A;  3B2Z A;  3U1R A;  4IJO A;  5L7F A;  1HFS A;  1XFY A;  1L6J A;  4L19 A;  1K7G A;  1CGE A;  3DPE A;  1D5J A;  1FLS A;  1R1J A;  5L79 A;  4XBH A;  4JPA A;  1HFC A;  4ILW D;  1IAE A;  2WOA A;  1UTT A;  3N2V A;  1PWW A;  1XFW A;  1JIW P;  3NX7 A;  3DPF A;  4FU4 A;  3EDI A;  1EAK A;  2ERO A;  1XFX A;  2X3B A;  1IAG A;  1MMP A;  1MMB A;  3KMC A;  4PKQ A;  3LUN A;  1FM1 A;  1PWQ A;  5D7W A;  2OW9 A;  4WKI A;  3SHI A;  3AYU A;  1OS2 A;  3F19 A;  1XFV A;  1R1H A;  4EFS A;  1EB6 A;  5D1T A;  4PKW A;  1SLM A;  1AF0 A;  1ZTQ A;  3BA0 A;  3G5C A;  2W12 A;  1JJ9 A;  1B8Y A;  4XM7 A;  3HBV P;  3HDB A;  4GWN A;  5I0L A;  3TVC A;  1UMT A;  3K7L A;  2MLR A;  1OO9 A;  1GE7 A;  3LK8 A;  1XUD A;  2O3E A;  1ZP5 A;  3DWB A;  1DMT A;  3HB2 P;  4XM6 A;  1SLN A;  1BSW A;  1JK3 A;  1G49 A;  4J4M A;  4JQG A;  4PKR A;  1OM8 A;  3WV2 A;  2OY4 A;  4H30 A;  3AYK A;  3LEA A;  1BIW A;  2L0R A;  2OY2 A;  1HV5 A;  3HY9 A;  4FXQ A;  4H84 A;  2J0T A;  3WV3 A;  4H1Q A;  2XS4 A;  1SAT A;  1ATL A;  5H8X A;  3VTG A;  1IAD A;  1GXD A;  5I43 A;  3O64 A;  4WZV A;  1G12 A;  2OW2 A; 
#chains in the Genus database with same CATH topology
 4GQL A;  3E8R A;  1GO8 P;  1O0T A;  1ZS0 A;  1CGL A;  1FBL A;  1BQO A;  1JAP A;  1TVI A;  1GKC A;  3Q2H A;  1JIZ A;  2E3X A;  2W13 A;  3EHX A;  2MZE A;  3HY7 A;  3OHO A;  2D1N A;  1C8T A;  1Y93 A;  4ZR5 A;  2DW2 A;  4JIJ A;  3KEK A;  2DW0 A;  2X3A A;  1BQQ M;  4DV8 A;  3KEJ A;  4DF9 A;  2E2D A;  1GE5 A;  3GBO A;  1G9K A;  2V4B A;  2OI0 A;  1OM6 A;  1YQY A;  4L7A A;  2W0D A;  3HBU P;  1QJI A;  5CXA A;  2CLT A;  2ERP A;  1I1I P;  3G42 A;  3P1V A;  5I2Z A;  4PKT A;  1IAC A;  1YCM A;  2OW0 A;  1CAQ A;  1PWP A;  3WV1 A;  1S4B P;  1JAN A;  2K2G A;  1CXV A;  1BZS A;  4PKV A;  5BOY A;  1BUV M;  1PWU A;  2SRT A;  3LUM A;  4G0D A;  3LIL A;  2MLS A;  4H82 A;  2W14 A;  4L63 A;  3EWJ A;  3P24 A;  3DTE A;  5BOT A;  1KBC A;  2OZR A;  2I47 A;  1C7K A;  2DDY A;  2MZI A;  4L6T A;  3VI1 A;  3DL1 A;  3OHL A;  1UTZ A;  4AXQ A;  1ZXV A;  3L0T A;  3L0V A;  1OMJ A;  3KRY A;  2POJ A;  1EUB A;  2RJQ A;  3EDZ A;  2JNP A;  4WF6 A;  5I12 A;  5BPA A;  5D3C A;  830C A;  2YIG A;  2YUF A;  2FV9 A;  1H71 P;  4DD8 A;  5I3M A;  4GR0 A;  4PKU A;  1K7Q A;  1JAQ A;  1AST A;  1HTD A;  5D1S A;  2USN A;  1GKD A;  1ZVX A;  4G9L A;  4GUY A;  2KRJ A;  1Y8J A;  4A3W A;  1PWV A;  4H2E A;  2AIG P;  1AKL A;  3LIR A;  1BKC A;  4AYK A;  1OZ9 A;  2Y6C A;  3F15 A;  4AIG A;  