2KRJA

High-resolution solid-state nmr structure of a 17.6 kda protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
152
structure length
152
Chain Sequence
HYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title High-resolution solid-state NMR structure of a 17.6 kDa protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 152
sequence length 152
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2krjA00
4IJOA 1GO7P 3EHXA 1CAQA 3GBOA 2DW0A 4H82A 4I35A 2AIGP 3WV1A 2QPJA 3E8RA 3OHOA 1JIZA 4L19A 4PKTA 3DPEA 4FU4A 1JK3A 3HDAP 4DF9A 1HFSA 3TT4A 966CA 1Q3AA 2AYKA 3B2ZA 2X7MA 2WO8A 1IADA 2MLRA 2O3EA 3CKIA 1QICA 1Y8JA 5I2ZA 5BOTA 830CA 3ZVSA 2OY2A 1CQRA 5CXAA 3NX7A 2TCLA 2HU6A 3KMCA 3OHLA 4AYKA 1C8TA 4L63A 1OMJA 4GWNA 4G0DA 2MZHA 1KUGA 4PKRA 2O36A 1FM1A 1CGEA 1IAEA 4WZVA 3KWVC 1MMQA 1CK7A 1H71P 1BQOA 1PWWA 1QJIA 1BKCI 3F17A 1OM8A 2D1OA 1HY7A 2JT5A 4DV8A 2USNA 1CXVA 1QUAA 4I03A 4A3WA 2MZEA 3N2UA 4XBHA 3P1VA 1J7NA 1OO9A 1JIWP 3L0TA 4CTHA 1YQYA 1KUKA 5I4OA 2I47A 3L0VA 1C3IA 3F15A 2WOAA 2JT6A 3KECA 1BKCA 3DNGA 4J4MA 4WF6A 4H3XA 4GR3A 5D1UA 3MA2A 1HOVA 4DPEA 1XUCA 4QKZA 1SLMA 1SRPA 1YCMA 2OXWA 1GO8P 2Y6CA 4PKUA 1I1IP 1CGLA 1I73A 2W14A 2X3CA 3RTSA 2CLTA 3LIRA 3F16A 4PKVA 3BA0A 1SMPA 1XFYA 4ILWD 1G9KA 3N2VA 5I3MA 2MZIA 5I12A 1DTHA 1O0QA 1ZTQA 1OS2A 5L7FA 1BM6A 3HY9A 1IAGA 3F18A 4FXQA 5L79A 3O2XA 3WV3A 1JANA 1GE7A 3EDZA 1UMTA 2OW1A 4H76A 3G42A 3TVCA 4WKEA 5JMYA 1S4BP 1G05A 1YP1A 1XFXA 4GR0A 1MMPA 1GKCA 2PJTA 2E3XA 1ASTA 1HFCA 4WKIA 4JA1A 1GXDA 3DL1A 3HYGA 1UTTA 2ERPA 2OVXA 4GF1A 1KUFA 4XCTA 5CUHA 3I7GA 2SRTA 1FLSA 3KMEA 1KUIA 1BQQM 3LQBA 1JKYA 1D8MA 1AYKA 2OXUA 3DSLA 1XURA 3RTTA 1EB6A 3LIKA 2X3BA 1GKDA 2DDYA 1CGFA 1MNCA 2OVZA 3KEKA 1KUHA 2DDFA 1L6JA 3TS4A 2Z2DA 2RJQA 5I0LA 1PWPA 1QJJA 5LABA 1C7KA 3LJTA 4G9LA 2J83A 1K7IA 2DW2A 3KHIA 3EDHA 2POJA 2Y6DA 3ZXHA 4GUYA 4PKSA 4H84A 4XM7A 2OW0A 3LUMA 1G49A 1HV5A 1OM7A 1XFUA 3HB2P 1JAOA 2FV9A 1ZVXA 1EAKA 1PWVA 4JQGA 1ZS0A 2V4BA 2OI0A 5CZMA 4AIGA 1PWUA 1XFVA 3DPFA 4GWMA 1A85A 1BSWA 3WV2A 1RMZA 4A7BA 1Y0VA 2ERQA 3EDIA 3LE9A 3LMCA 2K9CA 5D2BA 1R1HA 1IACA 2OXZA 3TSKA 4ON1A 3Q2GA 3EHYA 2X3AA 1RM8A 3LJGA 3F1AA 1UMSA 1WNIA 2RJPA 3LILA 4JPAA 4PKWA 1MMRA 3ELMA 2EROA 1ROSA 1SATA 3F19A 4WK7A 4GQLA 4DD8A 3SHIA 1B3DA 1BIWA 3U1RA 3EDGA 2OY4A 3AIGA 3EWJA 1Y93A 2WO9A 5D1TA 1QIBA 4FVLA 1JAPA 1XUDA 1OM6A 4AUOA 2K2GA 4PKQA 1BZSA 4FXYP 1JAQA 2JIHA 5BPAA 1G12A 1JH1A 1QIAA 3USNA 3AYUA 1ATLA 4L6TA 4ZR5A 2OW2A 2J0TA 2OW9A 2XS3A 1IABA 3P24A 4XM8A 4XM6A 1XFZA 4AXQA 1UTZA 3G5CA 4H30A 4JP4A 1R54A 5BOYA 1XFWA 1O0TA 3HBUP 2N8RA 4R3VA 4IN9A 5D1SA 3VI1A 4IUWA 3LJZA 456CA 1SLNA 2W15A 1KAPP 3HDBA 3LEAA 1BUDA 2JNPA 4H1QA 1IAAA 5H8XA 1A86A 3AYKA 3KEJA 3V96B 2JSDA 1K7GA 2W12A 4HMAA 5I43A 1GE5A 5D7WA 