2KRJA

High-resolution solid-state nmr structure of a 17.6 kda protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
152
structure length
152
Chain Sequence
HYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Macrophage metalloelastase
publication title High-resolution solid-state NMR structure of a 17.6 kDa protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 152
sequence length 152
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2krjA00
2WO9A 1XFUA 3ZVSA 1R1IA 1RMZA 1A86A 5JMYA 2JNPA 1ZVXA 2OW0A 1C8TA 2JSDA 3OHOA 4XM8A 1JIZA 2D1NA 3E8RA 4DPEA 1R55A 2OVXA 2ERPA 1IACA 1B3DA 3LQBA 1Y93A 3F18A 1QJIA 4WKEA 1G9KA 5B5OA 4JQGA 2Y6DA 4DF9A 1G4KA 2X3CA 1MNCA 3TVCA 1QJJA 2MLSA 3EDHA 1KUKA 1JANA 1GE6A 2OXUA 1OS2A 4WK7A 1GE7A 1DTHA 2DDFA 3HB2P 1D7XA 3DSLA 2POJA 1JIWP 1KUHA 3HBUP 5D7WA 2O3EA 1HV5A 2SRTA 2K2GA 1KUFA 4H30A 2DDYA 1CIZA 1FBLA 1O0QA 2MZHA 4FVLA 1G49A 3WV1A 2RJPA 4G9LA 1MMQA 5I2ZA 3LK8A 2DW0A 4WZVA 2WOAA 830CA 1USNA 4FU4A 5L7FA 4GUYA 1CGFA 3LJGA 1HFCA 4H76A 1YCMA 4JP4A 1K7QA 1C3IA 1D8FA 4XM6A 4GR8A 1Y0VA 2W13A 3U1RA 2QPJA 4DV8A 1XFVA 1YQYA 2O36A 1KAPP 1BQQM 1K7IA 1JAOA 1MMRA 1AF0A 2USNA 4GQLA 1CXVA 5CZMA 4L19A 4J4MA 3KEJA 3P24A 1RM8A 3F16A 4L63A 3HBVP 2A8HA 4H3XA 1BUVM 1CQRA 1Q3AA 1CK7A 3LEAA 1GO7P 1BKCE 1MMBA 1ZXCA 3GBOA 1BZSA 2X3AA 1G05A 3LE9A 1O0TA 4JA1A 2PJTA 1PWPA 2OW9A 1JJ9A 5BPAA 1WNIA 3K7LA 1A85A 1OM8A 4GWNA 1I73A 4PKQA 1EAKA 3N2VA 1SU3A 3TS4A 1GXDA 1UTZA 4WKIA 2OW2A 2OW1A 2CKIA 2Y6CA 3F15A 4L6TA 1IAGA 4Q1LA 4JIJA 1ZP5A 3ZXHA 3B2ZA 2OZRA 1SLNA 2W12A 1HY7A 1KUIA 1UMSA 1Z3JA 3AYKA 3KWVC 2HU6A 1BKCI 5D2BA 4GWMA 3EHYA 4IJOA 3KMEA 3VTGA 3LQ0A 2AYKA 2OY2A 2MZEA 1B8YA 2OY4A 4A3WA 1FLSA 1KUGA 4H84A 3USNA 1UTTA 3Q2GA 1XFZA 3Q2HA 1SMPA 1BQOA 4G0DA 5D1SA 1CAQA 1AYKA 2ERQA 1PWVA 4H82A 1I76A 2FV9A 4GR0A 5CUHA 4XCTA 3AIGA 3HY9A 3SHIA 1PWQA 5D3CA 2X3BA 1OS9A 1SLMA 3LJZA 1JK3A 3RTSA 2DW1A 1QIBA 1OM6A 4GF1A 3F19A 3I7IA 1ATLA 3HY7A 3P1VA 4AXQA 4EFSA 4GR3A 1BIWA 5I4OA 3B92A 1K7GA 3G42A 2MZIA 2N8RA 1UEAA 1KBCA 2L0RA 3WV2A 1GKDA 3TT4A 1GE5A 3EDIA 3LUMA 2XS3A 1OM7A 1HTDA 1GKCA 1CGLA 4PKTA 4PKRA 4R3VA 2OXZA 4HX3A 1R1JA 1JAPA 4FXQA 3TSKA 4A7BA 3UVCA 1G12A 1XUDA 3CKIA 1AKLA 2K9CA 1ZXVA 3DPFA 1XUCA 3KRYA 2OXWA 4H49A 2E2DA 3KMCA 1D5JA 1ND1A 3K7NA 3F1AA 4AYKA 3V96B 3DL1A 2KRJA 1YP1A 1H71P 2Z2DA 1PWUA 2XS4A 1JKYA 1CGEA 3LKAA 3WV3A 2J83A 2E3XA 3I7GA 1C7KA 966CA 5I12A 1IAEA 1QIAA 5L79A 1L6JA 3DWBA 1MMPA 3LJTA 3HYGA 3BA0A 1QUAA 3F17A 5H8XA 1GO8P 3L0VA 1HFSA 5BOTA 2YB9A 1IABA 3RTTA 4ON1A 5CXAA 3LIKA 2W0DA 2CLTA 5I0LA 2DW2A 4IN9A 4PKVA 3LILA 3O2XA 3OHLA 4H2EA 1HOVA 2OVZA 3KEKA 2X7MA 2AIGP 3G5CA 1QICA 3NX7A 1BSWA 4FXYP 1BUDA 1IAAA 1YOUA 3DPEA 4HMAA 1I1IP 1DMTA 1OMJA 1ASTA 4AUOA 1BKCA 1BM6A 2JT6A 1JH1A 1PWWA 5LABA 