1ROSA

Crystal structure of mmp-12 complexed to 2-(1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)ethyl-4-(4-ethoxy[1,1-biphenyl]-4-yl)-4-oxobutanoic acid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Macrophage metalloelastase
publication title Crystal structures of novel non-peptidic, non-zinc chelating inhibitors bound to MMP-12.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1rosA00
4AXQA 3N2VA 2DW0A 1J7NA 1Y93A 2MZHA 5I3MA 3LK8A 1CXVA 1OMJA 3SHIA 3L0TA 4L6TA 3AYUA 1HV5A 4PKRA 2FV5A 1B3DA 1KUFA 1SU3A 4FVLA 2D1NA 4J4MA 1OM8A 4L19A 1G49A 3AYKA 1QICA 5I12A 1O0TA 2MLRA 1BUDA 1XUCA 1MMPA 4H30A 4PKVA 3F16A 3VTGA 1BQQM 5D1TA 4XCTA 1XFVA 2E3XA 2OZRA 2WO9A 3E8RA 1K7GA 1OS9A 1BZSA 2OI0A 1ZP5A 4WKIA 1ATLA 1JAPA 2OW0A 5I43A 2JIHA 1KAPP 1RMZA 1SLMA 2ERQA 1GE5A 4EFSA 2ERPA 4A7BA 3HBUP 2K2GA 3HY9A 4H82A 3TS4A 4A3WA 1IADA 3K7NA 3F15A 1BM6A 2E2DA 3B92A 4GUYA 1BIWA 2O3EA 2FV9A 3KRYA 1PWPA 1MMQA 3Q2GA 1MMRA 1AF0A 3DWBA 2O36A 4JIJA 1G9KA 4AUOA 1DTHA 1D7XA 2W12A 2Z2DA 4IJOA 4GQLA 1Y8JA 2X3CA 2I47A 1CQRA 3KEJA 1SRPA 1IACA 5D1SA 1D8FA 1PWUA 2AIGP 3O2XA 1UEAA 1AYKA 2X7MA 1FLSA 1BQOA 1IAAA 830CA 4PKWA 3HYGA 1K7IA 1Q3AA 2L0RA 4ON1A 3AIGA 4H76A 2XS4A 2EROA 1L6JA 2MZIA 4G0DA 2OY4A 3WV1A 1OM6A 1XFUA 3B2ZA 1HFCA 2V4BA 3LGPA 4XM6A 1B8YA 3DSLA 3ZUKA 4H49A 966CA 2OW1A 2WO8A 1JIZA 1YCMA 2POJA 1KUIA 4ILWD 2RJQA 3RTSA 3USNA 3LE9A 1OS2A 3HDBA 3B8ZA 5B5OA 1UMSA 2W14A 3LEAA 5L79A 4AYKA 5L7FA 1SLNA 3DPFA 2OXWA 4DPEA 1QUAA 2J0TA 2AYKA 2XS3A 1YQYA 2JNPA 5I2ZA 3CKIA 4PKQA 1IAGA 3KMCA 3F17A 1BKCA 1ZXCA 3LJZA 5JMYA 1UTTA 4WK7A 5D3CA 1XURA 1IABA 3LILA 1R1JA 3WV2A 3RTTA 2D1OA 1HTDA 2MZEA 4Q1LA 3KMEA 2RJPA 4JQGA 3EDHA 5D1UA 1KBCA 1QJJA 2USNA 4HX3A 3K7LA 1D5JA 1HY7A 5CUHA 1GE7A 4GR0A 3G5CA 4GR3A 1R1IA 3EHYA 2OXZA 3KHIA 1K7QA 3HDAP 