4H76 A;  1R55 A;  3KME A;  3I7G A;  3LJG A;  1R54 A;  3K7N A;  1D8M A;  1XFU A;  2OVX A;  3LQB A;  2OXU A;  1IAA A;  1G05 A;  1AYK A;  1SU3 A;  3Q2G A;  5CZM A;  4A7B A;  2OXZ A;  5D1U A;  1KUG A;  3RTT A;  2AYK A;  3TS4 A;  3CKI A;  4R3V A;  1I73 A;  1A86 A;  3LE9 A;  1QUA A;  3ZVS A;  2JSD A;  1QIC A;  3DTI A;  4FXY P;  3EHY A;  2OVZ A;  1OM7 A;  3UVC A;  1G4K A;  1MMQ A;  4AUO A;  4IUW A;  1GE6 A;  2W15 A;  4FVL A;  2JT5 A;  4GR8 A;  2N8R A;  2OXW A;  4WKE A;  1SMP A;  1KUK A;  966C A;  3ZUK A;  1QJJ A;  1QIA A;  2X7M A;  1JKY A;  1MNC A;  1ZXC A;  3USN A;  456C A;  1BUD A;  1K7I A;  3ZXH A;  1BKC I;  2ERQ A;  5I4O A;  1GO7 P;  1SRP A;  1OS9 A;  1I76 A;  2CKI A;  3F18 A;  5LAB A;  1DTH A;  2XS3 A;  2JIH A;  2JT6 A;  4H49 A;  1D7X A;  4QKZ A;  2K9C A;  2DDF A;  1KUI A;  4IN9 A;  3KWV C;  3EDG A;  1UEA A;  3F1A A;  3LGP A;  4DPE A;  3LIK A;  3HYG A;  3ELM A;  1XUR A;  1RM8 A;  2A8H A;  1JAO A;  4JA1 A;  1XFZ A;  4ON1 A;  3DSL A;  1Z3J A;  5B5O A;  4H3X A;  1B3D A;  1C3I A;  3N2U A;  2X3C A;  3LJZ A;  4WK7 A;  2MZH A;  2QPJ A;  1JH1 A;  4I35 A;  3F16 A;  4XM8 A;  4I03 A;  1CIZ A;  1QIB A;  1R1I A;  3RTS A;  3EDH A;  3KEC A;  4GR3 A;  2RJP A;  1YP1 A;  3DNG A;  2OW1 A;  1KUF A;  1J7N A;  1XUC A;  1YOU A;  1ND1 A;  5D2B A;  3F17 A;  4GF1 A;  4XCT A;  4Q1L A;  1BKC E;  3AIG A;  3LMC A;  2WO9 A;  2YB9 A;  2PJT A;  5B5P A;  5JMY A;  1BM6 A;  4HX3 A;  2Y6D A;  1Q3A A;  1USN A;  1HY7 A;  1CQR A;  5CUH A;  4HMA A;  1IAB A;  3I7I A;  3O2X A;  2J83 A;  4CTH A;  2TCL A;  1KAP P;  2DW1 A;  3B92 A;  2WO8 A;  3TT4 A;  1WNI A;  3B8Z A;  3LJT A;  1D8F A;  3KHI A;  1CGF A;  2D1O A;  1O0Q A;  1HOV A;  1RMZ A;  3V96 B;  1CK7 A;  3TSK A;  1KUH A;  3LKA A;  4GWM A;  4JP4 A;  2Z2D A;  1ROS A;  2O36 A;  3HDA P;  4PKS A;  1Y0V A;  2FV5 A;  2HU6 A;  1XM5 A;  3MA2 A;  1UMS A;  1A85 A;  3LQ0 A;  1MMR A;  3B2Z A;  3U1R A;  4IJO A;  5L7F A;  1HFS A;  1XFY A;  1L6J A;  4L19 A;  1K7G A;  1CGE A;  3DPE A;  1D5J A;  1FLS A;  1R1J A;  5L79 A;  4XBH A;  4JPA A;  1HFC A;  4ILW D;  1IAE A;  2WOA A;  1UTT A;  3N2V A;  1PWW A;  1XFW A;  1JIW P;  3NX7 A;  3DPF A;  4FU4 A;  3EDI A;  1EAK A;  2ERO A;  1XFX A;  2X3B A;  1IAG A;  1MMP A;  1MMB A;  3KMC A;  4PKQ A;  3LUN A;  1FM1 A;  1PWQ A;  5D7W A;  2OW9 A;  4WKI A;  3SHI A;  3AYU A;  1OS2 A;  3F19 A;  1XFV A;  1R1H A;  4EFS A;  1EB6 A;  5D1T A;  4PKW A;  1SLM A;  1AF0 A;  1ZTQ A;  3BA0 A;  3G5C A;  2W12 A;  