1FM1A 2J0TA 3HDAP 2I47A 4I03A 2V4BA 3AYUA 1ZTQA 3O64A 1SATA 1R54A 4WF6A 4CTHA 2JIHA 3N2UA 4XM7A 3LUNA 2RJQA 2YIGA 5I3MA 4H1QA 456CA 3ZUKA 1XFYA 1XURA 4PKWA 2W14A 3B8ZA 2JT5A 3MA2A 2WO8A 1XFWA 5D1TA 3LMCA 1IADA 1S4BP 3LIRA 3L0TA 4AIGA 2MLRA 3EDGA 1EB6A 1ZS0A 4IUWA 5BOYA 5B5PA 3VI1A 3ELMA 2EROA 1EUBA 4XBHA 4ZR5A 2D1OA 3HDBA 4DD8A 1ROSA 4JPAA 1Y8JA 1SRPA 3LGPA 1XFXA 3EWJA 2OI0A 1D8MA 1J7NA 2W15A 1JAQA 3EHXA 1OO9A 4I35A 3DNGA 3KECA 1R1HA 3EDZA 4ILWD 3KHIA 4QKZA 5I43A 4PKUA 2TCLA 2FV5A 4PKSA 1UMTA 5D1UA
chains in the Genus database with same CATH superfamily
2WO9A 1XFUA 3ZVSA 1R1IA 1RMZA 1A86A 5JMYA 2JNPA 1ZVXA 2OW0A 1C8TA 2JSDA 3OHOA 4XM8A 1JIZA 2D1NA 3E8RA 4DPEA 1R55A 2OVXA 2ERPA 1IACA 1B3DA 3LQBA 1Y93A 3F18A 1QJIA 4WKEA 1G9KA 5B5OA 4JQGA 2Y6DA 4DF9A 1G4KA 2X3CA 1MNCA 3TVCA 1OZ9A 1QJJA 2MLSA 3EDHA 1KUKA 1JANA 1GE6A 2OXUA 1OS2A 4WK7A 1GE7A 1DTHA 2DDFA 3HB2P 1D7XA 3DSLA 2POJA 1JIWP 1KUHA 3HBUP 5D7WA 2O3EA 1HV5A 2SRTA 1TVIA 1KUFA 2K2GA 4H30A 2DDYA 1CIZA 1FBLA 1O0QA 2MZHA 4FVLA 1G49A 3WV1A 2RJPA 4G9LA 1MMQA 5I2ZA 3LK8A 2DW0A 4WZVA 2WOAA 830CA 1USNA 4FU4A 5L7FA 4GUYA 1CGFA 3LJGA 1HFCA 4H76A 1YCMA 4JP4A 1K7QA 1C3IA 1D8FA 4XM6A 4GR8A 1Y0VA 2W13A 3U1RA 2QPJA 4DV8A 1XFVA 1YQYA 2O36A 1KAPP 1BQQM 1K7IA 1JAOA 1MMRA 1AF0A 2USNA 4GQLA 1CXVA 5CZMA 4L19A 4J4MA 3KEJA 3P24A 1RM8A 3F16A 4L63A 3HBVP 2A8HA 4H3XA 1BUVM 1CQRA 1Q3AA 1CK7A 3LEAA 1GO7P 1BKCE 1MMBA 1ZXCA 3GBOA 1BZSA 2X3AA 1G05A 3LE9A 1O0TA 4JA1A 2PJTA 1PWPA 2OW9A 4L7AA 1JJ9A 5BPAA 1WNIA 3K7LA 1A85A 1OM8A 4GWNA 1I73A 3DTKA 4PKQA 1EAKA 3N2VA 1SU3A 3TS4A 1GXDA 1UTZA 4WKIA 2OW2A 2OW1A 2CKIA 2Y6CA 3F15A 4L6TA 1IAGA 4Q1LA 4JIJA 1ZP5A 3ZXHA 3B2ZA 2OZRA 1SLNA 2W12A 1HY7A 1KUIA 1UMSA 1Z3JA 3AYKA 3KWVC 2HU6A 1BKCI 5D2BA 4GWMA 3EHYA 4IJOA 3KMEA 3VTGA 3LQ0A 2AYKA 2OY2A 2MZEA 1B8YA 2OY4A 4A3WA 1FLSA 1KUGA 4H84A 3USNA 1UTTA 3Q2GA 1XFZA 3Q2HA 1SMPA 1BQOA 4G0DA 5D1SA 1CAQA 1AYKA 2ERQA 1PWVA 4H82A 1I76A 2FV9A 4GR0A 5CUHA 4XCTA 3AIGA 3DTEA 3HY9A 3SHIA 1PWQA 5D3CA 2X3BA 1OS9A 1SLMA 3LJZA 1JK3A 3RTSA 2DW1A 1QIBA 1OM6A 4GF1A 3F19A 3I7IA 1ATLA 3HY7A 3P1VA 4AXQA 4EFSA 4GR3A 1BIWA 5I4OA 3B92A 1K7GA 3G42A 2MZIA 2N8RA 1UEAA 1KBCA 2L0RA 3WV2A 1GKDA 3TT4A 1GE5A 3EDIA 3LUMA 2XS3A 1OM7A 1HTDA 1GKCA 1CGLA 4PKTA 4PKRA 4R3VA 2OXZA 4HX3A 1R1JA 1JAPA 4FXQA 3TSKA 4A7BA 3UVCA 1G12A 1XUDA 3CKIA 1AKLA 2K9CA 1ZXVA 3DPFA 1XUCA 3KRYA 2OXWA 4H49A 2E2DA 3KMCA 1D5JA 1ND1A 2YUFA 3F1AA 3K7NA 4AYKA 3V96B 3DL1A 2KRJA 1YP1A 1H71P 2Z2DA 1PWUA 2XS4A 1JKYA 1CGEA 3LKAA 3WV3A 2J83A 2E3XA 3I7GA 1C7KA 966CA 5I12A 1IAEA 1QIAA 5L79A 1L6JA 3DWBA 1MMPA 3LJTA 3HYGA 3BA0A 1QUAA 3F17A 5H8XA 1GO8P 3L0VA 1HFSA 5BOTA 2YB9A 1IABA 3RTTA 4ON1A 5CXAA 3LIKA 2W0DA 2CLTA 5I0LA 2DW2A 4IN9A 4PKVA 3LILA 3O2XA 3OHLA 4H2EA 1HOVA 2OVZA 3KEKA 