3TT4A 4ZR5A 5LABA 4I35A 3WV3A 1UMTA 1GXDA 1G12A 5D2BA 1XFXA 1WNIA 1CGEA 1IAEA 3EDGA 4H2EA 5I0LA 1BKCE 3LUMA 1OO9A 5BOYA 2YB9A 5B5PA 2W13A 1GO8P 1PWWA 1I76A 1JH1A 1QJIA 3Q2HA 4H84A 2J83A 3LMCA 1JKYA 3ELMA 1A85A 4WKEA 3V96B 1RM8A 3L0VA 1ASTA 3P1VA 4QKZA 1C7KA 1R55A 3HY7A 3VI1A 1HFSA 2OVXA 1C3IA 3I7IA 1PWVA 2OW2A 2KRJA 1UTZA 4JPAA 3DPEA 4DD8A 1BKCI 1PWQA 4DF9A 1GKCA 1G4KA 3LIRA 4H1QA 4CTHA 4DV8A 1YP1A 2X3AA 4JA1A 2OY2A 2CLTA 3ZVSA 3KEKA 1Y0VA 2X3BA 2MLSA 2PJTA 3G42A 4FXQA 4FU4A 1CIZA 3F1AA 1H71P 1JJ9A 1CK7A 4PKSA 3TSKA 1OM7A 4WF6A 4GWNA 1Z3JA 4I03A 4FXYP 4PKTA 2DDYA 3LIKA 3DL1A 3LJTA 5CXAA 1MNCA 3O64A 3MA2A 1ZXVA 3OHOA 2HU6A 1G05A 3N2UA 2QPJA 4XM8A 2JSDA 4IUWA 3UVCA 1XUDA 2CKIA 2Y6DA 2DW1A 1D8MA 456CA 1FBLA 3LUNA 1USNA 1EAKA 3ZXHA 1JANA 1ZVXA 4GF1A 5CZMA 1JIWP 1YOUA 2OW9A 3I7GA 3U1RA 3F18A 1SMPA 1JAQA 2A8HA 3TVCA 5I4OA 1HOVA 4H3XA 2W0DA 3LQBA 1ROSA 2JT6A 3LKAA 1JK3A 3P24A 1ZS0A 4WZVA 1CGFA 4HMAA 5BOTA 1GO7P 1I1IP 3HB2P 1XFWA 3KWVC 1R54A 3NX7A 1MMBA 1GKDA 1BUVM 4IN9A 1C8TA 4PKUA 1KUKA 4XM7A 2SRTA 2N8RA 4JP4A 1QIBA 3EDIA 1KUHA 2OVZA 1CGLA 2YIGA 1CAQA 4GR8A 3HBVP 1KUGA 2OXUA 3F19A 1BSWA 1SATA 2DW2A 1EB6A 1EUBA 3LJGA 3EDZA 1JAOA 3LQ0A 3DNGA 5H8XA 2W15A 4XBHA 2K9CA 1A86A 1XFZA 5BPAA 1QIAA 1I73A 3BA0A 2WOAA 1DMTA 1ZTQA 1ND1A 1GE6A 4G9LA 3EWJA 5D7WA 3GBOA 3OHLA 2JT5A 1FM1A 1O0QA 3EHXA 4R3VA 1S4BP 2DDFA 1XFYA 2TCLA 3KECA 4L63A 1AKLA 2Y6CA 1R1HA 4AIGA 4GWMA
chains in the Genus database with same CATH superfamily
4AXQA 3N2VA 2DW0A 1J7NA 2YUFA 1Y93A 2MZHA 5I3MA 3LK8A 1CXVA 1OMJA 3SHIA 3L0TA 4L6TA 3AYUA 1HV5A 4PKRA 2FV5A 1B3DA 1KUFA 1SU3A 4FVLA 2D1NA 4J4MA 1OM8A 4L19A 1G49A 3AYKA 1QICA 5I12A 1O0TA 2MLRA 1BUDA 1XUCA 1MMPA 4H30A 4PKVA 3F16A 3VTGA 1BQQM 5D1TA 4XCTA 1XFVA 2E3XA 2OZRA 2WO9A 3E8RA 1K7GA 1OS9A 1BZSA 2OI0A 