3HBVP 3K7LA 1D5JA 1B8YA 1CIZA 1DMTA 3LKAA 2KRJA 3ZUKA 1AKLA 1AF0A 1HTDA 4JIJA 3B8ZA 1BKCE 1OS9A 3B92A 1EUBA 3LUNA 2XS4A 3LGPA 3VTGA 1I76A 4GR8A 3LK8A 1K7QA 1PWQA 1YOUA 1G4KA 2DW1A 2YB9A 3K7NA 3KRYA 1USNA 2W0DA 4Q1LA 4EFSA 1SU3A 1D8FA 1ZXCA 2A8HA 1ZP5A 3UVCA 3DWBA 2L0RA 3HY7A 3Q2HA 2MLSA 1D7XA 3I7IA 1R1JA 1BUVM 4H2EA 2W13A 3O64A 2CKIA 1ND1A 1JJ9A 1ZXVA 4HX3A 1GE6A 1FBLA 2D1NA 2OZRA 1R55A 1KBCA 2YIGA 1Z3JA 2FV5A 3LQ0A 5D3CA 1MMBA 2E2DA 5B5OA 4H49A 5B5PA 1R1IA 1UEAA
chains in the Genus database with same CATH superfamily
4IJOA 1GO7P 3EHXA 1CAQA 3GBOA 2DW0A 4H82A 4I35A 2AIGP 3WV1A 2QPJA 3E8RA 3OHOA 1JIZA 4L19A 4PKTA 3DPEA 4FU4A 1JK3A 3HDAP 4DF9A 1HFSA 3TT4A 966CA 1Q3AA 2AYKA 3B2ZA 2X7MA 2WO8A 1IADA 2MLRA 2O3EA 3CKIA 1QICA 1Y8JA 5I2ZA 5BOTA 1TVIA 830CA 3ZVSA 2OY2A 1CQRA 5CXAA 3DTKA 3NX7A 2TCLA 2HU6A 3KMCA 3OHLA 4AYKA 1C8TA 4L63A 1OMJA 4GWNA 4G0DA 2MZHA 1KUGA 4PKRA 2O36A 1FM1A 1CGEA 1IAEA 4WZVA 3KWVC 1MMQA 1CK7A 1H71P 1BQOA 1PWWA 1QJIA 1XM5A 1BKCI 3F17A 1OM8A 2D1OA 1HY7A 2JT5A 4DV8A 2USNA 1CXVA 1QUAA 4I03A 4A3WA 2MZEA 3N2UA 4XBHA 3P1VA 1J7NA 1OO9A 1JIWP 3L0TA 4CTHA 1YQYA 1KUKA 5I4OA 2I47A 3L0VA 1C3IA 3F15A 2WOAA 2JT6A 3KECA 1BKCA 3DNGA 4J4MA 4WF6A 4H3XA 4GR3A 5D1UA 3MA2A 1HOVA 4DPEA 1XUCA 4QKZA 1SLMA 1SRPA 1YCMA 2OXWA 1GO8P 2Y6CA 4PKUA 1I1IP 1CGLA 1I73A 2W14A 2X3CA 3RTSA 2CLTA 3LIRA 3F16A 4PKVA 3BA0A 1SMPA 1XFYA 4ILWD 1G9KA 3N2VA 5I3MA 2MZIA 5I12A 1DTHA 1O0QA 1ZTQA 1OS2A 5L7FA 1BM6A 3HY9A 1IAGA 3F18A 4FXQA 5L79A 3O2XA 3WV3A 1JANA 1GE7A 3EDZA 1UMTA 2OW1A 4H76A 3G42A 3TVCA 4L7AA 4WKEA 5JMYA 1S4BP 1G05A 1YP1A 1XFXA 4GR0A 1MMPA 1GKCA 2PJTA 2E3XA 1ASTA 1HFCA 4WKIA 4JA1A 1GXDA 3DL1A 3HYGA 1UTTA 2ERPA 2OVXA 4GF1A 1KUFA 4XCTA 5CUHA 3I7GA 2SRTA 1FLSA 3KMEA 1KUIA 1BQQM 3LQBA 1JKYA 1D8MA 1AYKA 2OXUA 3DTEA 3DSLA 1XURA 3RTTA 1EB6A 3LIKA 2X3BA 1GKDA 2DDYA 1CGFA 1MNCA 2OVZA 3KEKA 1KUHA 2DDFA 1XAXA 1L6JA 3TS4A 2Z2DA 2RJQA 5I0LA 1PWPA 1QJJA 5LABA 1C7KA 3LJTA 4G9LA 2J83A 1K7IA 2DW2A 3KHIA 3EDHA 2POJA 2Y6DA 3ZXHA 4GUYA 4PKSA 4H84A 4XM7A 2YUFA 2OW0A 3LUMA 1G49A 1HV5A 1OM7A 1XFUA 3HB2P 1JAOA 2FV9A 1ZVXA 1EAKA 1PWVA 4JQGA 1ZS0A 2V4BA 2OI0A 5CZMA 4AIGA 1PWUA 1XFVA 3DPFA 4GWMA 1A85A 1BSWA 3WV2A 1RMZA 4A7BA 1Y0VA 2ERQA 3EDIA 3LE9A 3LMCA 2K9CA 5D2BA 1R1HA 1IACA 2OXZA 3TSKA 4ON1A 3Q2GA 3EHYA 2X3AA 1RM8A 3LJGA 3F1AA 1UMSA 1WNIA 2RJPA 3LILA 4JPAA 4PKWA 1MMRA 3ELMA 2EROA 1ROSA 1SATA 3F19A 4WK7A 4GQLA 4DD8A 3SHIA 1B3DA 1BIWA 3U1RA 3EDGA 2OY4A 3AIGA 3EWJA 1Y93A 2WO9A 5D1TA 1QIBA 4FVLA 1JAPA 1XUDA 1OM6A 4AUOA 2K2GA 4PKQA 1BZSA 4FXYP 1JAQA 2JIHA 5BPAA 1G12A 1JH1A 1QIAA 3USNA 3AYUA 1ATLA 4L6TA 4ZR5A 2OW2A 2J0TA 2OW9A 2XS3A 1IABA 3P24A 4XM8A 4XM6A 1XFZA 4AXQA 1UTZA 3G5CA 4H30A 4JP4A 1R54A 5BOYA 1XFWA 1O0TA 3HBUP 2N8RA 1OZ9A 4R3VA 4IN9A 