2KRJA

High-resolution solid-state nmr structure of a 17.6 kda protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
152
structure length
152
Chain Sequence
b'HYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title High-resolution solid-state NMR structure of a 17.6 kDa protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 152
sequence length 152
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2krjA00
5JMYA 2W15A 2D1OA 1JAPA 1OS2A 2O36A 3NX7A 4H1QA 1O0QA 3O64A 4AUOA 1EB6A 1G12A 1BZSA 1GE5A 1USNA 1Z3JA 3O2XA 4IUWA 1DTHA 2DW1A 2JSDA 4JIJA 3EDZA 3KEJA 4CTHA 2K2GA 4H84A 1KUKA 4I03A 1ASTA 1D8MA 1SRPA 1PWWA 4H3XA 1MMQA 2OW0A 1QJJA 1GKDA 1R1HA 3LJTA 4PKWA 1MMRA 2DW2A 3F19A 1YOUA 3L0VA 4XM7A 4XCTA 4WKIA 1B3DA 2X7MA 3AYKA 2X3CA 1UMTA 5BOYA 4WF6A 3DSLA 2OXUA 1ROSA 1UTTA 3EWJA 4H30A 3DPFA 2JIHA 3K7NA 4JQGA 1I73A 3KECA 4H76A 1WNIA 1GO7P 3LE9A 3LIRA 1QJIA 1Y8JA 3HDBA 2OW9A 3TT4A 4PKQA 1BUDA 1HTDA 1ZP5A 3B92A 4GR0A 2EROA 2I47A 3LUNA 2J83A 1SLNA 3Q2HA 2POJA 4AXQA 5BOTA 3LJZA 1OO9A 1BSWA 1ZXCA 3EDGA 4G9LA 1EUBA 1EAKA 1GO8P 2YIGA 1FM1A 3I7GA 2W13A 4JA1A 2O3EA 1I1IP 5I3MA 2V4BA 4DF9A 1MMPA 3B2ZA 2XS4A 1KUGA 4H82A 1IAEA 1IADA 1CXVA 3KHIA 1BKCI 4DV8A 1SU3A 1C8TA 2WO8A 3EHXA 1Y0VA 1H71P 1D8FA 1UEAA 4FVLA 2WOAA 1ZTQA 1CK7A 1XFYA 2TCLA 1GE6A 1JIZA 1JJ9A 1A86A 1PWPA 1DMTA 1R55A 2DW0A 3CKIA 3DL1A 3F15A 1S4BP 3ZUKA 1BQQM 2E2DA 5I12A 2USNA 2OZRA 1KAPP 1SLMA 2OVXA 2MZHA 1Q3AA 3RTTA 2FV9A 1XFUA 5LABA 3U1RA 1HFSA 2CLTA 1R54A 1A85A 2KRJA 5I2ZA 1RMZA 1JANA 3K7LA 3KWVC 3HDAP 4AIGA 1YQYA 3LUMA 4XM6A 1RM8A 2YB9A 1AF0A 4GUYA 1JAOA 1XURA 3AYUA 4I35A 1IABA 4WK7A 966CA 1K7QA 2RJPA 1XFWA 4HMAA 1G05A 3AIGA 1JH1A 4JP4A 3V96B 1FLSA 1YCMA 3SHIA 1C7KA 4GR8A 3TS4A 3N2UA 4DD8A 3HY9A 4H2EA 1CAQA 3EDHA 1QIAA 2MZIA 1PWUA 2QPJA 3KMEA 4H49A 1HY7A 1GE7A 2AIGP 1ATLA 2CKIA 1JIWP 1QIBA 2W0DA 1IAAA 1XFXA 3LKAA 2OW2A 1XUCA 1HOVA 3L0TA 2OXWA 830CA 3P1VA 1IACA 3P24A 3HBUP 1O0TA 2N8RA 5L7FA 1CGLA 3HYGA 5D1UA 1CGEA 4AYKA 3WV3A 5H8XA 1XFZA 5I0LA 3LQBA 4L63A 3EDIA 4PKUA 2OI0A 3EHYA 3E8RA 4J4MA 2JT6A 4Q1LA 1ZS0A 1BM6A 1BIWA 1FBLA 3KEKA 3WV2A 2AYKA 2E3XA 3HBVP 3F16A 1JKYA 4GR3A 4PKVA 1SATA 1SMPA 5B5OA 2K9CA 1OM6A 3WV1A 1OS9A 1PWVA 5B5PA 1R1JA 4GWNA 1AKLA 4EFSA 4A7BA 4DPEA 2X3AA 1R1IA 2DDFA 1JAQA 1OM8A 1D7XA 2JNPA 1UTZA 1ZXVA 4IN9A 1D5JA 2SRTA 1B8YA 4GF1A 456CA 2ERPA 2Y6DA 4L19A 2X3BA 2ERQA 4PKSA 2Y6CA 5I43A 2MZEA 2OY4A 1GXDA 3F17A 4FU4A 1YP1A 3DPEA 4FXQA 4ZR5A 3VTGA 1QUAA 3LEAA 5BPAA 1G9KA 3LMCA 4ON1A 2OW1A 4IJOA 3BA0A 1G4KA 1PWQA 4WZVA 1IAGA 1QICA 1K7IA 2PJTA 1L6JA 1MNCA 2A8HA 1JK3A 1ND1A 2OY2A 4G0DA 2XS3A 2MLSA 1KUIA 4GQLA 1GKCA 3HY7A 4L6TA 4JPAA 3ZXHA 3G5CA 2RJQA 1CGFA 4WKEA 3ZVSA 3HB2P 3DNGA 1CQRA 3B8ZA 3OHOA 5L79A 2FV5A 4PKTA 3TSKA 4GWMA 