1ZP5A 4WKIA 1ATLA 1JAPA 2OW0A 5I43A 2JIHA 1KAPP 1RMZA 1SLMA 2ERQA 1GE5A 4EFSA 2ERPA 4A7BA 3HBUP 2K2GA 3HY9A 4H82A 3TS4A 4A3WA 1IADA 3K7NA 3F15A 1BM6A 2E2DA 3B92A 4GUYA 1BIWA 2O3EA 2FV9A 3KRYA 1PWPA 1MMQA 3Q2GA 1MMRA 1AF0A 1TVIA 3DWBA 2O36A 4JIJA 1G9KA 4AUOA 1DTHA 1D7XA 2W12A 2Z2DA 4IJOA 4GQLA 1Y8JA 2X3CA 2I47A 1CQRA 3KEJA 1SRPA 1IACA 5D1SA 1D8FA 1PWUA 2AIGP 3O2XA 1UEAA 1AYKA 2X7MA 1FLSA 1BQOA 1IAAA 830CA 4PKWA 3HYGA 1K7IA 1XAXA 1Q3AA 2L0RA 4ON1A 3AIGA 4H76A 2XS4A 2EROA 1L6JA 2MZIA 4G0DA 3DTKA 2OY4A 1XM5A 3WV1A 1OM6A 1XFUA 3B2ZA 1HFCA 2V4BA 3LGPA 4XM6A 1B8YA 3DSLA 3ZUKA 4H49A 966CA 2OW1A 2WO8A 1JIZA 1YCMA 2POJA 1KUIA 4ILWD 2RJQA 3RTSA 3USNA 3LE9A 1OS2A 3HDBA 3B8ZA 5B5OA 1UMSA 2W14A 3LEAA 5L79A 4AYKA 5L7FA 1SLNA 3DPFA 2OXWA 4DPEA 1QUAA 2J0TA 2AYKA 2XS3A 1YQYA 2JNPA 5I2ZA 3CKIA 4PKQA 1IAGA 3KMCA 3F17A 1BKCA 1ZXCA 3LJZA 5JMYA 1UTTA 4WK7A 5D3CA 1XURA 1IABA 3LILA 1R1JA 3WV2A 3RTTA 2D1OA 1HTDA 2MZEA 4Q1LA 3KMEA 2RJPA 4JQGA 3EDHA 5D1UA 1KBCA 1QJJA 2USNA 4HX3A 3K7LA 1D5JA 1HY7A 5CUHA 1GE7A 4GR0A 3G5CA 4GR3A 1R1IA 3EHYA 2OXZA 3KHIA 1K7QA 3HDAP 3TT4A 4ZR5A 5LABA 4I35A 3WV3A 1UMTA 1GXDA 1G12A 5D2BA 1XFXA 1WNIA 1CGEA 1IAEA 3EDGA 4H2EA 5I0LA 1BKCE 3LUMA 1OO9A 5BOYA 2YB9A 5B5PA 2W13A 1GO8P 1PWWA 1I76A 1JH1A 1QJIA 3Q2HA 4H84A 2J83A 3LMCA 1JKYA 3ELMA 1A85A 4WKEA 3V96B 1RM8A 3L0VA 1ASTA 3P1VA 4QKZA 1C7KA 1R55A 3HY7A 3VI1A 1HFSA 2OVXA 1C3IA 3I7IA 1PWVA 2OW2A 2KRJA 1UTZA 4JPAA 3DPEA 4DD8A 1BKCI 1PWQA 4DF9A 1GKCA 1G4KA 3LIRA 4H1QA 4CTHA 4DV8A 1YP1A 2X3AA 4JA1A 2OY2A 2CLTA 3ZVSA 3KEKA 1Y0VA 2X3BA 2MLSA 2PJTA 3G42A 4FXQA 4FU4A 1CIZA 3F1AA 1H71P 1JJ9A 1CK7A 4PKSA 3TSKA 1OM7A 4WF6A 4GWNA 1Z3JA 4I03A 4FXYP 4PKTA 2DDYA 3LIKA 3DL1A 3LJTA 5CXAA 1MNCA 3O64A 3MA2A 1ZXVA 3OHOA 2HU6A 1G05A 3N2UA 2QPJA 4XM8A 2JSDA 4IUWA 3UVCA 1XUDA 2CKIA 