5D1SA 3VI1A 4IUWA 3LJZA 456CA 1SLNA 2W15A 1KAPP 3HDBA 3LEAA 1BUDA 2JNPA 4H1QA 1IAAA 5H8XA 1A86A 3AYKA 3KEJA 3V96B 2JSDA 1K7GA 2W12A 4HMAA 5I43A 1GE5A 5D7WA 3HBVP 3K7LA 1D5JA 1B8YA 1CIZA 1DMTA 3LKAA 2KRJA 3ZUKA 1AKLA 1AF0A 1HTDA 4JIJA 3B8ZA 1BKCE 1OS9A 3B92A 1EUBA 3LUNA 2XS4A 3LGPA 3DTIA 3VTGA 1I76A 4GR8A 3LK8A 1K7QA 1PWQA 1YOUA 1G4KA 2DW1A 2YB9A 3K7NA 3KRYA 1USNA 2W0DA 4Q1LA 4EFSA 1SU3A 1D8FA 1ZXCA 2A8HA 1ZP5A 3UVCA 3DWBA 2L0RA 3HY7A 3Q2HA 2MLSA 1D7XA 3I7IA 1R1JA 1BUVM 4H2EA 2W13A 3O64A 2CKIA 1ND1A 1JJ9A 1ZXVA 4HX3A 1GE6A 1FBLA 2D1NA 2OZRA 1R55A 1KBCA 2YIGA 1Z3JA 2FV5A 3LQ0A 5D3CA 1MMBA 2E2DA 5B5OA 4H49A 5B5PA 1R1IA 1UEAA
chains in the Genus database with same CATH topology
4IJOA 1GO7P 3EHXA 1CAQA 3GBOA 2DW0A 4H82A 4I35A 2AIGP 3WV1A 2QPJA 3E8RA 3OHOA 1JIZA 4L19A 4PKTA 3DPEA 4FU4A 1JK3A 3HDAP 4DF9A 1HFSA 3TT4A 966CA 1Q3AA 2AYKA 3B2ZA 2X7MA 2WO8A 1IADA 2MLRA 2O3EA 3CKIA 1QICA 1Y8JA 5I2ZA 5BOTA 830CA 3ZVSA 2OY2A 1CQRA 5CXAA 3DTKA 3NX7A 2TCLA 2HU6A 3KMCA 3OHLA 4AYKA 1C8TA 4L63A 1OMJA 4GWNA 4G0DA 2MZHA 1KUGA 4PKRA 2O36A 1FM1A 1CGEA 1IAEA 4WZVA 3KWVC 1MMQA 1CK7A 1H71P 1BQOA 1PWWA 1QJIA 1BKCI 3F17A 1OM8A 2D1OA 1HY7A 2JT5A 4DV8A 2USNA 1CXVA 1QUAA 4I03A 4A3WA 2MZEA 3N2UA 4XBHA 3P1VA 1J7NA 1OO9A 1JIWP 3L0TA 4CTHA 1YQYA 1KUKA 5I4OA 2I47A 3L0VA 1C3IA 3F15A 2WOAA 2JT6A 3KECA 1BKCA 3DNGA 4J4MA 4WF6A 4H3XA 4GR3A 5D1UA 3MA2A 1HOVA 4DPEA 1XUCA 4QKZA 1SLMA 1SRPA 1YCMA 2OXWA 1GO8P 2Y6CA 4PKUA 1I1IP 1CGLA 1I73A 2W14A 2X3CA 3RTSA 2CLTA 3LIRA 3F16A 4PKVA 3BA0A 1SMPA 1XFYA 4ILWD 1G9KA 3N2VA 5I3MA 2MZIA 5I12A 1DTHA 1O0QA 1ZTQA 1OS2A 5L7FA 1BM6A 3HY9A 1IAGA 3F18A 4FXQA 5L79A 3O2XA 3WV3A 1JANA 1GE7A 3EDZA 1UMTA 2OW1A 4H76A 3G42A 3TVCA 4L7AA 4WKEA 5JMYA 1S4BP 1G05A 1YP1A 1XFXA 4GR0A 1MMPA 1GKCA 2PJTA 2E3XA 1ASTA 1HFCA 4WKIA 4JA1A 1GXDA 3DL1A 3HYGA 1UTTA 2ERPA 2OVXA 4GF1A 1KUFA 4XCTA 5CUHA 3I7GA 2SRTA 1FLSA 3KMEA 1KUIA 1BQQM 3LQBA 1JKYA 1D8MA 1AYKA 2OXUA 3DTEA 3DSLA 1XURA 3RTTA 1EB6A 3LIKA 2X3BA 1GKDA 2DDYA 1CGFA 1MNCA 2OVZA 3KEKA 1KUHA 2DDFA 1L6JA 3TS4A 2Z2DA 2RJQA 5I0LA 1PWPA 1QJJA 5LABA 1C7KA 3LJTA 4G9LA 2J83A 1K7IA 2DW2A 3KHIA 3EDHA 2POJA 2Y6DA 3ZXHA 4GUYA 4PKSA 4H84A 4XM7A 2YUFA 2OW0A 3LUMA 1G49A 1HV5A 1OM7A 1XFUA 3HB2P 1JAOA 2FV9A 1ZVXA 1EAKA 1PWVA 4JQGA 1ZS0A 2V4BA 2OI0A 5CZMA 4AIGA 1PWUA 1XFVA 3DPFA 4GWMA 1A85A 1BSWA 3WV2A 1RMZA 4A7BA 1Y0VA 2ERQA 3EDIA 3LE9A 3LMCA 2K9CA 5D2BA 1R1HA 1IACA 2OXZA 3TSKA 4ON1A 3Q2GA 3EHYA 2X3AA 1RM8A 3LJGA 3F1AA 1UMSA 1WNIA 2RJPA 3LILA 4JPAA 4PKWA 1MMRA 3ELMA 2EROA 1ROSA 1SATA 3F19A 4WK7A 4GQLA 4DD8A 3SHIA 1B3DA 1BIWA 3U1RA 3EDGA 2OY4A 3AIGA 3EWJA 1Y93A 2WO9A 5D1TA 1QIBA 4FVLA 1JAPA 1XUDA 1OM6A 4AUOA 2K2GA 4PKQA 1BZSA 4FXYP 1JAQA 2JIHA 5BPAA 1G12A 1JH1A 1QIAA 3USNA 3AYUA 1ATLA 4L6TA 4ZR5A 