2X7MA 2AIGP 3G5CA 1QICA 3NX7A 1BSWA 4FXYP 1BUDA 1IAAA 1YOUA 3DPEA 4HMAA 1I1IP 1DMTA 1OMJA 1ASTA 4AUOA 1BKCA 1BM6A 2JT6A 1JH1A 1PWWA 5LABA 1XAXA 3DTIA 1FM1A 2J0TA 3HDAP 2I47A 4I03A 2V4BA 3AYUA 1ZTQA 3O64A 1SATA 1R54A 4WF6A 4CTHA 2JIHA 3N2UA 4XM7A 3LUNA 2RJQA 2YIGA 5I3MA 4H1QA 456CA 3ZUKA 1XFYA 1XURA 4PKWA 2W14A 3B8ZA 2JT5A 3MA2A 2WO8A 1XFWA 5D1TA 3LMCA 1IADA 1S4BP 3LIRA 3L0TA 4AIGA 2MLRA 3EDGA 1EB6A 1ZS0A 4IUWA 5BOYA 5B5PA 3VI1A 3ELMA 2EROA 1EUBA 4XBHA 4ZR5A 2D1OA 3HDBA 4DD8A 1ROSA 4JPAA 1Y8JA 1SRPA 3LGPA 1XFXA 3EWJA 2OI0A 1D8MA 1J7NA 2W15A 1JAQA 3EHXA 1OO9A 4I35A 3DNGA 1XM5A 3KECA 1R1HA 3EDZA 4ILWD 3KHIA 4QKZA 5I43A 4PKUA 2TCLA 2FV5A 4PKSA 1UMTA 5D1UA
chains in the Genus database with same CATH topology
2WO9A 1XFUA 3ZVSA 1R1IA 1RMZA 1A86A 5JMYA 2JNPA 1ZVXA 2OW0A 1C8TA 2JSDA 3OHOA 4XM8A 1JIZA 2D1NA 3E8RA 4DPEA 1R55A 2OVXA 2ERPA 1IACA 1B3DA 3LQBA 1Y93A 3F18A 1QJIA 4WKEA 1G9KA 5B5OA 4JQGA 2Y6DA 4DF9A 1G4KA 2X3CA 1MNCA 3TVCA 1QJJA 2MLSA 3EDHA 1KUKA 1JANA 1GE6A 2OXUA 1OS2A 4WK7A 1GE7A 1DTHA 2DDFA 3HB2P 1D7XA 3DSLA 2POJA 1JIWP 1KUHA 3HBUP 5D7WA 2O3EA 1HV5A 2SRTA 2K2GA 1KUFA 4H30A 2DDYA 1CIZA 1FBLA 1O0QA 2MZHA 4FVLA 1G49A 3WV1A 2RJPA 4G9LA 1MMQA 5I2ZA 3LK8A 2DW0A 4WZVA 2WOAA 830CA 1USNA 4FU4A 5L7FA 4GUYA 1CGFA 3LJGA 1HFCA 4H76A 1YCMA 4JP4A 1K7QA 1C3IA 1D8FA 4XM6A 4GR8A 1Y0VA 2W13A 3U1RA 2QPJA 4DV8A 1XFVA 1YQYA 2O36A 1KAPP 1BQQM 1K7IA 1JAOA 1MMRA 1AF0A 2USNA 4GQLA 1CXVA 5CZMA 4L19A 4J4MA 3KEJA 3P24A 1RM8A 3F16A 4L63A 3HBVP 2A8HA 4H3XA 1BUVM 1CQRA 1Q3AA 1CK7A 3LEAA 1GO7P 1BKCE 1MMBA 1ZXCA 3GBOA 1BZSA 2X3AA 1G05A 3LE9A 1O0TA 4JA1A 2PJTA 1PWPA 2OW9A 4L7AA 1JJ9A 5BPAA 1WNIA 3K7LA 1A85A 1OM8A 4GWNA 1I73A 3DTKA 4PKQA 1EAKA 3N2VA 1SU3A 3TS4A 1GXDA 1UTZA 4WKIA 2OW2A 2OW1A 2CKIA 2Y6CA 3F15A 4L6TA 1IAGA 4Q1LA 4JIJA 1ZP5A 3ZXHA 3B2ZA 2OZRA 1SLNA 2W12A 1HY7A 1KUIA 1UMSA 1Z3JA 3AYKA 3KWVC 2HU6A 1BKCI 5D2BA 4GWMA 3EHYA 4IJOA 3KMEA 3VTGA 3LQ0A 2AYKA 2OY2A 2MZEA 1B8YA 2OY4A 4A3WA 1FLSA 1KUGA 4H84A 3USNA 1UTTA 3Q2GA 1XFZA 3Q2HA 1SMPA 1BQOA 4G0DA 5D1SA 1CAQA 1AYKA 2ERQA 1PWVA 4H82A 1I76A 2FV9A 4GR0A 5CUHA 4XCTA 3AIGA 3DTEA 3HY9A 3SHIA 1PWQA 5D3CA 2X3BA 1OS9A 1SLMA 3LJZA 1JK3A 3RTSA 2DW1A 1QIBA 1OM6A 4GF1A 3F19A 3I7IA 1ATLA 3HY7A 3P1VA 4AXQA 4EFSA 4GR3A 1BIWA 5I4OA 3B92A 1K7GA 3G42A 2MZIA 2N8RA 1UEAA 1KBCA 2L0RA 3WV2A 1GKDA 3TT4A 1GE5A 3EDIA 3LUMA 2XS3A 1OM7A 1HTDA 1GKCA 1CGLA 4PKTA 4PKRA 4R3VA 2OXZA 4HX3A 1R1JA 1JAPA 4FXQA 3TSKA 4A7BA 3UVCA 1G12A 1XUDA 3CKIA 1AKLA 2K9CA 1ZXVA 3DPFA 1XUCA 3KRYA 2OXWA 4H49A 2E2DA 3KMCA 1D5JA 1ND1A 2YUFA 3F1AA 3K7NA 4AYKA 3V96B 3DL1A 2KRJA 1YP1A 1H71P 2Z2DA 1PWUA 2XS4A 1JKYA 1CGEA 3LKAA 3WV3A 2J83A 2E3XA 3I7GA 1C7KA 966CA 5I12A 1IAEA 1QIAA 5L79A 1L6JA 3DWBA 1MMPA 3LJTA 3HYGA 3BA0A 1QUAA 3F17A 5H8XA 