2Y6DA 2DW1A 1D8MA 456CA 1FBLA 3LUNA 1USNA 1EAKA 3ZXHA 1JANA 1ZVXA 4GF1A 5CZMA 1JIWP 1YOUA 2OW9A 3I7GA 3U1RA 3F18A 1SMPA 1JAQA 2A8HA 3TVCA 3DTIA 5I4OA 1HOVA 4H3XA 2W0DA 3LQBA 1ROSA 2JT6A 3LKAA 1JK3A 3P24A 1ZS0A 4WZVA 1CGFA 4HMAA 5BOTA 1GO7P 1I1IP 3HB2P 1XFWA 3KWVC 1R54A 3NX7A 1MMBA 1GKDA 1BUVM 4IN9A 1C8TA 4PKUA 1KUKA 4XM7A 2SRTA 2N8RA 4JP4A 1QIBA 3EDIA 1KUHA 2OVZA 1CGLA 2YIGA 1CAQA 4GR8A 3HBVP 1KUGA 2OXUA 3F19A 1BSWA 1SATA 2DW2A 1EB6A 1EUBA 3LJGA 3EDZA 1JAOA 3LQ0A 3DNGA 5H8XA 2W15A 4XBHA 2K9CA 4L7AA 1A86A 1XFZA 5BPAA 1QIAA 1I73A 3BA0A 2WOAA 1DMTA 1ZTQA 1OZ9A 1ND1A 1GE6A 4G9LA 3EWJA 5D7WA 3GBOA 3OHLA 2JT5A 1FM1A 1O0QA 3DTEA 3EHXA 4R3VA 1S4BP 2DDFA 1XFYA 2TCLA 3KECA 4L63A 1AKLA 2Y6CA 1R1HA 4AIGA 4GWMA
chains in the Genus database with same CATH topology
4AXQA 3N2VA 2DW0A 1J7NA 2YUFA 1Y93A 2MZHA 5I3MA 3LK8A 1CXVA 1OMJA 3SHIA 3L0TA 4L6TA 3AYUA 1HV5A 4PKRA 2FV5A 1B3DA 1KUFA 1SU3A 4FVLA 2D1NA 4J4MA 1OM8A 4L19A 1G49A 3AYKA 1QICA 5I12A 1O0TA 2MLRA 1BUDA 1XUCA 1MMPA 4H30A 4PKVA 3F16A 3VTGA 1BQQM 5D1TA 4XCTA 1XFVA 2E3XA 2OZRA 2WO9A 3E8RA 1K7GA 1OS9A 1BZSA 2OI0A 1ZP5A 4WKIA 1ATLA 1JAPA 2OW0A 5I43A 2JIHA 1KAPP 1RMZA 1SLMA 2ERQA 1GE5A 4EFSA 2ERPA 4A7BA 3HBUP 2K2GA 3HY9A 4H82A 3TS4A 4A3WA 1IADA 3K7NA 3F15A 1BM6A 2E2DA 3B92A 4GUYA 1BIWA 2O3EA 2FV9A 3KRYA 1PWPA 1MMQA 3Q2GA 1MMRA 1AF0A 3DWBA 2O36A 4JIJA 1G9KA 4AUOA 1DTHA 1D7XA 2W12A 2Z2DA 4IJOA 4GQLA 1Y8JA 2X3CA 2I47A 1CQRA 3KEJA 1SRPA 1IACA 5D1SA 1D8FA 1PWUA 2AIGP 3O2XA 1UEAA 1AYKA 2X7MA 1FLSA 1BQOA 1IAAA 830CA 4PKWA 3HYGA 1K7IA 1Q3AA 2L0RA 4ON1A 3AIGA 4H76A 2XS4A 2EROA 1L6JA 2MZIA 4G0DA 3DTKA 2OY4A 3WV1A 1OM6A 1XFUA 3B2ZA 1HFCA 2V4BA 3LGPA 4XM6A 1B8YA 3DSLA 3ZUKA 4H49A 966CA 2OW1A 2WO8A 1JIZA 1YCMA 2POJA 1KUIA 4ILWD 2RJQA 3RTSA 3USNA 3LE9A 1OS2A 3HDBA 3B8ZA 5B5OA 1UMSA 