1XFVA 2J0TA 2WO9A 3LIKA 2Z2DA 1I76A 3ELMA 4A3WA 1J7NA 4FXYP 2HU6A 1C3IA 4HX3A 1BKCE 3LGPA 3MA2A 3VI1A 5CZMA 1UMSA 1BQOA 2DDYA 1HV5A 2JT5A 3UVCA 1G49A 3LK8A 2OXZA 5CUHA 3OHLA 1KBCA 2MLRA 3N2VA 1HFCA 3KRYA 3F1AA 1AYKA 1KUHA 5I4OA 3Q2GA 5D1SA 3LQ0A 4ILWD 5D3CA 1Y93A 1BKCA 3F18A 5D7WA 3LILA 4QKZA 5D1TA 3LJGA 3RTSA 4XM8A 4PKRA 1CIZA 3G42A 5D2BA 1XUDA 1ZVXA 4R3VA 3GBOA 2OVZA 1OMJA 4XBHA 3USNA 2L0RA 2W14A 3I7IA 3DWBA 3KMCA 3TVCA 2D1NA 1KUFA 2W12A 1BUVM 5CXAA 1OM7A 1MMBA 1K7GA
chains in the Genus database with same CATH superfamily
5JMYA 2W15A 2D1OA 1JAPA 1OS2A 2O36A 3NX7A 4H1QA 1O0QA 3O64A 4AUOA 1EB6A 1G12A 1BZSA 1GE5A 1USNA 1Z3JA 3O2XA 4IUWA 1DTHA 2DW1A 2JSDA 4JIJA 3EDZA 3KEJA 4CTHA 2K2GA 4H84A 1KUKA 4I03A 1ASTA 1D8MA 1SRPA 1PWWA 4H3XA 1MMQA 2OW0A 1QJJA 1GKDA 1R1HA 3LJTA 4PKWA 1MMRA 2DW2A 3F19A 1YOUA 3L0VA 4XM7A 4XCTA 4WKIA 1B3DA 2X7MA 3AYKA 2X3CA 1UMTA 5BOYA 4WF6A 3DSLA 2OXUA 1ROSA 1UTTA 3EWJA 4H30A 3DPFA 2JIHA 3K7NA 4JQGA 1I73A 3KECA 4H76A 1WNIA 1GO7P 3LE9A 3LIRA 1QJIA 1Y8JA 3HDBA 2OW9A 3TT4A 4PKQA 1BUDA 1HTDA 1ZP5A 3B92A 4GR0A 2EROA 2I47A 3LUNA 2J83A 1SLNA 3Q2HA 2POJA 4AXQA 5BOTA 3LJZA 1OO9A 1BSWA 1ZXCA 3EDGA 4G9LA 1EUBA 1EAKA 1GO8P 2YIGA 1FM1A 3I7GA 2W13A 4JA1A 2O3EA 1I1IP 5I3MA 2V4BA 4DF9A 1MMPA 3B2ZA 2XS4A 1KUGA 4H82A 1IAEA 1IADA 1CXVA 3KHIA 1BKCI 4DV8A 3DTIA 1SU3A 1C8TA 2WO8A 3EHXA 1Y0VA 1H71P 1D8FA 1UEAA 4FVLA 2WOAA 1ZTQA 1CK7A 1XFYA 2TCLA 1GE6A 1JIZA 1JJ9A 1A86A 1PWPA 1DMTA 1R55A 2DW0A 3CKIA 3DL1A 3F15A 1S4BP 3ZUKA 1BQQM 2E2DA 5I12A 2USNA 2OZRA 1KAPP 1SLMA 2OVXA 2MZHA 1Q3AA 3RTTA 2FV9A 1XFUA 5LABA 3U1RA 1HFSA 2CLTA 1R54A 1A85A 2KRJA 5I2ZA 1RMZA 1JANA 3K7LA 3KWVC 3HDAP 4AIGA 1YQYA 3LUMA 4XM6A 1RM8A 2YB9A 1AF0A 4GUYA 1OZ9A 1JAOA 1XURA 3AYUA 1XAXA 4I35A 1IABA 4WK7A 966CA 1K7QA 2RJPA 1XFWA 4HMAA 1G05A 3AIGA 1JH1A 4JP4A 3V96B 1FLSA 1YCMA 3SHIA 1C7KA 4GR8A 3TS4A 3N2UA 4DD8A 3HY9A 4H2EA 1CAQA 3EDHA 1QIAA 2MZIA 1PWUA 2QPJA 3KMEA 4H49A 1HY7A 1TVIA 1GE7A 2AIGP 1ATLA 2CKIA 1JIWP 1QIBA 2W0DA 1IAAA 1XFXA 3LKAA 2OW2A 1XUCA 1HOVA 3L0TA 2OXWA 830CA 3P1VA 1IACA 3P24A 3HBUP 1O0TA 2N8RA 5L7FA 1CGLA 3HYGA 5D1UA 1CGEA 4AYKA 3WV3A 5H8XA 1XFZA 5I0LA 3LQBA 4L63A 3EDIA 4PKUA 2OI0A 3EHYA 3E8RA 4J4MA 2JT6A 4Q1LA 1ZS0A 1BM6A 1BIWA 1FBLA 3KEKA 3WV2A 2AYKA 2E3XA 3HBVP 3F16A 1JKYA 4GR3A 4PKVA 1SATA 1SMPA 5B5OA 2K9CA 1OM6A 3WV1A 1OS9A 1PWVA 5B5PA 1R1JA 4GWNA 1AKLA 4EFSA 4A7BA 4DPEA 2X3AA 1R1IA 2DDFA 1JAQA 1OM8A 1D7XA 3DTEA 2JNPA 1UTZA 1ZXVA 4IN9A 1D5JA 2SRTA 1B8YA 4GF1A 456CA 2ERPA 2Y6DA 4L19A 2X3BA 2ERQA 4PKSA 2Y6CA 2YUFA 5I43A 2MZEA 2OY4A 1GXDA 3F17A 4FU4A 1YP1A 3DPEA 4FXQA 4ZR5A 3VTGA 1QUAA 3LEAA 5BPAA 1G9KA 3LMCA 4ON1A 2OW1A 4IJOA 3BA0A 1G4KA 1PWQA 4WZVA 1IAGA 1QICA 1K7IA 2PJTA 1L6JA 1MNCA 2A8HA 1JK3A 1ND1A 2OY2A 4G0DA 2XS3A 