1GO8P 3L0VA 1HFSA 5BOTA 2YB9A 1IABA 3RTTA 4ON1A 5CXAA 3LIKA 2W0DA 2CLTA 5I0LA 2DW2A 4IN9A 4PKVA 3LILA 3O2XA 3OHLA 4H2EA 1HOVA 2OVZA 3KEKA 2X7MA 2AIGP 3G5CA 1QICA 3NX7A 1BSWA 4FXYP 1BUDA 1IAAA 1YOUA 3DPEA 4HMAA 1I1IP 1DMTA 1OMJA 1ASTA 4AUOA 1BKCA 1BM6A 2JT6A 1JH1A 1PWWA 5LABA 3DTIA 1FM1A 2J0TA 3HDAP 2I47A 4I03A 2V4BA 3AYUA 1ZTQA 3O64A 1SATA 1R54A 4WF6A 4CTHA 2JIHA 3N2UA 4XM7A 3LUNA 2RJQA 2YIGA 5I3MA 4H1QA 456CA 3ZUKA 1XFYA 1XURA 4PKWA 2W14A 3B8ZA 2JT5A 3MA2A 2WO8A 1XFWA 5D1TA 3LMCA 1IADA 1S4BP 3LIRA 3L0TA 4AIGA 2MLRA 3EDGA 1EB6A 1ZS0A 4IUWA 5BOYA 5B5PA 3VI1A 3ELMA 2EROA 1EUBA 4XBHA 4ZR5A 2D1OA 3HDBA 4DD8A 1ROSA 4JPAA 1Y8JA 1SRPA 3LGPA 1XFXA 3EWJA 2OI0A 1D8MA 1J7NA 2W15A 1JAQA 3EHXA 1OO9A 4I35A 3DNGA 3KECA 1R1HA 3EDZA 4ILWD 3KHIA 4QKZA 5I43A 4PKUA 2TCLA 2FV5A 4PKSA 1UMTA 5D1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WO9 A;  1XFU A;  3ZVS A;  1R1I A;  1RMZ A;  1A86 A;  5JMY A;  2JNP A;  1ZVX A;  2OW0 A;  1C8T A;  2JSD A;  3OHO A;  4XM8 A;  1JIZ A;  2D1N A;  3E8R A;  4DPE A;  1R55 A;  2OVX A;  2ERP A;  1IAC A;  1B3D A;  3LQB A;  1Y93 A;  3F18 A;  1QJI A;  4WKE A;  1G9K A;  5B5O A;  4JQG A;  2Y6D A;  4DF9 A;  1G4K A;  2X3C A;  1MNC A;  3TVC A;  1QJJ A;  2MLS A;  3EDH A;  1KUK A;  1JAN A;  1GE6 A;  2OXU A;  1OS2 A;  4WK7 A;  1GE7 A;  1DTH A;  2DDF A;  3HB2 P;  1D7X A;  3DSL A;  2POJ A;  1JIW P;  1KUH A;  3HBU P;  5D7W A;  2O3E A;  1HV5 A;  2SRT A;  2K2G A;  1KUF A;  4H30 A;  2DDY A;  1CIZ A;  1FBL A;  1O0Q A;  2MZH A;  4FVL A;  1G49 A;  3WV1 A;  2RJP A;  4G9L A;  1MMQ A;  5I2Z A;  3LK8 A;  2DW0 A;  4WZV A;  2WOA A;  830C A;  1USN A;  4FU4 A;  5L7F A;  4GUY A;  1CGF A;  3LJG A;  1HFC A;  4H76 A;  1YCM A;  4JP4 A;  1K7Q A;  1C3I A;  1D8F A;  4XM6 A;  4GR8 A;  1Y0V A;  2W13 A;  3U1R A;  2QPJ A;  4DV8 A;  1XFV A;  1YQY A;  2O36 A;  1KAP P;  1BQQ M;  1K7I A;  1JAO A;  1MMR A;  1AF0 A;  2USN A;  4GQL A;  1CXV A;  5CZM A;  4L19 A;  4J4M A;  3KEJ A;  3P24 A;  1RM8 A;  3F16 A;  4L63 A;  3HBV P;  2A8H A;  4H3X A;  1BUV M;  1CQR A;  1Q3A A;  1CK7 A;  3LEA A;  1GO7 P;  1BKC E;  1MMB A;  1ZXC A;  3GBO A;  1BZS A;  2X3A A;  1G05 A;  3LE9 A;  1O0T A;  4JA1 A;  2PJT A;  1PWP A;  2OW9 A;  1JJ9 A;  5BPA A;  1WNI A;  3K7L A;  1A85 A;  1OM8 A;  4GWN A;  1I73 A;  4PKQ A;  1EAK A;  3N2V A;  1SU3 A;  3TS4 A;  1GXD A;  1UTZ A;  4WKI A;  2OW2 A;  2OW1 A;  2CKI A;  2Y6C A;  3F15 A;  4L6T A;  1IAG A;  4Q1L A;  4JIJ A;  1ZP5 A;  3ZXH A;  3B2Z A;  2OZR A;  1SLN A;  2W12 A;  1HY7 A;  1KUI A;  1UMS A;  1Z3J A;  3AYK A;  3KWV C;  2HU6 A;  1BKC I;  5D2B A;  4GWM A;  3EHY A;  4IJO A;  3KME A;  3VTG A;  3LQ0 A;  2AYK A;  2OY2 A;  2MZE A;  1B8Y A;  2OY4 A;  4A3W A;  1FLS A;  1KUG A;  4H84 A;  3USN A;  1UTT A;  3Q2G A;  1XFZ A;  3Q2H