2W14A 3LEAA 5L79A 4AYKA 5L7FA 1SLNA 3DPFA 2OXWA 4DPEA 1QUAA 2J0TA 2AYKA 2XS3A 1YQYA 2JNPA 5I2ZA 3CKIA 4PKQA 1IAGA 3KMCA 3F17A 1BKCA 1ZXCA 3LJZA 5JMYA 1UTTA 4WK7A 5D3CA 1XURA 1IABA 3LILA 1R1JA 3WV2A 3RTTA 2D1OA 1HTDA 2MZEA 4Q1LA 3KMEA 2RJPA 4JQGA 3EDHA 5D1UA 1KBCA 1QJJA 2USNA 4HX3A 3K7LA 1D5JA 1HY7A 5CUHA 1GE7A 4GR0A 3G5CA 4GR3A 1R1IA 3EHYA 2OXZA 3KHIA 1K7QA 3HDAP 3TT4A 4ZR5A 5LABA 4I35A 3WV3A 1UMTA 1GXDA 1G12A 5D2BA 1XFXA 1WNIA 1CGEA 1IAEA 3EDGA 4H2EA 5I0LA 1BKCE 3LUMA 1OO9A 5BOYA 2YB9A 5B5PA 2W13A 1GO8P 1PWWA 1I76A 1JH1A 1QJIA 3Q2HA 4H84A 2J83A 3LMCA 1JKYA 3ELMA 1A85A 4WKEA 3V96B 1RM8A 3L0VA 1ASTA 3P1VA 4QKZA 1C7KA 1R55A 3HY7A 3VI1A 1HFSA 2OVXA 1C3IA 3I7IA 1PWVA 2OW2A 2KRJA 1UTZA 4JPAA 3DPEA 4DD8A 1BKCI 1PWQA 4DF9A 1GKCA 1G4KA 3LIRA 4H1QA 4CTHA 4DV8A 1YP1A 2X3AA 4JA1A 2OY2A 2CLTA 3ZVSA 3KEKA 1Y0VA 2X3BA 2MLSA 2PJTA 3G42A 4FXQA 4FU4A 1CIZA 3F1AA 1H71P 1JJ9A 1CK7A 4PKSA 3TSKA 1OM7A 4WF6A 4GWNA 1Z3JA 4I03A 4FXYP 4PKTA 2DDYA 3LIKA 3DL1A 3LJTA 5CXAA 1MNCA 3O64A 3MA2A 1ZXVA 3OHOA 2HU6A 1G05A 3N2UA 2QPJA 4XM8A 2JSDA 4IUWA 3UVCA 1XUDA 2CKIA 2Y6DA 2DW1A 1D8MA 456CA 1FBLA 3LUNA 1USNA 1EAKA 3ZXHA 1JANA 1ZVXA 4GF1A 5CZMA 1JIWP 1YOUA 2OW9A 3I7GA 3U1RA 3F18A 1SMPA 1JAQA 2A8HA 3TVCA 3DTIA 5I4OA 1HOVA 4H3XA 2W0DA 3LQBA 1ROSA 2JT6A 3LKAA 1JK3A 3P24A 1ZS0A 4WZVA 1CGFA 4HMAA 5BOTA 1GO7P 1I1IP 3HB2P 1XFWA 3KWVC 1R54A 3NX7A 1MMBA 1GKDA 1BUVM 4IN9A 1C8TA 4PKUA 1KUKA 4XM7A 2SRTA 2N8RA 4JP4A 1QIBA 3EDIA 1KUHA 2OVZA 1CGLA 2YIGA 1CAQA 4GR8A 3HBVP 1KUGA 2OXUA 3F19A 1BSWA 1SATA 2DW2A 1EB6A 1EUBA 3LJGA 3EDZA 1JAOA 3LQ0A 3DNGA 5H8XA 2W15A 4XBHA 2K9CA 4L7AA 1A86A 1XFZA 5BPAA 1QIAA 1I73A 3BA0A 2WOAA 1DMTA 1ZTQA 1ND1A 1GE6A 4G9LA 3EWJA 5D7WA 3GBOA 3OHLA 2JT5A 1FM1A 1O0QA 3DTEA 3EHXA 4R3VA 1S4BP 2DDFA 1XFYA 2TCLA 3KECA 4L63A 1AKLA 2Y6CA 