2OW2A 2J0TA 2OW9A 2XS3A 1IABA 3P24A 4XM8A 4XM6A 1XFZA 4AXQA 1UTZA 3G5CA 4H30A 4JP4A 1R54A 5BOYA 1XFWA 1O0TA 3HBUP 2N8RA 4R3VA 4IN9A 5D1SA 3VI1A 4IUWA 3LJZA 456CA 1SLNA 2W15A 1KAPP 3HDBA 3LEAA 1BUDA 2JNPA 4H1QA 1IAAA 5H8XA 1A86A 3AYKA 3KEJA 3V96B 2JSDA 1K7GA 2W12A 4HMAA 5I43A 1GE5A 5D7WA 3HBVP 3K7LA 1D5JA 1B8YA 1CIZA 1DMTA 3LKAA 2KRJA 3ZUKA 1AKLA 1AF0A 1HTDA 4JIJA 3B8ZA 1BKCE 1OS9A 3B92A 1EUBA 3LUNA 2XS4A 3LGPA 3DTIA 3VTGA 1I76A 4GR8A 3LK8A 1K7QA 1PWQA 1YOUA 1G4KA 2DW1A 2YB9A 3K7NA 3KRYA 1USNA 2W0DA 4Q1LA 4EFSA 1SU3A 1D8FA 1ZXCA 2A8HA 1ZP5A 3UVCA 3DWBA 2L0RA 3HY7A 3Q2HA 2MLSA 1D7XA 3I7IA 1R1JA 1BUVM 4H2EA 2W13A 3O64A 2CKIA 1ND1A 1JJ9A 1ZXVA 4HX3A 1GE6A 1FBLA 2D1NA 2OZRA 1R55A 1KBCA 2YIGA 1Z3JA 2FV5A 3LQ0A 5D3CA 1MMBA 2E2DA 5B5OA 4H49A 5B5PA 1R1IA 1UEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJO A;  1GO7 P;  3EHX A;  1CAQ A;  3GBO A;  2DW0 A;  4H82 A;  4I35 A;  2AIG P;  3WV1 A;  2QPJ A;  3E8R A;  3OHO A;  1JIZ A;  4L19 A;  4PKT A;  3DPE A;  4FU4 A;  1JK3 A;  3HDA P;  4DF9 A;  1HFS A;  3TT4 A;  966C A;  1Q3A A;  2AYK A;  3B2Z A;  2X7M A;  2WO8 A;  1IAD A;  2MLR A;  2O3E A;  3CKI A;  1QIC A;  1Y8J A;  5I2Z A;  5BOT A;  830C A;  3ZVS A;  2OY2 A;  1CQR A;  5CXA A;  3NX7 A;  2TCL A;  2HU6 A;  3KMC A;  3OHL A;  4AYK A;  1C8T A;  4L63 A;  1OMJ A;  4GWN A;  4G0D A;  2MZH A;  1KUG A;  4PKR A;  2O36 A;  1FM1 A;  1CGE A;  1IAE A;  4WZV A;  3KWV C;  1MMQ A;  1CK7 A;  1H71 P;  1BQO A;  1PWW A;  1QJI A;  1BKC I;  3F17 A;  1OM8 A;  2D1O A;  1HY7 A;  2JT5 A;  4DV8 A;  2USN A;  1CXV A;  1QUA A;  4I03 A;  4A3W A;  2MZE A;  3N2U A;  4XBH A;  3P1V A;  1J7N A;  1OO9 A;  1JIW P;  3L0T A;  4CTH A;  1YQY A;  1KUK A;  5I4O A;  2I47 A;  3L0V A;  1C3I A;  3F15 A;  2WOA A;  2JT6 A;  3KEC A;  1BKC A;  3DNG A;  4J4M A;  4WF6 A;  4H3X A;  4GR3 A;  5D1U A;  3MA2 A;  1HOV A;  4DPE A;  1XUC A;  4QKZ A;  1SLM A;  1SRP A;  1YCM A;  2OXW A;  1GO8 P;  2Y6C A;  4PKU A;  1I1I P;  1CGL A;  1I73 A;  2W14 A;  2X3C A;  3RTS A;  2CLT A;  3LIR A;  3F16 A;  4PKV A;  3BA0 A;  1SMP A;  1XFY A;  4ILW D;  1G9K A;  3N2V A;  5I3M A;  2MZI A;  5I12 A;  1DTH A;  1O0Q A;  1ZTQ A;  1OS2 A;  5L7F A;  1BM6 A;  3HY9 A;  1IAG A;  3F18 A;  4FXQ A;  5L79 A;  3O2X A;  3WV3 A;  1JAN A;  1GE7 A;  3EDZ A;  1UMT A;  2OW1 A;  4H76 A;  3G42 A;  3TVC A;  4WKE A;  5JMY A;  1S4B P;  1G05 A;  1YP1 A;  1XFX A;  4GR0 A;  1MMP A;  1GKC A;  2PJT A;  2E3X A;  1AST A;  1HFC A;  4WKI A;  4JA1 A;  1GXD A;  3DL1 A;  3HYG A;  1UTT A;  2ERP A;  2OVX A;  4GF1 A;  1KUF A;  4XCT A;  5CUH A;  3I7G A;  2SRT A;  1FLS A;  3KME A;  1KUI A;  1BQQ M;  3LQB A;  1JKY A;  1D8M A;  1AYK A;  2OXU A;  3DSL A;  1XUR A;  3RTT A;  1EB6 A;  3LIK A;  2X3B A;  1GKD A;  2DDY A;  1CGF A;  1MNC