A;  1SMP A;  1BQO A;  4G0D A;  5D1S A;  1CAQ A;  1AYK A;  2ERQ A;  1PWV A;  4H82 A;  1I76 A;  2FV9 A;  4GR0 A;  5CUH A;  4XCT A;  3AIG A;  3HY9 A;  3SHI A;  1PWQ A;  5D3C A;  2X3B A;  1OS9 A;  1SLM A;  3LJZ A;  1JK3 A;  3RTS A;  2DW1 A;  1QIB A;  1OM6 A;  4GF1 A;  3F19 A;  3I7I A;  1ATL A;  3HY7 A;  3P1V A;  4AXQ A;  4EFS A;  4GR3 A;  1BIW A;  5I4O A;  3B92 A;  1K7G A;  3G42 A;  2MZI A;  2N8R A;  1UEA A;  1KBC A;  2L0R A;  3WV2 A;  1GKD A;  3TT4 A;  1GE5 A;  3EDI A;  3LUM A;  2XS3 A;  1OM7 A;  1HTD A;  1GKC A;  1CGL A;  4PKT A;  4PKR A;  4R3V A;  2OXZ A;  4HX3 A;  1R1J A;  1JAP A;  4FXQ A;  3TSK A;  4A7B A;  3UVC A;  1G12 A;  1XUD A;  3CKI A;  1AKL A;  2K9C A;  1ZXV A;  3DPF A;  1XUC A;  3KRY A;  2OXW A;  4H49 A;  2E2D A;  3KMC A;  1D5J A;  1ND1 A;  3K7N A;  3F1A A;  4AYK A;  3V96 B;  3DL1 A;  2KRJ A;  1YP1 A;  1H71 P;  2Z2D A;  1PWU A;  2XS4 A;  1JKY A;  1CGE A;  3LKA A;  3WV3 A;  2J83 A;  2E3X A;  3I7G A;  1C7K A;  966C A;  5I12 A;  1IAE A;  1QIA A;  5L79 A;  1L6J A;  3DWB A;  1MMP A;  3LJT A;  3HYG A;  3BA0 A;  1QUA A;  3F17 A;  5H8X A;  1GO8 P;  3L0V A;  1HFS A;  5BOT A;  2YB9 A;  1IAB A;  3RTT A;  4ON1 A;  5CXA A;  3LIK A;  2W0D A;  2CLT A;  5I0L A;  2DW2 A;  4IN9 A;  4PKV A;  3LIL A;  3O2X A;  3OHL A;  4H2E A;  1HOV A;  2OVZ A;  3KEK A;  2X7M A;  2AIG P;  3G5C A;  1QIC A;  3NX7 A;  1BSW A;  4FXY P;  1BUD A;  1IAA A;  1YOU A;  3DPE A;  4HMA A;  1I1I P;  1DMT A;  1OMJ A;  1AST A;  4AUO A;  1BKC A;  1BM6 A;  2JT6 A;  1JH1 A;  1PWW A;  5LAB A;  1FM1 A;  2J0T A;  3HDA P;  2I47 A;  4I03 A;  2V4B A;  3AYU A;  1ZTQ A;  3O64 A;  1SAT A;  1R54 A;  4WF6 A;  4CTH A;  2JIH A;  3N2U A;  4XM7 A;  3LUN A;  2RJQ A;  2YIG A;  5I3M A;  4H1Q A;  456C A;  3ZUK A;  1XFY A;  1XUR A;  4PKW A;  2W14 A;  3B8Z A;  2JT5 A;  3MA2 A;  2WO8 A;  1XFW A;  5D1T A;  3LMC A;  1IAD A;  1S4B P;  3LIR A;  3L0T A;  4AIG A;  2MLR A;  3EDG A;  1EB6 A;  1ZS0 A;  4IUW A;  5BOY A;  5B5P A;  3VI1 A;  3ELM A;  2ERO A;  1EUB A;  4XBH A;  4ZR5 A;  2D1O A;  3HDB A;  4DD8 A;  1ROS A;  4JPA A;  1Y8J A;  1SRP A;  3LGP A;  1XFX A;  3EWJ A;  2OI0 A;  1D8M A;  1J7N A;  2W15 A;  1JAQ A;  3EHX A;  1OO9 A;  4I35 A;  3DNG A;  3KEC A;  1R1H A;  3EDZ A;  4ILW D;  3KHI A;  4QKZ A;  5I43 A;  4PKU A;  2TCL A;  2FV5 A;  4PKS A;  1UMT A;  5D1U A; 
#chains in the Genus database with same CATH topology