2MLSA 1KUIA 4GQLA 1GKCA 3HY7A 4L6TA 4JPAA 3ZXHA 3G5CA 2RJQA 1CGFA 4WKEA 3ZVSA 3HB2P 3DNGA 1CQRA 3B8ZA 3OHOA 5L79A 2FV5A 4PKTA 3TSKA 4GWMA 1XFVA 2J0TA 2WO9A 3LIKA 2Z2DA 1I76A 3ELMA 4A3WA 1J7NA 4FXYP 2HU6A 1C3IA 4HX3A 1BKCE 3LGPA 3MA2A 3VI1A 5CZMA 1UMSA 1BQOA 2DDYA 1HV5A 2JT5A 3UVCA 1G49A 3DTKA 3LK8A 2OXZA 5CUHA 3OHLA 1KBCA 2MLRA 3N2VA 1HFCA 3KRYA 3F1AA 1AYKA 1KUHA 5I4OA 3Q2GA 5D1SA 3LQ0A 4ILWD 5D3CA 1Y93A 1BKCA 3F18A 5D7WA 3LILA 4QKZA 5D1TA 3LJGA 3RTSA 1XM5A 4XM8A 4PKRA 1CIZA 3G42A 5D2BA 1XUDA 1ZVXA 4R3VA 3GBOA 2OVZA 1OMJA 4XBHA 3USNA 2L0RA 2W14A 3I7IA 3DWBA 3KMCA 4L7AA 3TVCA 2D1NA 1KUFA 2W12A 1BUVM 5CXAA 1OM7A 1MMBA 1K7GA
chains in the Genus database with same CATH topology
5JMYA 2W15A 2D1OA 1JAPA 1OS2A 2O36A 3NX7A 4H1QA 1O0QA 3O64A 4AUOA 1EB6A 1G12A 1BZSA 1GE5A 1USNA 1Z3JA 3O2XA 4IUWA 1DTHA 2DW1A 2JSDA 4JIJA 3EDZA 3KEJA 4CTHA 2K2GA 4H84A 1KUKA 4I03A 1ASTA 1D8MA 1SRPA 1PWWA 4H3XA 1MMQA 2OW0A 1QJJA 1GKDA 1R1HA 3LJTA 4PKWA 1MMRA 2DW2A 3F19A 1YOUA 3L0VA 4XM7A 4XCTA 4WKIA 1B3DA 2X7MA 3AYKA 2X3CA 1UMTA 5BOYA 4WF6A 3DSLA 2OXUA 1ROSA 1UTTA 3EWJA 4H30A 3DPFA 2JIHA 3K7NA 4JQGA 1I73A 3KECA 4H76A 1WNIA 1GO7P 3LE9A 3LIRA 1QJIA 1Y8JA 3HDBA 2OW9A 3TT4A 4PKQA 1BUDA 1HTDA 1ZP5A 3B92A 4GR0A 2EROA 2I47A 3LUNA 2J83A 1SLNA 3Q2HA 2POJA 4AXQA 5BOTA 3LJZA 1OO9A 1BSWA 1ZXCA 3EDGA 4G9LA 1EUBA 1EAKA 1GO8P 2YIGA 1FM1A 3I7GA 2W13A 4JA1A 2O3EA 1I1IP 5I3MA 2V4BA 4DF9A 1MMPA 3B2ZA 2XS4A 1KUGA 4H82A 1IAEA 1IADA 1CXVA 3KHIA 1BKCI 4DV8A 3DTIA 1SU3A 1C8TA 2WO8A 3EHXA 1Y0VA 1H71P 1D8FA 1UEAA 4FVLA 2WOAA 1ZTQA 1CK7A 1XFYA 2TCLA 1GE6A 1JIZA 1JJ9A 1A86A 1PWPA 1DMTA 1R55A 2DW0A 3CKIA 3DL1A 3F15A 1S4BP 3ZUKA 1BQQM 2E2DA 5I12A 2USNA 2OZRA 1KAPP 1SLMA 2OVXA 2MZHA 1Q3AA 3RTTA 2FV9A 1XFUA 5LABA 3U1RA 1HFSA 2CLTA 1R54A 1A85A 2KRJA 5I2ZA 1RMZA 1JANA 3K7LA 3KWVC 3HDAP 4AIGA 1YQYA 3LUMA 4XM6A 1RM8A 2YB9A 1AF0A 4GUYA 1JAOA 1XURA 3AYUA 4I35A 1IABA 4WK7A 966CA 1K7QA 2RJPA 1XFWA 4HMAA 1G05A 3AIGA 1JH1A 4JP4A 3V96B 1FLSA 1YCMA 3SHIA 1C7KA 4GR8A 3TS4A 3N2UA 4DD8A 3HY9A 4H2EA 1CAQA 3EDHA 1QIAA 2MZIA 1PWUA 2QPJA 3KMEA 4H49A 1HY7A 1GE7A 2AIGP 1ATLA 2CKIA 1JIWP 1QIBA 2W0DA 1IAAA 1XFXA 3LKAA 2OW2A 1XUCA 1HOVA 3L0TA 2OXWA 830CA 3P1VA 1IACA 3P24A 3HBUP 1O0TA 2N8RA 5L7FA 1CGLA 3HYGA 5D1UA 1CGEA 4AYKA 3WV3A 5H8XA 1XFZA 5I0LA 3LQBA 4L63A 3EDIA 4PKUA 2OI0A 3EHYA 3E8RA 4J4MA 2JT6A 4Q1LA 1ZS0A 1BM6A 1BIWA 1FBLA 3KEKA 3WV2A 2AYKA 2E3XA 3HBVP 3F16A 1JKYA 4GR3A 4PKVA 1SATA 1SMPA 5B5OA 2K9CA 1OM6A 3WV1A 1OS9A 1PWVA 5B5PA 1R1JA 4GWNA 1AKLA 4EFSA 4A7BA 4DPEA 2X3AA 1R1IA 2DDFA 1JAQA 1OM8A 1D7XA 3DTEA 2JNPA 1UTZA 1ZXVA 4IN9A 1D5JA 2SRTA 1B8YA 4GF1A 456CA 2ERPA 2Y6DA 4L19A 2X3BA 2ERQA 4PKSA 2Y6CA 2YUFA 5I43A 2MZEA 2OY4A 1GXDA 3F17A 4FU4A 1YP1A 3DPEA 4FXQA 4ZR5A 3VTGA 1QUAA 