A;  2OVZ A;  3KEK A;  1KUH A;  2DDF A;  1L6J A;  3TS4 A;  2Z2D A;  2RJQ A;  5I0L A;  1PWP A;  1QJJ A;  5LAB A;  1C7K A;  3LJT A;  4G9L A;  2J83 A;  1K7I A;  2DW2 A;  3KHI A;  3EDH A;  2POJ A;  2Y6D A;  3ZXH A;  4GUY A;  4PKS A;  4H84 A;  4XM7 A;  2OW0 A;  3LUM A;  1G49 A;  1HV5 A;  1OM7 A;  1XFU A;  3HB2 P;  1JAO A;  2FV9 A;  1ZVX A;  1EAK A;  1PWV A;  4JQG A;  1ZS0 A;  2V4B A;  2OI0 A;  5CZM A;  4AIG A;  1PWU A;  1XFV A;  3DPF A;  4GWM A;  1A85 A;  1BSW A;  3WV2 A;  1RMZ A;  4A7B A;  1Y0V A;  2ERQ A;  3EDI A;  3LE9 A;  3LMC A;  2K9C A;  5D2B A;  1R1H A;  1IAC A;  2OXZ A;  3TSK A;  4ON1 A;  3Q2G A;  3EHY A;  2X3A A;  1RM8 A;  3LJG A;  3F1A A;  1UMS A;  1WNI A;  2RJP A;  3LIL A;  4JPA A;  4PKW A;  1MMR A;  3ELM A;  2ERO A;  1ROS A;  1SAT A;  3F19 A;  4WK7 A;  4GQL A;  4DD8 A;  3SHI A;  1B3D A;  1BIW A;  3U1R A;  3EDG A;  2OY4 A;  3AIG A;  3EWJ A;  1Y93 A;  2WO9 A;  5D1T A;  1QIB A;  4FVL A;  1JAP A;  1XUD A;  1OM6 A;  4AUO A;  2K2G A;  4PKQ A;  1BZS A;  4FXY P;  1JAQ A;  2JIH A;  5BPA A;  1G12 A;  1JH1 A;  1QIA A;  3USN A;  3AYU A;  1ATL A;  4L6T A;  4ZR5 A;  2OW2 A;  2J0T A;  2OW9 A;  2XS3 A;  1IAB A;  3P24 A;  4XM8 A;  4XM6 A;  1XFZ A;  4AXQ A;  1UTZ A;  3G5C A;  4H30 A;  4JP4 A;  1R54 A;  5BOY A;  1XFW A;  1O0T A;  3HBU P;  2N8R A;  4R3V A;  4IN9 A;  5D1S A;  3VI1 A;  4IUW A;  3LJZ A;  456C A;  1SLN A;  2W15 A;  1KAP P;  3HDB A;  3LEA A;  1BUD A;  2JNP A;  4H1Q A;  1IAA A;  5H8X A;  1A86 A;  3AYK A;  3KEJ A;  3V96 B;  2JSD A;  1K7G A;  2W12 A;  4HMA A;  5I43 A;  1GE5 A;  5D7W A;  3HBV P;  3K7L A;  1D5J A;  1B8Y A;  1CIZ A;  1DMT A;  3LKA A;  2KRJ A;  3ZUK A;  1AKL A;  1AF0 A;  1HTD A;  4JIJ A;  3B8Z A;  1BKC E;  1OS9 A;  3B92 A;  1EUB A;  3LUN A;  2XS4 A;  3LGP A;  3VTG A;  1I76 A;  4GR8 A;  3LK8 A;  1K7Q A;  1PWQ A;  1YOU A;  1G4K A;  2DW1 A;  2YB9 A;  3K7N A;  3KRY A;  1USN A;  2W0D A;  4Q1L A;  4EFS A;  1SU3 A;  1D8F A;  1ZXC A;  2A8H A;  1ZP5 A;  3UVC A;  3DWB A;  2L0R A;  3HY7 A;  3Q2H A;  2MLS A;  1D7X A;  3I7I A;  1R1J A;  1BUV M;  4H2E A;  2W13 A;  3O64 A;  2CKI A;  1ND1 A;  1JJ9 A;  1ZXV A;  4HX3 A;  1GE6 A;  1FBL A;  2D1N A;  2OZR A;  1R55 A;  1KBC A;  2YIG A;  1Z3J A;  2FV5 A;  3LQ0 A;  5D3C A;  1MMB A;  2E2D A;  5B5O A;  4H49 A;  5B5P A;  1R1I A;  1UEA A; 
#chains in the Genus database with same CATH topology