1JJ9 A;  1B8Y A;  4XM7 A;  3HBV P;  3HDB A;  4GWN A;  5I0L A;  3TVC A;  1UMT A;  3K7L A;  2MLR A;  1OO9 A;  1GE7 A;  3LK8 A;  1XUD A;  2O3E A;  1ZP5 A;  3DWB A;  3DTK A;  1DMT A;  3HB2 P;  4XM6 A;  1SLN A;  1BSW A;  1JK3 A;  1G49 A;  4J4M A;  4JQG A;  4PKR A;  1OM8 A;  3WV2 A;  2OY4 A;  4H30 A;  3AYK A;  3LEA A;  1BIW A;  2L0R A;  2OY2 A;  1HV5 A;  3HY9 A;  4FXQ A;  4H84 A;  2J0T A;  3WV3 A;  4H1Q A;  2XS4 A;  1SAT A;  1ATL A;  5H8X A;  3VTG A;  1IAD A;  1GXD A;  5I43 A;  1XAX A;  3O64 A;  4WZV A;  1G12 A;  2OW2 A; 
#chains in the Genus database with same CATH homology
 4GQL A;  3E8R A;  1GO8 P;  1O0T A;  1ZS0 A;  1CGL A;  1FBL A;  1BQO A;  1JAP A;  1GKC A;  3Q2H A;  1JIZ A;  2E3X A;  2W13 A;  3EHX A;  2MZE A;  3HY7 A;  3OHO A;  2D1N A;  1C8T A;  1Y93 A;  4ZR5 A;  2DW2 A;  4JIJ A;  3KEK A;  2DW0 A;  2X3A A;  1BQQ M;  4DV8 A;  3KEJ A;  4DF9 A;  2E2D A;  1GE5 A;  3GBO A;  1G9K A;  2V4B A;  2OI0 A;  1OM6 A;  1YQY A;  4L7A A;  2W0D A;  3HBU P;  1QJI A;  5CXA A;  2CLT A;  2ERP A;  1I1I P;  3G42 A;  3P1V A;  5I2Z A;  4PKT A;  1IAC A;  1YCM A;  2OW0 A;  1CAQ A;  1PWP A;  3WV1 A;  1S4B P;  1JAN A;  2K2G A;  1CXV A;  1BZS A;  4PKV A;  5BOY A;  1BUV M;  1PWU A;  2SRT A;  3LUM A;  4G0D A;  3LIL A;  2MLS A;  4H82 A;  2W14 A;  4L63 A;  3EWJ A;  3P24 A;  3DTE A;  5BOT A;  1KBC A;  2OZR A;  2I47 A;  1C7K A;  2DDY A;  2MZI A;  4L6T A;  3VI1 A;  3DL1 A;  3OHL A;  1UTZ A;  4AXQ A;  1ZXV A;  3L0T A;  3L0V A;  1OMJ A;  3KRY A;  2POJ A;  1EUB A;  2RJQ A;  3EDZ A;  2JNP A;  4WF6 A;  5I12 A;  5BPA A;  5D3C A;  830C A;  2YIG A;  2YUF A;  2FV9 A;  1H71 P;  4DD8 A;  5I3M A;  4GR0 A;  4PKU A;  1K7Q A;  1JAQ A;  1AST A;  1HTD A;  5D1S A;  2USN A;  1GKD A;  1ZVX A;  4G9L A;  4GUY A;  2KRJ A;  1Y8J A;  4A3W A;  1PWV A;  4H2E A;  2AIG P;  1AKL A;  3LIR A;  1BKC A;  4AYK A;  2Y6C A;  3F15 A;  4AIG A;  4H76 A;  1R55 A;  3KME A;  3I7G A;  3LJG A;  1R54 A;  3K7N A;  1D8M A;  1XFU A;  2OVX A;  3LQB A;  2OXU A;  1IAA A;  1G05 A;  1AYK A;  1SU3 A;  3Q2G A;  5CZM A;  4A7B A;  2OXZ A;  5D1U A;  1KUG A;  3RTT A;  2AYK A;  3TS4 A;  3CKI A;  4R3V A;  1I73 A;  1A86 A;  3LE9 A;  1QUA A;  3ZVS A;  2JSD A;  1QIC A;  3DTI A;  4FXY P;  3EHY A;  2OVZ A;  1OM7 A;  3UVC A;  1G4K A;  1MMQ A;  4AUO A;  4IUW A;  1GE6 A;  2W15 A;  4FVL A;  2JT5 A;  4GR8 A;  2N8R A;  2OXW A;  4WKE A;  1SMP A;  1KUK A;  966C A;  3ZUK A;  1QJJ A;  1QIA A;  2X7M A;  1JKY A;  1MNC A;  1ZXC