3LEAA 5BPAA 1G9KA 3LMCA 4ON1A 2OW1A 4IJOA 3BA0A 1G4KA 1PWQA 4WZVA 1IAGA 1QICA 1K7IA 2PJTA 1L6JA 1MNCA 2A8HA 1JK3A 1ND1A 2OY2A 4G0DA 2XS3A 2MLSA 1KUIA 4GQLA 1GKCA 3HY7A 4L6TA 4JPAA 3ZXHA 3G5CA 2RJQA 1CGFA 4WKEA 3ZVSA 3HB2P 3DNGA 1CQRA 3B8ZA 3OHOA 5L79A 2FV5A 4PKTA 3TSKA 4GWMA 1XFVA 2J0TA 2WO9A 3LIKA 2Z2DA 1I76A 3ELMA 4A3WA 1J7NA 4FXYP 2HU6A 1C3IA 4HX3A 1BKCE 3LGPA 3MA2A 3VI1A 5CZMA 1UMSA 1BQOA 2DDYA 1HV5A 2JT5A 3UVCA 1G49A 3DTKA 3LK8A 2OXZA 5CUHA 3OHLA 1KBCA 2MLRA 3N2VA 1HFCA 3KRYA 3F1AA 1AYKA 1KUHA 5I4OA 3Q2GA 5D1SA 3LQ0A 4ILWD 5D3CA 1Y93A 1BKCA 3F18A 5D7WA 3LILA 4QKZA 5D1TA 3LJGA 3RTSA 4XM8A 4PKRA 1CIZA 3G42A 5D2BA 1XUDA 1ZVXA 4R3VA 3GBOA 2OVZA 1OMJA 4XBHA 3USNA 2L0RA 2W14A 3I7IA 3DWBA 3KMCA 4L7AA 3TVCA 2D1NA 1KUFA 2W12A 1BUVM 5CXAA 1OM7A 1MMBA 1K7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JMY A;  2W15 A;  2D1O A;  1JAP A;  1OS2 A;  2O36 A;  3NX7 A;  4H1Q A;  1O0Q A;  3O64 A;  4AUO A;  1EB6 A;  1G12 A;  1BZS A;  1GE5 A;  1USN A;  1Z3J A;  3O2X A;  4IUW A;  1DTH A;  2DW1 A;  2JSD A;  4JIJ A;  3EDZ A;  3KEJ A;  4CTH A;  2K2G A;  4H84 A;  1KUK A;  4I03 A;  1AST A;  1D8M A;  1SRP A;  1PWW A;  4H3X A;  1MMQ A;  2OW0 A;  1QJJ A;  1GKD A;  1R1H A;  3LJT A;  4PKW A;  1MMR A;  2DW2 A;  3F19 A;  1YOU A;  3L0V A;  4XM7 A;  4XCT A;  4WKI A;  1B3D A;  2X7M A;  3AYK A;  2X3C A;  1UMT A;  5BOY A;  4WF6 A;  3DSL A;  2OXU A;  1ROS A;  1UTT A;  3EWJ A;  4H30 A;  3DPF A;  2JIH A;  3K7N A;  4JQG A;  1I73 A;  3KEC A;  4H76 A;  1WNI A;  1GO7 P;  3LE9 A;  3LIR A;  1QJI A;  1Y8J A;  3HDB A;  2OW9 A;  3TT4 A;  4PKQ A;  1BUD A;  1HTD A;  1ZP5 A;  3B92 A;  4GR0 A;  2ERO A;  2I47 A;  3LUN A;  2J83 A;  1SLN A;  3Q2H A;  2POJ A;  4AXQ A;  5BOT A;  3LJZ A;  1OO9 A;  1BSW A;  1ZXC A;  3EDG A;  4G9L A;  1EUB A;  1EAK A;  1GO8 P;  2YIG A;  1FM1 A;  3I7G A;  2W13 A;  4JA1 A;  2O3E A;  1I1I P;  5I3M A;  2V4B A;  4DF9 A;  1MMP A;  3B2Z A;  2XS4 A;  1KUG A;  4H82 A;  1IAE A;  1IAD A;  1CXV A;  3KHI A;  1BKC I;  4DV8 A;  1SU3 A;  1C8T A;  2WO8 A;  3EHX A;  1Y0V A;  1H71 P;  1D8F A;  1UEA A;  4FVL A;  2WOA A;  1ZTQ A;  1CK7 A;  1XFY A;  2TCL A;  1GE6 A;  1JIZ A;  1JJ9 A;  1A86 A;  1PWP A;  1DMT A;  1R55 A;  2DW0 A;  3CKI A;  3DL1 A;  3F15 A;  1S4B P;  3ZUK A;  1BQQ M;  2E2D A;  5I12 A;  2USN A;  2OZR A;  1KAP P;  1SLM A;  2OVX A;  2MZH A;  1Q3A A;  3RTT A;  2FV9 A;  1XFU A;  5LAB A;  3U1R A;  1HFS A;  2CLT A;  1R54 A;  1A85 A;  2KRJ A;  5I2Z A;  1RMZ A;  1JAN A;  3K7L A;  3KWV C;  3HDA P;  4AIG A;  1YQY A;  3LUM A;  4XM6 A;  1RM8 A;  2YB9 A;  1AF0 A;  4GUY A;  1JAO A;  1XUR A;  3AYU A;  4I35 A;  1IAB A;  4WK7 A;  966C A;  1K7Q A;  2RJP A;  1XFW A;  4HMA A;  1G05 A;  3AIG A;  1JH1 A;  4JP4 A;  3V96 B;  1FLS A;  1YCM A;  3SHI