 4IJO A;  1GO7 P;  3EHX A;  1CAQ A;  3GBO A;  2DW0 A;  4H82 A;  4I35 A;  2AIG P;  3WV1 A;  2QPJ A;  3E8R A;  3OHO A;  1JIZ A;  4L19 A;  4PKT A;  3DPE A;  4FU4 A;  1JK3 A;  3HDA P;  4DF9 A;  1HFS A;  3TT4 A;  966C A;  1Q3A A;  2AYK A;  3B2Z A;  2X7M A;  2WO8 A;  1IAD A;  2MLR A;  2O3E A;  3CKI A;  1QIC A;  1Y8J A;  5I2Z A;  5BOT A;  1TVI A;  830C A;  3ZVS A;  2OY2 A;  1CQR A;  5CXA A;  3DTK A;  3NX7 A;  2TCL A;  2HU6 A;  3KMC A;  3OHL A;  4AYK A;  1C8T A;  4L63 A;  1OMJ A;  4GWN A;  4G0D A;  2MZH A;  1KUG A;  4PKR A;  2O36 A;  1FM1 A;  1CGE A;  1IAE A;  4WZV A;  3KWV C;  1MMQ A;  1CK7 A;  1H71 P;  1BQO A;  1PWW A;  1QJI A;  1XM5 A;  1BKC I;  3F17 A;  1OM8 A;  2D1O A;  1HY7 A;  2JT5 A;  4DV8 A;  2USN A;  1CXV A;  1QUA A;  4I03 A;  4A3W A;  2MZE A;  3N2U A;  4XBH A;  3P1V A;  1J7N A;  1OO9 A;  1JIW P;  3L0T A;  4CTH A;  1YQY A;  1KUK A;  5I4O A;  2I47 A;  3L0V A;  1C3I A;  3F15 A;  2WOA A;  2JT6 A;  3KEC A;  1BKC A;  3DNG A;  4J4M A;  4WF6 A;  4H3X A;  4GR3 A;  5D1U A;  3MA2 A;  1HOV A;  4DPE A;  1XUC A;  4QKZ A;  1SLM A;  1SRP A;  1YCM A;  2OXW A;  1GO8 P;  2Y6C A;  4PKU A;  1I1I P;  1CGL A;  1I73 A;  2W14 A;  2X3C A;  3RTS A;  2CLT A;  3LIR A;  3F16 A;  4PKV A;  3BA0 A;  1SMP A;  1XFY A;  4ILW D;  1G9K A;  3N2V A;  5I3M A;  2MZI A;  5I12 A;  1DTH A;  1O0Q A;  1ZTQ A;  1OS2 A;  5L7F A;  1BM6 A;  3HY9 A;  1IAG A;  3F18 A;  4FXQ A;  5L79 A;  3O2X A;  3WV3 A;  1JAN A;  1GE7 A;  3EDZ A;  1UMT A;  2OW1 A;  4H76 A;  3G42 A;  3TVC A;  4L7A A;  4WKE A;  5JMY A;  1S4B P;  1G05 A;  1YP1 A;  1XFX A;  4GR0 A;  1MMP A;  1GKC A;  2PJT A;  2E3X A;  1AST A;  1HFC A;  4WKI A;  4JA1 A;  1GXD A;  3DL1 A;  3HYG A;  1UTT A;  2ERP A;  2OVX A;  4GF1 A;  1KUF A;  4XCT A;  5CUH A;  3I7G A;  2SRT A;  1FLS A;  3KME A;  1KUI A;  1BQQ M;  3LQB A;  1JKY A;  1D8M A;  1AYK A;  2OXU A;  3DTE A;  3DSL A;  1XUR A;  3RTT A;  1EB6 A;  3LIK A;  2X3B A;  1GKD A;  2DDY A;  1CGF A;  1MNC A;  2OVZ A;  3KEK A;  1KUH A;  2DDF A;  1XAX A;  1L6J A;  3TS4 A;  2Z2D A;  2RJQ A;  5I0L A;  1PWP A;  1QJJ A;  5LAB A;  1C7K A;  3LJT A;  4G9L A;  2J83 A;  1K7I A;  2DW2 A;  3KHI A;  3EDH A;  2POJ A;  2Y6D A;  3ZXH A;  4GUY A;  4PKS A;  4H84 A;  4XM7 A;  2YUF A;  2OW0 A;  3LUM A;  1G49 A;  1HV5 A;  1OM7 A;  1XFU A;  3HB2 P;  1JAO A;  2FV9 A;  1ZVX A;  1EAK A;  1PWV A;  4JQG A;  1ZS0 A;  2V4B A;  2OI0 A;  5CZM A;  4AIG A;  1PWU A;  1XFV A;  3DPF A;  4GWM A;  1A85 A;  1BSW A;  3WV2 A;  1RMZ A;  4A7B A;  1Y0V A;  2ERQ A;  3EDI A;  3LE9 A;  3LMC A;  2K9C A;  5D2B A;  1R1H A;  1IAC A;  2OXZ A;  3TSK A;  4ON1 A;  3Q2G A;  3EHY A;  2X3A A;  1RM8 A;  3LJG A;  3F1A A;  1UMS A;  1WNI A;  2RJP A;  3LIL A;  4JPA A;  4PKW A;  1MMR A;  3ELM A;  2ERO A;  1ROS A;  1SAT A;  3F19 A;  4WK7 A;  4GQL A;  4DD8 A;  3SHI A;  1B3D A;  1BIW A;  3U1R A;  3EDG A;  2OY4 A;  3AIG A;  3EWJ A;  1Y93 A;  2WO9 A;  5D1T A;  1QIB A;  4FVL A;  1JAP A;  1XUD A;  1OM6 A;  4AUO A;  2K2G A;  4PKQ A;  1BZS A;  4FXY P;  1JAQ A;  2JIH A;  5BPA A;  1G12 A;  1JH1 A;  1QIA A;  3USN A;  3AYU A;  1ATL A;  4L6T A;  4ZR5 A;  2OW2 A;  2J0T A;  2OW9 A;  2XS3 A;  1IAB A;  3P24 A;  