1R1HA 4AIGA 4GWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AXQ A;  3N2V A;  2DW0 A;  1J7N A;  1Y93 A;  2MZH A;  5I3M A;  3LK8 A;  1CXV A;  1OMJ A;  3SHI A;  3L0T A;  4L6T A;  3AYU A;  1HV5 A;  4PKR A;  2FV5 A;  1B3D A;  1KUF A;  1SU3 A;  4FVL A;  2D1N A;  4J4M A;  1OM8 A;  4L19 A;  1G49 A;  3AYK A;  1QIC A;  5I12 A;  1O0T A;  2MLR A;  1BUD A;  1XUC A;  1MMP A;  4H30 A;  4PKV A;  3F16 A;  3VTG A;  1BQQ M;  5D1T A;  4XCT A;  1XFV A;  2E3X A;  2OZR A;  2WO9 A;  3E8R A;  1K7G A;  1OS9 A;  1BZS A;  2OI0 A;  1ZP5 A;  4WKI A;  1ATL A;  1JAP A;  2OW0 A;  5I43 A;  2JIH A;  1KAP P;  1RMZ A;  1SLM A;  2ERQ A;  1GE5 A;  4EFS A;  2ERP A;  4A7B A;  3HBU P;  2K2G A;  3HY9 A;  4H82 A;  3TS4 A;  4A3W A;  1IAD A;  3K7N A;  3F15 A;  1BM6 A;  2E2D A;  3B92 A;  4GUY A;  1BIW A;  2O3E A;  2FV9 A;  3KRY A;  1PWP A;  1MMQ A;  3Q2G A;  1MMR A;  1AF0 A;  3DWB A;  2O36 A;  4JIJ A;  1G9K A;  4AUO A;  1DTH A;  1D7X A;  2W12 A;  2Z2D A;  4IJO A;  4GQL A;  1Y8J A;  2X3C A;  2I47 A;  1CQR A;  3KEJ A;  1SRP A;  1IAC A;  5D1S A;  1D8F A;  1PWU A;  2AIG P;  3O2X A;  1UEA A;  1AYK A;  2X7M A;  1FLS A;  1BQO A;  1IAA A;  830C A;  4PKW A;  3HYG A;  1K7I A;  1Q3A A;  2L0R A;  4ON1 A;  3AIG A;  4H76 A;  2XS4 A;  2ERO A;  1L6J A;  2MZI A;  4G0D A;  2OY4 A;  3WV1 A;  1OM6 A;  1XFU A;  3B2Z A;  1HFC A;  2V4B A;  3LGP A;  4XM6 A;  1B8Y A;  3DSL A;  3ZUK A;  4H49 A;  966C A;  2OW1 A;  2WO8 A;  1JIZ A;  1YCM A;  2POJ A;  1KUI A;  4ILW D;  2RJQ A;  3RTS A;  3USN A;  3LE9 A;  1OS2 A;  3HDB A;  3B8Z A;  5B5O A;  1UMS A;  2W14 A;  3LEA A;  5L79 A;  4AYK A;  5L7F A;  1SLN A;  3DPF A;  2OXW A;  4DPE A;  1QUA A;  2J0T A;  2AYK A;  2XS3 A;  1YQY A;  2JNP A;  5I2Z A;  3CKI A;  4PKQ A;  1IAG A;  3KMC A;  3F17 A;  1BKC A;  1ZXC A;  3LJZ A;  5JMY A;  1UTT