A;  1C7K A;  4GR8 A;  3TS4 A;  3N2U A;  4DD8 A;  3HY9 A;  4H2E A;  1CAQ A;  3EDH A;  1QIA A;  2MZI A;  1PWU A;  2QPJ A;  3KME A;  4H49 A;  1HY7 A;  1GE7 A;  2AIG P;  1ATL A;  2CKI A;  1JIW P;  1QIB A;  2W0D A;  1IAA A;  1XFX A;  3LKA A;  2OW2 A;  1XUC A;  1HOV A;  3L0T A;  2OXW A;  830C A;  3P1V A;  1IAC A;  3P24 A;  3HBU P;  1O0T A;  2N8R A;  5L7F A;  1CGL A;  3HYG A;  5D1U A;  1CGE A;  4AYK A;  3WV3 A;  5H8X A;  1XFZ A;  5I0L A;  3LQB A;  4L63 A;  3EDI A;  4PKU A;  2OI0 A;  3EHY A;  3E8R A;  4J4M A;  2JT6 A;  4Q1L A;  1ZS0 A;  1BM6 A;  1BIW A;  1FBL A;  3KEK A;  3WV2 A;  2AYK A;  2E3X A;  3HBV P;  3F16 A;  1JKY A;  4GR3 A;  4PKV A;  1SAT A;  1SMP A;  5B5O A;  2K9C A;  1OM6 A;  3WV1 A;  1OS9 A;  1PWV A;  5B5P A;  1R1J A;  4GWN A;  1AKL A;  4EFS A;  4A7B A;  4DPE A;  2X3A A;  1R1I A;  2DDF A;  1JAQ A;  1OM8 A;  1D7X A;  2JNP A;  1UTZ A;  1ZXV A;  4IN9 A;  1D5J A;  2SRT A;  1B8Y A;  4GF1 A;  456C A;  2ERP A;  2Y6D A;  4L19 A;  2X3B A;  2ERQ A;  4PKS A;  2Y6C A;  5I43 A;  2MZE A;  2OY4 A;  1GXD A;  3F17 A;  4FU4 A;  1YP1 A;  3DPE A;  4FXQ A;  4ZR5 A;  3VTG A;  1QUA A;  3LEA A;  5BPA A;  1G9K A;  3LMC A;  4ON1 A;  2OW1 A;  4IJO A;  3BA0 A;  1G4K A;  1PWQ A;  4WZV A;  1IAG A;  1QIC A;  1K7I A;  2PJT A;  1L6J A;  1MNC A;  2A8H A;  1JK3 A;  1ND1 A;  2OY2 A;  4G0D A;  2XS3 A;  2MLS A;  1KUI A;  4GQL A;  1GKC A;  3HY7 A;  4L6T A;  4JPA A;  3ZXH A;  3G5C A;  2RJQ A;  1CGF A;  4WKE A;  3ZVS A;  3HB2 P;  3DNG A;  1CQR A;  3B8Z A;  3OHO A;  5L79 A;  2FV5 A;  4PKT A;  3TSK A;  4GWM A;  1XFV A;  2J0T A;  2WO9 A;  3LIK A;  2Z2D A;  1I76 A;  3ELM A;  4A3W A;  1J7N A;  4FXY P;  2HU6 A;  1C3I A;  4HX3 A;  1BKC E;  3LGP A;  3MA2 A;  3VI1 A;  5CZM A;  1UMS A;  1BQO A;  2DDY A;  1HV5 A;  2JT5 A;  3UVC A;  1G49 A;  3LK8 A;  2OXZ A;  5CUH A;  3OHL A;  1KBC A;  2MLR A;  3N2V A;  1HFC A;  3KRY A;  3F1A A;  1AYK A;  1KUH A;  5I4O A;  3Q2G A;  5D1S A;  3LQ0 A;  4ILW D;  5D3C A;  1Y93 A;  1BKC A;  3F18 A;  5D7W A;  3LIL A;  4QKZ A;  5D1T A;  3LJG A;  3RTS A;  4XM8 A;  4PKR A;  1CIZ A;  3G42 A;  5D2B A;  1XUD A;  1ZVX A;  4R3V A;  3GBO A;  2OVZ A;  1OMJ A;  4XBH A;  3USN A;  2L0R A;  2W14 A;  3I7I A;  3DWB A;  3KMC A;  3TVC A;  2D1N A;  1KUF A;  2W12 A;  1BUV M;  5CXA A;  1OM7 A;  1MMB A;  1K7G A; 
#chains in the Genus database with same CATH topology