 2WO9 A;  1XFU A;  3ZVS A;  1R1I A;  1RMZ A;  1A86 A;  5JMY A;  2JNP A;  1ZVX A;  2OW0 A;  1C8T A;  2JSD A;  3OHO A;  4XM8 A;  1JIZ A;  2D1N A;  3E8R A;  4DPE A;  1R55 A;  2OVX A;  2ERP A;  1IAC A;  1B3D A;  3LQB A;  1Y93 A;  3F18 A;  1QJI A;  4WKE A;  1G9K A;  5B5O A;  4JQG A;  2Y6D A;  4DF9 A;  1G4K A;  2X3C A;  1MNC A;  3TVC A;  1OZ9 A;  1QJJ A;  2MLS A;  3EDH A;  1KUK A;  1JAN A;  1GE6 A;  2OXU A;  1OS2 A;  4WK7 A;  1GE7 A;  1DTH A;  2DDF A;  3HB2 P;  1D7X A;  3DSL A;  2POJ A;  1JIW P;  1KUH A;  3HBU P;  5D7W A;  2O3E A;  1HV5 A;  2SRT A;  1TVI A;  1KUF A;  2K2G A;  4H30 A;  2DDY A;  1CIZ A;  1FBL A;  1O0Q A;  2MZH A;  4FVL A;  1G49 A;  3WV1 A;  2RJP A;  4G9L A;  1MMQ A;  5I2Z A;  3LK8 A;  2DW0 A;  4WZV A;  2WOA A;  830C A;  1USN A;  4FU4 A;  5L7F A;  4GUY A;  1CGF A;  3LJG A;  1HFC A;  4H76 A;  1YCM A;  4JP4 A;  1K7Q A;  1C3I A;  1D8F A;  4XM6 A;  4GR8 A;  1Y0V A;  2W13 A;  3U1R A;  2QPJ A;  4DV8 A;  1XFV A;  1YQY A;  2O36 A;  1KAP P;  1BQQ M;  1K7I A;  1JAO A;  1MMR A;  1AF0 A;  2USN A;  4GQL A;  1CXV A;  5CZM A;  4L19 A;  4J4M A;  3KEJ A;  3P24 A;  1RM8 A;  3F16 A;  4L63 A;  3HBV P;  2A8H A;  4H3X A;  1BUV M;  1CQR A;  1Q3A A;  1CK7 A;  3LEA A;  1GO7 P;  1BKC E;  1MMB A;  1ZXC A;  3GBO A;  1BZS A;  2X3A A;  1G05 A;  3LE9 A;  1O0T A;  4JA1 A;  2PJT A;  1PWP A;  2OW9 A;  4L7A A;  1JJ9 A;  5BPA A;  1WNI A;  3K7L A;  1A85 A;  1OM8 A;  4GWN A;  1I73 A;  3DTK A;  4PKQ A;  1EAK A;  3N2V A;  1SU3 A;  3TS4 A;  1GXD A;  1UTZ A;  4WKI A;  2OW2 A;  2OW1 A;  2CKI A;  2Y6C A;  3F15 A;  4L6T A;  1IAG A;  4Q1L A;  4JIJ A;  1ZP5 A;  3ZXH A;  3B2Z A;  2OZR A;  1SLN A;  2W12 A;  1HY7 A;  1KUI A;  1UMS A;  1Z3J A;  3AYK A;  3KWV C;  2HU6 A;  1BKC I;  5D2B A;  4GWM A;  3EHY A;  4IJO A;  3KME A;  3VTG A;  3LQ0 A;  2AYK A;  2OY2 A;  2MZE A;  1B8Y A;  2OY4 A;  4A3W A;  1FLS A;  1KUG A;  4H84 A;  3USN A;  1UTT A;  3Q2G A;  1XFZ A;  3Q2H A;  1SMP A;  1BQO A;  4G0D A;  5D1S A;  1CAQ A;  1AYK A;  2ERQ A;  1PWV A;  4H82 A;  1I76 A;  2FV9 A;  4GR0 A;  5CUH A;  4XCT A;  3AIG A;  3DTE A;  3HY9 A;  3SHI A;  1PWQ A;  5D3C A;  2X3B A;  1OS9 A;  1SLM A;  3LJZ A;  1JK3 A;  3RTS A;  2DW1 A;  1QIB A;  1OM6 A;  4GF1 A;  3F19 A;  3I7I A;  1ATL A;  3HY7 A;  3P1V A;  4AXQ A;  4EFS A;  4GR3 A;  1BIW A;  5I4O A;  3B92 A;  1K7G A;  3G42 A;  2MZI A;  2N8R A;  1UEA A;  1KBC A;  2L0R A;  3WV2 A;  1GKD A;  3TT4 A;  1GE5 A;  3EDI A;  3LUM A;  2XS3 A;  1OM7 A;  1HTD A;  1GKC A;  1CGL A;  4PKT A;  4PKR A;  4R3V A;  2OXZ A;  4HX3 A;  1R1J A;  1JAP A;  4FXQ A;  3TSK A;  4A7B A;  3UVC A;  1G12 A;  1XUD A;  3CKI A;  1AKL A;  2K9C A;  1ZXV A;  3DPF A;  1XUC A;  3KRY A;  2OXW A;  4H49 A;  2E2D A;  3KMC A;  1D5J A;  1ND1 A;  2YUF A;  3F1A A;  3K7N A;  4AYK A;  3V96 B;  3DL1 A;  2KRJ A;  1YP1 A;  1H71 P;  2Z2D A;  1PWU A;  2XS4 A;  1JKY A;  1CGE A;  3LKA A;  3WV3 A;  2J83 A;  2E3X A;  3I7G A;  1C7K A;  966C A;  5I12 A;  1IAE A;  1QIA A;  5L79 A;  1L6J A;  3DWB A;  1MMP A;  3LJT A;  3HYG A;  3BA0 A;  1QUA A;  3F17 A;  5H8X A;  1GO8 P;  3L0V A;  1HFS A;  5BOT A;  2YB9 A;  1IAB A;  3RTT A;  4ON1 A;  5CXA A;  3LIK A;  