4XM8 A;  4XM6 A;  1XFZ A;  4AXQ A;  1UTZ A;  3G5C A;  4H30 A;  4JP4 A;  1R54 A;  5BOY A;  1XFW A;  1O0T A;  3HBU P;  2N8R A;  1OZ9 A;  4R3V A;  4IN9 A;  5D1S A;  3VI1 A;  4IUW A;  3LJZ A;  456C A;  1SLN A;  2W15 A;  1KAP P;  3HDB A;  3LEA A;  1BUD A;  2JNP A;  4H1Q A;  1IAA A;  5H8X A;  1A86 A;  3AYK A;  3KEJ A;  3V96 B;  2JSD A;  1K7G A;  2W12 A;  4HMA A;  5I43 A;  1GE5 A;  5D7W A;  3HBV P;  3K7L A;  1D5J A;  1B8Y A;  1CIZ A;  1DMT A;  3LKA A;  2KRJ A;  3ZUK A;  1AKL A;  1AF0 A;  1HTD A;  4JIJ A;  3B8Z A;  1BKC E;  1OS9 A;  3B92 A;  1EUB A;  3LUN A;  2XS4 A;  3LGP A;  3DTI A;  3VTG A;  1I76 A;  4GR8 A;  3LK8 A;  1K7Q A;  1PWQ A;  1YOU A;  1G4K A;  2DW1 A;  2YB9 A;  3K7N A;  3KRY A;  1USN A;  2W0D A;  4Q1L A;  4EFS A;  1SU3 A;  1D8F A;  1ZXC A;  2A8H A;  1ZP5 A;  3UVC A;  3DWB A;  2L0R A;  3HY7 A;  3Q2H A;  2MLS A;  1D7X A;  3I7I A;  1R1J A;  1BUV M;  4H2E A;  2W13 A;  3O64 A;  2CKI A;  1ND1 A;  1JJ9 A;  1ZXV A;  4HX3 A;  1GE6 A;  1FBL A;  2D1N A;  2OZR A;  1R55 A;  1KBC A;  2YIG A;  1Z3J A;  2FV5 A;  3LQ0 A;  5D3C A;  1MMB A;  2E2D A;  5B5O A;  4H49 A;  5B5P A;  1R1I A;  1UEA A; 
#chains in the Genus database with same CATH homology
 4IJO A;  1GO7 P;  3EHX A;  1CAQ A;  3GBO A;  2DW0 A;  4H82 A;  4I35 A;  2AIG P;  3WV1 A;  2QPJ A;  3E8R A;  3OHO A;  1JIZ A;  4L19 A;  4PKT A;  3DPE A;  4FU4 A;  1JK3 A;  3HDA P;  4DF9 A;  1HFS A;  3TT4 A;  966C A;  1Q3A A;  2AYK A;  3B2Z A;  2X7M A;  2WO8 A;  1IAD A;  2MLR A;  2O3E A;  3CKI A;  1QIC A;  1Y8J A;  5I2Z A;  5BOT A;  830C A;  3ZVS A;  2OY2 A;  1CQR A;  5CXA A;  3DTK A;  3NX7 A;  2TCL A;  2HU6 A;  3KMC A;  3OHL A;  4AYK A;  1C8T A;  4L63 A;  1OMJ A;  4GWN A;  4G0D A;  2MZH A;  1KUG A;  4PKR A;  2O36 A;  1FM1 A;  1CGE A;  1IAE A;  4WZV A;  3KWV C;  1MMQ A;  1CK7 A;  1H71 P;  1BQO A;  1PWW A;  1QJI A;  1BKC I;  3F17 A;  1OM8 A;  2D1O A;  1HY7 A;  2JT5 A;  4DV8 A;  2USN A;  1CXV A;  1QUA A;  4I03 A;  4A3W A;  2MZE A;  3N2U A;  4XBH A;  3P1V A;  1J7N A;  1OO9 A;  1JIW P;  3L0T A;  4CTH A;  1YQY A;  1KUK A;  5I4O A;  2I47 A;  3L0V A;  1C3I A;  3F15 A;  2WOA A;  2JT6 A;  3KEC A;  1BKC A;  3DNG A;  4J4M A;  4WF6 A;  4H3X A;  4GR3 A;  5D1U A;  3MA2 A;  1HOV A;  4DPE A;  1XUC A;  4QKZ A;  1SLM A;  1SRP A;  1YCM A;  2OXW A;  1GO8 P;  2Y6C A;  4PKU A;  1I1I P;  1CGL A;  1I73 A;  2W14 A;  2X3C A;  3RTS A;  2CLT A;  3LIR A;  3F16 A;  4PKV A;  3BA0 A;  1SMP A;  1XFY A;  4ILW D;  1G9K A;  3N2V A;  5I3M A;  2MZI A;  5I12 A;  1DTH A;  1O0Q A;  1ZTQ A;  1OS2 A;  5L7F A;  1BM6 A;  3HY9 A;  1IAG A;  3F18 A;  4FXQ A;  5L79 A;  3O2X A;  3WV3 A;  1JAN A;  1GE7 A;  3EDZ A;  1UMT A;  2OW1 A;  4H76 A;  3G42 A;  3TVC A;  4L7A A;  4WKE A;  5JMY A;  1S4B P;  1G05 A;  1YP1 A;  1XFX