 5JMY A;  2W15 A;  2D1O A;  1JAP A;  1OS2 A;  2O36 A;  3NX7 A;  4H1Q A;  1O0Q A;  3O64 A;  4AUO A;  1EB6 A;  1G12 A;  1BZS A;  1GE5 A;  1USN A;  1Z3J A;  3O2X A;  4IUW A;  1DTH A;  2DW1 A;  2JSD A;  4JIJ A;  3EDZ A;  3KEJ A;  4CTH A;  2K2G A;  4H84 A;  1KUK A;  4I03 A;  1AST A;  1D8M A;  1SRP A;  1PWW A;  4H3X A;  1MMQ A;  2OW0 A;  1QJJ A;  1GKD A;  1R1H A;  3LJT A;  4PKW A;  1MMR A;  2DW2 A;  3F19 A;  1YOU A;  3L0V A;  4XM7 A;  4XCT A;  4WKI A;  1B3D A;  2X7M A;  3AYK A;  2X3C A;  1UMT A;  5BOY A;  4WF6 A;  3DSL A;  2OXU A;  1ROS A;  1UTT A;  3EWJ A;  4H30 A;  3DPF A;  2JIH A;  3K7N A;  4JQG A;  1I73 A;  3KEC A;  4H76 A;  1WNI A;  1GO7 P;  3LE9 A;  3LIR A;  1QJI A;  1Y8J A;  3HDB A;  2OW9 A;  3TT4 A;  4PKQ A;  1BUD A;  1HTD A;  1ZP5 A;  3B92 A;  4GR0 A;  2ERO A;  2I47 A;  3LUN A;  2J83 A;  1SLN A;  3Q2H A;  2POJ A;  4AXQ A;  5BOT A;  3LJZ A;  1OO9 A;  1BSW A;  1ZXC A;  3EDG A;  4G9L A;  1EUB A;  1EAK A;  1GO8 P;  2YIG A;  1FM1 A;  3I7G A;  2W13 A;  4JA1 A;  2O3E A;  1I1I P;  5I3M A;  2V4B A;  4DF9 A;  1MMP A;  3B2Z A;  2XS4 A;  1KUG A;  4H82 A;  1IAE A;  1IAD A;  1CXV A;  3KHI A;  1BKC I;  4DV8 A;  3DTI A;  1SU3 A;  1C8T A;  2WO8 A;  3EHX A;  1Y0V A;  1H71 P;  1D8F A;  1UEA A;  4FVL A;  2WOA A;  1ZTQ A;  1CK7 A;  1XFY A;  2TCL A;  1GE6 A;  1JIZ A;  1JJ9 A;  1A86 A;  1PWP A;  1DMT A;  1R55 A;  2DW0 A;  3CKI A;  3DL1 A;  3F15 A;  1S4B P;  3ZUK A;  1BQQ M;  2E2D A;  5I12 A;  2USN A;  2OZR A;  1KAP P;  1SLM A;  2OVX A;  2MZH A;  1Q3A A;  3RTT A;  2FV9 A;  1XFU A;  5LAB A;  3U1R A;  1HFS A;  2CLT A;  1R54 A;  1A85 A;  2KRJ A;  5I2Z A;  1RMZ A;  1JAN A;  3K7L A;  3KWV C;  3HDA P;  4AIG A;  1YQY A;  3LUM A;  4XM6 A;  1RM8 A;  2YB9 A;  1AF0 A;  4GUY A;  1OZ9 A;  1JAO A;  1XUR A;  3AYU A;  1XAX A;  4I35 A;  1IAB A;  4WK7 A;  966C A;  1K7Q A;  2RJP A;  1XFW A;  4HMA A;  1G05 A;  3AIG A;  1JH1 A;  4JP4 A;  3V96 B;  1FLS A;  1YCM A;  3SHI A;  1C7K A;  4GR8 A;  3TS4 A;  3N2U A;  4DD8 A;  3HY9 A;  4H2E A;  1CAQ A;  3EDH A;  1QIA A;  2MZI A;  1PWU A;  2QPJ A;  3KME A;  4H49 A;  1HY7 A;  1TVI A;  1GE7 A;  2AIG P;  1ATL A;  2CKI A;  1JIW P;  1QIB A;  2W0D A;  1IAA A;  1XFX A;  3LKA A;  2OW2 A;  1XUC A;  1HOV A;  3L0T A;  2OXW A;  830C A;  3P1V A;  1IAC A;  3P24 A;  3HBU P;  1O0T A;  2N8R A;  5L7F A;  1CGL A;  3HYG A;  5D1U A;  1CGE A;  4AYK A;  3WV3 A;  5H8X A;  1XFZ A;  5I0L A;  3LQB A;  4L63 A;  3EDI A;  4PKU A;  2OI0 A;  3EHY A;  3E8R A;  4J4M A;  2JT6 A;  4Q1L A;  1ZS0 A;  1BM6 A;  1BIW A;  1FBL A;  3KEK A;  3WV2 A;  2AYK A;  2E3X A;  3HBV P;  3F16 A;  1JKY A;  4GR3 A;  4PKV A;  1SAT A;  1SMP A;  5B5O A;  2K9C A;  1OM6 A;  3WV1 A;  1OS9 A;  1PWV A;  5B5P A;  1R1J A;  4GWN A;  1AKL A;  4EFS A;  4A7B A;  4DPE A;  2X3A A;  1R1I A;  2DDF A;  1JAQ A;  1OM8 A;  1D7X A;  3DTE A;  2JNP A;  1UTZ A;  1ZXV A;  4IN9 A;  1D5J A;  2SRT A;  1B8Y A;  4GF1 A;  456C A;  2ERP A;  2Y6D A;  4L19 A;  2X3B A;  2ERQ A;  4PKS A;  2Y6C A;  2YUF A;  5I43 A;  2MZE A;  2OY4 A;  1GXD A;  3F17 A;  4FU4 A;  1YP1 A;  3DPE A;  4FXQ A;  4ZR5 A;  3VTG A;  1QUA A;  3LEA A;  5BPA A;  1G9K A;  3LMC A;  4ON1 A;  2OW1 A;  