2W0D A;  2CLT A;  5I0L A;  2DW2 A;  4IN9 A;  4PKV A;  3LIL A;  3O2X A;  3OHL A;  4H2E A;  1HOV A;  2OVZ A;  3KEK A;  2X7M A;  2AIG P;  3G5C A;  1QIC A;  3NX7 A;  1BSW A;  4FXY P;  1BUD A;  1IAA A;  1YOU A;  3DPE A;  4HMA A;  1I1I P;  1DMT A;  1OMJ A;  1AST A;  4AUO A;  1BKC A;  1BM6 A;  2JT6 A;  1JH1 A;  1PWW A;  5LAB A;  1XAX A;  3DTI A;  1FM1 A;  2J0T A;  3HDA P;  2I47 A;  4I03 A;  2V4B A;  3AYU A;  1ZTQ A;  3O64 A;  1SAT A;  1R54 A;  4WF6 A;  4CTH A;  2JIH A;  3N2U A;  4XM7 A;  3LUN A;  2RJQ A;  2YIG A;  5I3M A;  4H1Q A;  456C A;  3ZUK A;  1XFY A;  1XUR A;  4PKW A;  2W14 A;  3B8Z A;  2JT5 A;  3MA2 A;  2WO8 A;  1XFW A;  5D1T A;  3LMC A;  1IAD A;  1S4B P;  3LIR A;  3L0T A;  4AIG A;  2MLR A;  3EDG A;  1EB6 A;  1ZS0 A;  4IUW A;  5BOY A;  5B5P A;  3VI1 A;  3ELM A;  2ERO A;  1EUB A;  4XBH A;  4ZR5 A;  2D1O A;  3HDB A;  4DD8 A;  1ROS A;  4JPA A;  1Y8J A;  1SRP A;  3LGP A;  1XFX A;  3EWJ A;  2OI0 A;  1D8M A;  1J7N A;  2W15 A;  1JAQ A;  3EHX A;  1OO9 A;  4I35 A;  3DNG A;  1XM5 A;  3KEC A;  1R1H A;  3EDZ A;  4ILW D;  3KHI A;  4QKZ A;  5I43 A;  4PKU A;  2TCL A;  2FV5 A;  4PKS A;  1UMT A;  5D1U A; 
#chains in the Genus database with same CATH homology
 2WO9 A;  1XFU A;  3ZVS A;  1R1I A;  1RMZ A;  1A86 A;  5JMY A;  2JNP A;  1ZVX A;  2OW0 A;  1C8T A;  2JSD A;  3OHO A;  4XM8 A;  1JIZ A;  2D1N A;  3E8R A;  4DPE A;  1R55 A;  2OVX A;  2ERP A;  1IAC A;  1B3D A;  3LQB A;  1Y93 A;  3F18 A;  1QJI A;  4WKE A;  1G9K A;  5B5O A;  4JQG A;  2Y6D A;  4DF9 A;  1G4K A;  2X3C A;  1MNC A;  3TVC A;  1QJJ A;  2MLS A;  3EDH A;  1KUK A;  1JAN A;  1GE6 A;  2OXU A;  1OS2 A;  4WK7 A;  1GE7 A;  1DTH A;  2DDF A;  3HB2 P;  1D7X A;  3DSL A;  2POJ A;  1JIW P;  1KUH A;  3HBU P;  5D7W A;  2O3E A;  1HV5 A;  2SRT A;  2K2G A;  1KUF A;  4H30 A;  2DDY A;  1CIZ A;  1FBL A;  1O0Q A;  2MZH A;  4FVL A;  1G49 A;  3WV1 A;  2RJP A;  4G9L A;  1MMQ A;  5I2Z A;  3LK8 A;  2DW0 A;  4WZV A;  2WOA A;  830C A;  1USN A;  4FU4 A;  5L7F A;  4GUY A;  1CGF A;  3LJG A;  1HFC A;  4H76 A;  1YCM A;  4JP4 A;  1K7Q A;  1C3I A;  1D8F A;  4XM6 A;  4GR8 A;  1Y0V A;  2W13 A;  3U1R A;  2QPJ A;  4DV8 A;  1XFV A;  1YQY A;  2O36 A;  1KAP P;  1BQQ M;  1K7I A;  1JAO A;  1MMR A;  1AF0 A;  2USN A;  4GQL A;  1CXV A;  5CZM A;  4L19 A;  4J4M A;  3KEJ A;  3P24 A;  1RM8 A;  3F16 A;  4L63 A;  3HBV P;  2A8H A;  4H3X A;  1BUV M;  1CQR A;  1Q3A A;  1CK7 A;  3LEA A;  1GO7 P;  1BKC E;  1MMB A;  1ZXC A;  3GBO A;  1BZS A;  2X3A A;  1G05 A;  3LE9 A;  1O0T A;  4JA1 A;  2PJT A;  1PWP A;  2OW9 A;  4L7A A;  1JJ9 A;  5BPA A;  1WNI A;  3K7L A;  1A85 A;  1OM8 A;  4GWN A;  1I73 A;  3DTK A;  4PKQ A;  1EAK A;  3N2V A;  1SU3 A;  3TS4 A;  1GXD A;  1UTZ A;  4WKI A;  2OW2 A;  2OW1 A;  2CKI A;  2Y6C A;  3F15 A;  