A;  3USN A;  456C A;  1BUD A;  1K7I A;  3ZXH A;  1BKC I;  2ERQ A;  5I4O A;  1GO7 P;  1SRP A;  1OS9 A;  1I76 A;  2CKI A;  3F18 A;  5LAB A;  1DTH A;  2XS3 A;  2JIH A;  2JT6 A;  4H49 A;  1D7X A;  4QKZ A;  2K9C A;  2DDF A;  1KUI A;  4IN9 A;  3KWV C;  3EDG A;  1UEA A;  3F1A A;  3LGP A;  4DPE A;  3LIK A;  3HYG A;  3ELM A;  1XUR A;  1RM8 A;  2A8H A;  1JAO A;  4JA1 A;  1XFZ A;  4ON1 A;  3DSL A;  1Z3J A;  5B5O A;  4H3X A;  1B3D A;  1C3I A;  3N2U A;  2X3C A;  3LJZ A;  4WK7 A;  2MZH A;  2QPJ A;  1JH1 A;  4I35 A;  3F16 A;  4XM8 A;  4I03 A;  1CIZ A;  1QIB A;  1R1I A;  3RTS A;  3EDH A;  3KEC A;  4GR3 A;  2RJP A;  1YP1 A;  3DNG A;  2OW1 A;  1KUF A;  1J7N A;  1XUC A;  1YOU A;  1ND1 A;  5D2B A;  3F17 A;  4GF1 A;  4XCT A;  4Q1L A;  1BKC E;  3AIG A;  3LMC A;  2WO9 A;  2YB9 A;  2PJT A;  5B5P A;  5JMY A;  1BM6 A;  4HX3 A;  2Y6D A;  1Q3A A;  1USN A;  1HY7 A;  1CQR A;  5CUH A;  4HMA A;  1IAB A;  3I7I A;  3O2X A;  2J83 A;  4CTH A;  2TCL A;  1KAP P;  2DW1 A;  3B92 A;  2WO8 A;  3TT4 A;  1WNI A;  3B8Z A;  3LJT A;  1D8F A;  3KHI A;  1CGF A;  2D1O A;  1O0Q A;  1HOV A;  1RMZ A;  3V96 B;  1CK7 A;  3TSK A;  1KUH A;  3LKA A;  4GWM A;  4JP4 A;  2Z2D A;  1ROS A;  2O36 A;  3HDA P;  4PKS A;  1Y0V A;  2FV5 A;  2HU6 A;  3MA2 A;  1UMS A;  1A85 A;  3LQ0 A;  1MMR A;  3B2Z A;  3U1R A;  4IJO A;  5L7F A;  1HFS A;  1XFY A;  1L6J A;  4L19 A;  1K7G A;  1CGE A;  3DPE A;  1D5J A;  1FLS A;  1R1J A;  5L79 A;  4XBH A;  4JPA A;  1HFC A;  4ILW D;  1IAE A;  2WOA A;  1UTT A;  3N2V A;  1PWW A;  1XFW A;  1JIW P;  3NX7 A;  3DPF A;  4FU4 A;  3EDI A;  1EAK A;  2ERO A;  1XFX A;  2X3B A;  1IAG A;  1MMP A;  1MMB A;  3KMC A;  4PKQ A;  3LUN A;  1FM1 A;  1PWQ A;  5D7W A;  2OW9 A;  4WKI A;  3SHI A;  3AYU A;  1OS2 A;  3F19 A;  1XFV A;  1R1H A;  4EFS A;  1EB6 A;  5D1T A;  4PKW A;  1SLM A;  1AF0 A;  1ZTQ A;  3BA0 A;  3G5C A;  2W12 A;  1JJ9 A;  1B8Y A;  4XM7 A;  3HBV P;  3HDB A;  4GWN A;  5I0L A;  3TVC A;  1UMT A;  3K7L A;  2MLR A;  1OO9 A;  1GE7 A;  3LK8 A;  1XUD A;  2O3E A;  1ZP5 A;  3DWB A;  3DTK A;  1DMT A;  3HB2 P;  4XM6 A;  1SLN A;  1BSW A;  1JK3 A;  1G49 A;  4J4M A;  4JQG A;  4PKR A;  1OM8 A;  3WV2 A;  2OY4 A;  4H30 A;  3AYK A;  3LEA A;  1BIW A;  2L0R A;  2OY2 A;  1HV5 A;  3HY9 A;  4FXQ A;  4H84 A;  2J0T A;  3WV3 A;  4H1Q A;  2XS4 A;  1SAT A;  1ATL A;  5H8X A;  3VTG A;  1IAD A;  1GXD A;  5I43 A;  3O64 A;  4WZV A;  1G12 A;  2OW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...