A;  4WK7 A;  5D3C A;  1XUR A;  1IAB A;  3LIL A;  1R1J A;  3WV2 A;  3RTT A;  2D1O A;  1HTD A;  2MZE A;  4Q1L A;  3KME A;  2RJP A;  4JQG A;  3EDH A;  5D1U A;  1KBC A;  1QJJ A;  2USN A;  4HX3 A;  3K7L A;  1D5J A;  1HY7 A;  5CUH A;  1GE7 A;  4GR0 A;  3G5C A;  4GR3 A;  1R1I A;  3EHY A;  2OXZ A;  3KHI A;  1K7Q A;  3HDA P;  3TT4 A;  4ZR5 A;  5LAB A;  4I35 A;  3WV3 A;  1UMT A;  1GXD A;  1G12 A;  5D2B A;  1XFX A;  1WNI A;  1CGE A;  1IAE A;  3EDG A;  4H2E A;  5I0L A;  1BKC E;  3LUM A;  1OO9 A;  5BOY A;  2YB9 A;  5B5P A;  2W13 A;  1GO8 P;  1PWW A;  1I76 A;  1JH1 A;  1QJI A;  3Q2H A;  4H84 A;  2J83 A;  3LMC A;  1JKY A;  3ELM A;  1A85 A;  4WKE A;  3V96 B;  1RM8 A;  3L0V A;  1AST A;  3P1V A;  4QKZ A;  1C7K A;  1R55 A;  3HY7 A;  3VI1 A;  1HFS A;  2OVX A;  1C3I A;  3I7I A;  1PWV A;  2OW2 A;  2KRJ A;  1UTZ A;  4JPA A;  3DPE A;  4DD8 A;  1BKC I;  1PWQ A;  4DF9 A;  1GKC A;  1G4K A;  3LIR A;  4H1Q A;  4CTH A;  4DV8 A;  1YP1 A;  2X3A A;  4JA1 A;  2OY2 A;  2CLT A;  3ZVS A;  3KEK A;  1Y0V A;  2X3B A;  2MLS A;  2PJT A;  3G42 A;  4FXQ A;  4FU4 A;  1CIZ A;  3F1A A;  1H71 P;  1JJ9 A;  1CK7 A;  4PKS A;  3TSK A;  1OM7 A;  4WF6 A;  4GWN A;  1Z3J A;  4I03 A;  4FXY P;  4PKT A;  2DDY A;  3LIK A;  3DL1 A;  3LJT A;  5CXA A;  1MNC A;  3O64 A;  3MA2 A;  1ZXV A;  3OHO A;  2HU6 A;  1G05 A;  3N2U A;  2QPJ A;  4XM8 A;  2JSD A;  4IUW A;  3UVC A;  1XUD A;  2CKI A;  2Y6D A;  2DW1 A;  1D8M A;  456C A;  1FBL A;  3LUN A;  1USN A;  1EAK A;  3ZXH A;  1JAN A;  1ZVX A;  4GF1 A;  5CZM A;  1JIW P;  1YOU A;  2OW9 A;  3I7G A;  3U1R A;  3F18 A;  1SMP A;  1JAQ A;  2A8H A;  3TVC A;  5I4O A;  1HOV A;  4H3X A;  2W0D A;  3LQB A;  1ROS A;  2JT6 A;  3LKA A;  1JK3 A;  3P24 A;  1ZS0 A;  4WZV A;  1CGF A;  4HMA A;  5BOT A;  1GO7 P;  1I1I P;  3HB2 P;  1XFW A;  3KWV C;  