4L6T A;  1IAG A;  4Q1L A;  4JIJ A;  1ZP5 A;  3ZXH A;  3B2Z A;  2OZR A;  1SLN A;  2W12 A;  1HY7 A;  1KUI A;  1UMS A;  1Z3J A;  3AYK A;  3KWV C;  2HU6 A;  1BKC I;  5D2B A;  4GWM A;  3EHY A;  4IJO A;  3KME A;  3VTG A;  3LQ0 A;  2AYK A;  2OY2 A;  2MZE A;  1B8Y A;  2OY4 A;  4A3W A;  1FLS A;  1KUG A;  4H84 A;  3USN A;  1UTT A;  3Q2G A;  1XFZ A;  3Q2H A;  1SMP A;  1BQO A;  4G0D A;  5D1S A;  1CAQ A;  1AYK A;  2ERQ A;  1PWV A;  4H82 A;  1I76 A;  2FV9 A;  4GR0 A;  5CUH A;  4XCT A;  3AIG A;  3DTE A;  3HY9 A;  3SHI A;  1PWQ A;  5D3C A;  2X3B A;  1OS9 A;  1SLM A;  3LJZ A;  1JK3 A;  3RTS A;  2DW1 A;  1QIB A;  1OM6 A;  4GF1 A;  3F19 A;  3I7I A;  1ATL A;  3HY7 A;  3P1V A;  4AXQ A;  4EFS A;  4GR3 A;  1BIW A;  5I4O A;  3B92 A;  1K7G A;  3G42 A;  2MZI A;  2N8R A;  1UEA A;  1KBC A;  2L0R A;  3WV2 A;  1GKD A;  3TT4 A;  1GE5 A;  3EDI A;  3LUM A;  2XS3 A;  1OM7 A;  1HTD A;  1GKC A;  1CGL A;  4PKT A;  4PKR A;  4R3V A;  2OXZ A;  4HX3 A;  1R1J A;  1JAP A;  4FXQ A;  3TSK A;  4A7B A;  3UVC A;  1G12 A;  1XUD A;  3CKI A;  1AKL A;  2K9C A;  1ZXV A;  3DPF A;  1XUC A;  3KRY A;  2OXW A;  4H49 A;  2E2D A;  3KMC A;  1D5J A;  1ND1 A;  2YUF A;  3F1A A;  3K7N A;  4AYK A;  3V96 B;  3DL1 A;  2KRJ A;  1YP1 A;  1H71 P;  2Z2D A;  1PWU A;  2XS4 A;  1JKY A;  1CGE A;  3LKA A;  3WV3 A;  2J83 A;  2E3X A;  3I7G A;  1C7K A;  966C A;  5I12 A;  1IAE A;  1QIA A;  5L79 A;  1L6J A;  3DWB A;  1MMP A;  3LJT A;  3HYG A;  3BA0 A;  1QUA A;  3F17 A;  5H8X A;  1GO8 P;  3L0V A;  1HFS A;  5BOT A;  2YB9 A;  1IAB A;  3RTT A;  4ON1 A;  5CXA A;  3LIK A;  2W0D A;  2CLT A;  5I0L A;  2DW2 A;  4IN9 A;  4PKV A;  3LIL A;  3O2X A;  3OHL A;  4H2E A;  1HOV A;  2OVZ A;  3KEK A;  2X7M A;  2AIG P;  3G5C A;  1QIC A;  3NX7 A;  1BSW A;  4FXY P;  1BUD A;  1IAA A;  1YOU A;  3DPE A;  4HMA A;  1I1I P;  1DMT A;  1OMJ A;  1AST A;  4AUO A;  1BKC A;  1BM6 A;  2JT6 A;  1JH1 A;  1PWW A;  5LAB A;  3DTI A;  1FM1 A;  2J0T A;  3HDA P;  2I47 A;  4I03 A;  2V4B A;  3AYU A;  1ZTQ A;  3O64 A;  1SAT A;  1R54 A;  4WF6 A;  4CTH A;  2JIH A;  3N2U A;  4XM7 A;  3LUN A;  2RJQ A;  2YIG A;  5I3M A;  4H1Q A;  456C A;  3ZUK A;  1XFY A;  1XUR A;  4PKW A;  2W14 A;  3B8Z A;  2JT5 A;  3MA2 A;  2WO8 A;  1XFW A;  5D1T A;  3LMC A;  1IAD A;  1S4B P;  3LIR A;  3L0T A;  4AIG A;  2MLR A;  3EDG A;  1EB6 A;  1ZS0 A;  4IUW A;  5BOY A;  5B5P A;  3VI1 A;  3ELM A;  2ERO A;  1EUB A;  4XBH A;  4ZR5 A;  2D1O A;  3HDB A;  4DD8 A;  1ROS A;  4JPA A;  1Y8J A;  1SRP A;  3LGP A;  1XFX A;  3EWJ A;  2OI0 A;  1D8M A;  1J7N A;  2W15 A;  1JAQ A;  3EHX A;  1OO9 A;  4I35 A;  3DNG A;  3KEC A;  1R1H A;  3EDZ A;  4ILW D;  3KHI A;  4QKZ A;  5I43 A;  4PKU A;  2TCL A;  2FV5 A;  4PKS A;  1UMT A;  5D1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...