A;  4GR0 A;  1MMP A;  1GKC A;  2PJT A;  2E3X A;  1AST A;  1HFC A;  4WKI A;  4JA1 A;  1GXD A;  3DL1 A;  3HYG A;  1UTT A;  2ERP A;  2OVX A;  4GF1 A;  1KUF A;  4XCT A;  5CUH A;  3I7G A;  2SRT A;  1FLS A;  3KME A;  1KUI A;  1BQQ M;  3LQB A;  1JKY A;  1D8M A;  1AYK A;  2OXU A;  3DTE A;  3DSL A;  1XUR A;  3RTT A;  1EB6 A;  3LIK A;  2X3B A;  1GKD A;  2DDY A;  1CGF A;  1MNC A;  2OVZ A;  3KEK A;  1KUH A;  2DDF A;  1L6J A;  3TS4 A;  2Z2D A;  2RJQ A;  5I0L A;  1PWP A;  1QJJ A;  5LAB A;  1C7K A;  3LJT A;  4G9L A;  2J83 A;  1K7I A;  2DW2 A;  3KHI A;  3EDH A;  2POJ A;  2Y6D A;  3ZXH A;  4GUY A;  4PKS A;  4H84 A;  4XM7 A;  2YUF A;  2OW0 A;  3LUM A;  1G49 A;  1HV5 A;  1OM7 A;  1XFU A;  3HB2 P;  1JAO A;  2FV9 A;  1ZVX A;  1EAK A;  1PWV A;  4JQG A;  1ZS0 A;  2V4B A;  2OI0 A;  5CZM A;  4AIG A;  1PWU A;  1XFV A;  3DPF A;  4GWM A;  1A85 A;  1BSW A;  3WV2 A;  1RMZ A;  4A7B A;  1Y0V A;  2ERQ A;  3EDI A;  3LE9 A;  3LMC A;  2K9C A;  5D2B A;  1R1H A;  1IAC A;  2OXZ A;  3TSK A;  4ON1 A;  3Q2G A;  3EHY A;  2X3A A;  1RM8 A;  3LJG A;  3F1A A;  1UMS A;  1WNI A;  2RJP A;  3LIL A;  4JPA A;  4PKW A;  1MMR A;  3ELM A;  2ERO A;  1ROS A;  1SAT A;  3F19 A;  4WK7 A;  4GQL A;  4DD8 A;  3SHI A;  1B3D A;  1BIW A;  3U1R A;  3EDG A;  2OY4 A;  3AIG A;  3EWJ A;  1Y93 A;  2WO9 A;  5D1T A;  1QIB A;  4FVL A;  1JAP A;  1XUD A;  1OM6 A;  4AUO A;  2K2G A;  4PKQ A;  1BZS A;  4FXY P;  1JAQ A;  2JIH A;  5BPA A;  1G12 A;  1JH1 A;  1QIA A;  3USN A;  3AYU A;  1ATL A;  4L6T A;  4ZR5 A;  2OW2 A;  2J0T A;  2OW9 A;  2XS3 A;  1IAB A;  3P24 A;  4XM8 A;  4XM6 A;  1XFZ A;  4AXQ A;  1UTZ A;  3G5C A;  4H30 A;  4JP4 A;  1R54 A;  5BOY A;  1XFW A;  1O0T A;  3HBU P;  2N8R A;  4R3V A;  4IN9 A;  5D1S A;  3VI1 A;  4IUW A;  3LJZ A;  456C A;  1SLN A;  2W15 A;  1KAP P;  3HDB A;  3LEA A;  1BUD A;  2JNP A;  4H1Q A;  1IAA A;  5H8X A;  1A86 A;  3AYK A;  3KEJ A;  3V96 B;  2JSD A;  1K7G A;  2W12 A;  4HMA A;  5I43 A;  1GE5 A;  5D7W A;  3HBV P;  3K7L A;  1D5J A;  1B8Y A;  1CIZ A;  1DMT A;  3LKA A;  2KRJ A;  3ZUK A;  1AKL A;  1AF0 A;  1HTD A;  4JIJ A;  3B8Z A;  1BKC E;  1OS9 A;  3B92 A;  1EUB A;  3LUN A;  2XS4 A;  3LGP A;  3DTI A;  3VTG A;  1I76 A;  4GR8 A;  3LK8 A;  1K7Q A;  1PWQ A;  1YOU A;  1G4K A;  2DW1 A;  2YB9 A;  3K7N A;  3KRY A;  1USN A;  2W0D A;  4Q1L A;  4EFS A;  1SU3 A;  1D8F A;  1ZXC A;  2A8H A;  1ZP5 A;  3UVC A;  3DWB A;  2L0R A;  3HY7 A;  3Q2H A;  2MLS A;  1D7X A;  3I7I A;  1R1J A;  1BUV M;  4H2E A;  2W13 A;  3O64 A;  2CKI A;  1ND1 A;  1JJ9 A;  1ZXV A;  4HX3 A;  1GE6 A;  1FBL A;  2D1N A;  2OZR A;  1R55 A;  1KBC A;  2YIG A;  1Z3J A;  2FV5 A;  3LQ0 A;  5D3C A;  1MMB A;  2E2D A;  5B5O A;  4H49 A;  5B5P A;  1R1I A;  1UEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...