4IJO A;  3BA0 A;  1G4K A;  1PWQ A;  4WZV A;  1IAG A;  1QIC A;  1K7I A;  2PJT A;  1L6J A;  1MNC A;  2A8H A;  1JK3 A;  1ND1 A;  2OY2 A;  4G0D A;  2XS3 A;  2MLS A;  1KUI A;  4GQL A;  1GKC A;  3HY7 A;  4L6T A;  4JPA A;  3ZXH A;  3G5C A;  2RJQ A;  1CGF A;  4WKE A;  3ZVS A;  3HB2 P;  3DNG A;  1CQR A;  3B8Z A;  3OHO A;  5L79 A;  2FV5 A;  4PKT A;  3TSK A;  4GWM A;  1XFV A;  2J0T A;  2WO9 A;  3LIK A;  2Z2D A;  1I76 A;  3ELM A;  4A3W A;  1J7N A;  4FXY P;  2HU6 A;  1C3I A;  4HX3 A;  1BKC E;  3LGP A;  3MA2 A;  3VI1 A;  5CZM A;  1UMS A;  1BQO A;  2DDY A;  1HV5 A;  2JT5 A;  3UVC A;  1G49 A;  3DTK A;  3LK8 A;  2OXZ A;  5CUH A;  3OHL A;  1KBC A;  2MLR A;  3N2V A;  1HFC A;  3KRY A;  3F1A A;  1AYK A;  1KUH A;  5I4O A;  3Q2G A;  5D1S A;  3LQ0 A;  4ILW D;  5D3C A;  1Y93 A;  1BKC A;  3F18 A;  5D7W A;  3LIL A;  4QKZ A;  5D1T A;  3LJG A;  3RTS A;  1XM5 A;  4XM8 A;  4PKR A;  1CIZ A;  3G42 A;  5D2B A;  1XUD A;  1ZVX A;  4R3V A;  3GBO A;  2OVZ A;  1OMJ A;  4XBH A;  3USN A;  2L0R A;  2W14 A;  3I7I A;  3DWB A;  3KMC A;  4L7A A;  3TVC A;  2D1N A;  1KUF A;  2W12 A;  1BUV M;  5CXA A;  1OM7 A;  1MMB A;  1K7G A; 
#chains in the Genus database with same CATH homology
 5JMY A;  2W15 A;  2D1O A;  1JAP A;  1OS2 A;  2O36 A;  3NX7 A;  4H1Q A;  1O0Q A;  3O64 A;  4AUO A;  1EB6 A;  1G12 A;  1BZS A;  1GE5 A;  1USN A;  1Z3J A;  3O2X A;  4IUW A;  1DTH A;  2DW1 A;  2JSD A;  4JIJ A;  3EDZ A;  3KEJ A;  4CTH A;  2K2G A;  4H84 A;  1KUK A;  4I03 A;  1AST A;  1D8M A;  1SRP A;  1PWW A;  4H3X A;  1MMQ A;  2OW0 A;  1QJJ A;  1GKD A;  1R1H A;  3LJT A;  4PKW A;  1MMR A;  2DW2 A;  3F19 A;  1YOU A;  3L0V A;  4XM7 A;  4XCT A;  4WKI A;  1B3D A;  2X7M A;  3AYK A;  2X3C A;  1UMT A;  5BOY A;  4WF6 A;  3DSL A;  2OXU A;  1ROS A;  1UTT A;  3EWJ A;  4H30 A;  3DPF A;  2JIH A;  3K7N A;  4JQG A;  1I73 A;  3KEC A;  4H76 A;  1WNI A;  1GO7 P;  3LE9 A;  3LIR A;  1QJI A;  1Y8J A;  3HDB A;  2OW9 A;  3TT4 A;  4PKQ A;  1BUD A;  1HTD A;  1ZP5 A;  3B92 A;  4GR0 A;  2ERO A;  2I47 A;  3LUN A;  2J83 A;  1SLN A;  3Q2H A;  2POJ A;  4AXQ A;  5BOT A;  3LJZ A;  1OO9 A;  1BSW A;  1ZXC A;  3EDG A;  4G9L A;  1EUB A;  1EAK A;  1GO8 P;  2YIG A;  1FM1 A;  3I7G A;  2W13 A;  4JA1 A;  2O3E A;  1I1I P;  5I3M A;  2V4B A;  4DF9 A;  1MMP A;  3B2Z A;  2XS4 A;  1KUG A;  4H82 A;  1IAE A;  1IAD A;  1CXV A;  3KHI A;  1BKC I;  4DV8 A;  3DTI A;  1SU3 A;  1C8T A;  2WO8 A;  3EHX A;  1Y0V A;  1H71 P;  1D8F A;  1UEA A;  4FVL A;  2WOA A;  1ZTQ A;  1CK7 A;  1XFY A;  2TCL A;  1GE6 A;  1JIZ A;  1JJ9 A;  1A86 A;  1PWP A;  1DMT A;  1R55 A;  2DW0 A;  3CKI A;  3DL1 A;  3F15 A;  1S4B P;  3ZUK A;  1BQQ M;  2E2D A;  5I12 A;  2USN A;  2OZR A;  1KAP P;  1SLM A;  2OVX A;  2MZH A;  1Q3A A;  3RTT A;  2FV9 A;  1XFU A;  5LAB A;  3U1R A;  1HFS A;  2CLT A;  1R54 A;  1A85 A;  2KRJ A;  5I2Z A;  1RMZ A;  1JAN A;  3K7L A;  3KWV C;  3HDA P;  4AIG A;  1YQY A;  3LUM A;  4XM6 A;  1RM8 A;  2YB9 A;  1AF0 A;  4GUY A;  1JAO A;  1XUR A;  3AYU A;  4I35 A;  1IAB A;  4WK7 A;  966C A;  1K7Q A;  2RJP A;  1XFW A;  4HMA A;  1G05 A;  3AIG A;  1JH1 A;  4JP4 A;  3V96 B;  1FLS A;  1YCM A;  3SHI A;  1C7K A;  4GR8 A;  3TS4 A;  3N2U A;  4DD8 A;  3HY9 A;  4H2E A;  1CAQ A;  3EDH A;  1QIA A;  2MZI A;  1PWU A;  2QPJ A;  3KME A;  4H49 A;  1HY7 A;  1GE7 A;  2AIG P;  1ATL A;  2CKI A;  1JIW P;  1QIB A;  2W0D A;  1IAA A;  1XFX A;  3LKA A;  2OW2 A;  1XUC A;  1HOV A;  3L0T A;  2OXW A;  830C A;  3P1V A;  1IAC A;  3P24 A;  3HBU P;  1O0T A;  2N8R A;  5L7F A;  1CGL A;  3HYG A;  5D1U A;  1CGE A;  4AYK A;  3WV3 A;  5H8X A;  1XFZ A;  5I0L A;  3LQB A;  4L63 A;  3EDI A;  4PKU A;  2OI0 A;  3EHY A;  3E8R A;  4J4M A;  2JT6 A;  4Q1L A;  1ZS0 A;  1BM6 A;  1BIW A;  1FBL A;  3KEK A;  3WV2 A;  2AYK A;  2E3X A;  3HBV P;  3F16 A;  1JKY A;  4GR3 A;  4PKV A;  1SAT A;  1SMP A;  5B5O A;  2K9C A;  1OM6 A;  3WV1 A;  1OS9 A;  1PWV A;  5B5P A;  1R1J A;  4GWN A;  1AKL A;  4EFS A;  4A7B A;  4DPE A;  2X3A A;  1R1I A;  2DDF A;  1JAQ A;  1OM8 A;  1D7X A;  3DTE A;  2JNP A;  1UTZ A;  1ZXV A;  4IN9 A;  1D5J A;  2SRT A;  1B8Y A;  4GF1 A;  456C A;  2ERP A;  2Y6D A;  4L19 A;  2X3B A;  2ERQ A;  4PKS A;  2Y6C A;  2YUF A;  5I43 A;  2MZE A;  2OY4 A;  1GXD A;  3F17 A;  4FU4 A;  1YP1 A;  3DPE A;  4FXQ A;  4ZR5 A;  3VTG A;  1QUA A;  3LEA A;  5BPA A;  1G9K A;  3LMC A;  4ON1 A;  2OW1 A;  4IJO A;  3BA0 A;  1G4K A;  1PWQ A;  4WZV A;  1IAG A;  1QIC A;  1K7I A;  2PJT A;  1L6J A;  1MNC A;  2A8H A;  1JK3 A;  1ND1 A;  2OY2 A;  4G0D A;  2XS3 A;  2MLS A;  1KUI A;  4GQL A;  1GKC A;  3HY7 A;  4L6T A;  4JPA A;  3ZXH A;  3G5C A;  2RJQ A;  1CGF A;  4WKE A;  3ZVS A;  3HB2 P;  3DNG A;  1CQR A;  3B8Z A;  3OHO A;  5L79 A;  2FV5 A;  4PKT A;  3TSK A;  4GWM A;  1XFV A;  2J0T A;  2WO9 A;  3LIK A;  2Z2D A;  1I76 A;  3ELM A;  4A3W A;  1J7N A;  4FXY P;  2HU6 A;  1C3I A;  4HX3 A;  1BKC E;  3LGP A;  3MA2 A;  3VI1 A;  5CZM A;  1UMS A;  1BQO A;  2DDY A;  1HV5 A;  2JT5 A;  3UVC A;  1G49 A;  3DTK A;  3LK8 A;  2OXZ A;  5CUH A;  3OHL A;  1KBC A;  2MLR A;  3N2V A;  1HFC A;  3KRY A;  3F1A A;  1AYK A;  1KUH A;  5I4O A;  3Q2G A;  5D1S A;  3LQ0 A;  4ILW D;  5D3C A;  1Y93 A;  1BKC A;  3F18 A;  5D7W A;  3LIL A;  4QKZ A;  5D1T A;  3LJG A;  3RTS A;  4XM8 A;  4PKR A;  1CIZ A;  3G42 A;  5D2B A;  1XUD A;  1ZVX A;  4R3V A;  3GBO A;  2OVZ A;  1OMJ A;  4XBH A;  3USN A;  2L0R A;  2W14 A;  3I7I A;  3DWB A;  3KMC A;  4L7A A;  3TVC A;  2D1N A;  1KUF A;  2W12 A;  1BUV M;  5CXA A;  1OM7 A;  1MMB A;  1K7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...