1R54 A;  3NX7 A;  1MMB A;  1GKD A;  1BUV M;  4IN9 A;  1C8T A;  4PKU A;  1KUK A;  4XM7 A;  2SRT A;  2N8R A;  4JP4 A;  1QIB A;  3EDI A;  1KUH A;  2OVZ A;  1CGL A;  2YIG A;  1CAQ A;  4GR8 A;  3HBV P;  1KUG A;  2OXU A;  3F19 A;  1BSW A;  1SAT A;  2DW2 A;  1EB6 A;  1EUB A;  3LJG A;  3EDZ A;  1JAO A;  3LQ0 A;  3DNG A;  5H8X A;  2W15 A;  4XBH A;  2K9C A;  1A86 A;  1XFZ A;  5BPA A;  1QIA A;  1I73 A;  3BA0 A;  2WOA A;  1DMT A;  1ZTQ A;  1ND1 A;  1GE6 A;  4G9L A;  3EWJ A;  5D7W A;  3GBO A;  3OHL A;  2JT5 A;  1FM1 A;  1O0Q A;  3EHX A;  4R3V A;  1S4B P;  2DDF A;  1XFY A;  2TCL A;  3KEC A;  4L63 A;  1AKL A;  2Y6C A;  1R1H A;  4AIG A;  4GWM A; 
#chains in the Genus database with same CATH topology
 4AXQ A;  3N2V A;  2DW0 A;  1J7N A;  2YUF A;  1Y93 A;  2MZH A;  5I3M A;  3LK8 A;  1CXV A;  1OMJ A;  3SHI A;  3L0T A;  4L6T A;  3AYU A;  1HV5 A;  4PKR A;  2FV5 A;  1B3D A;  1KUF A;  1SU3 A;  4FVL A;  2D1N A;  4J4M A;  1OM8 A;  4L19 A;  1G49 A;  3AYK A;  1QIC A;  5I12 A;  1O0T A;  2MLR A;  1BUD A;  1XUC A;  1MMP A;  4H30 A;  4PKV A;  3F16 A;  3VTG A;  1BQQ M;  5D1T A;  4XCT A;  1XFV A;  2E3X A;  2OZR A;  2WO9 A;  3E8R A;  1K7G A;  1OS9 A;  1BZS A;  2OI0 A;  1ZP5 A;  4WKI A;  1ATL A;  1JAP A;  2OW0 A;  5I43 A;  2JIH A;  1KAP P;  1RMZ A;  1SLM A;  2ERQ A;  1GE5 A;  4EFS A;  2ERP A;  4A7B A;  3HBU P;  2K2G A;  3HY9 A;  4H82 A;  3TS4 A;  4A3W A;  1IAD A;  3K7N A;  3F15 A;  1BM6 A;  2E2D A;  3B92 A;  4GUY A;  1BIW A;  2O3E A;  2FV9 A;  3KRY A;  1PWP A;  1MMQ A;  3Q2G A;  1MMR A;  1AF0 A;  1TVI A;  3DWB A;  2O36 A;  4JIJ A;  1G9K A;  4AUO A;  1DTH A;  1D7X A;  2W12 A;  2Z2D A;  4IJO A;  4GQL A;  1Y8J A;  2X3C A;  2I47 A;  1CQR A;  3KEJ A;  1SRP A;  1IAC A;  5D1S A;  1D8F A;  1PWU A;  2AIG P;  3O2X A;  1UEA A;  1AYK A;  2X7M A;  1FLS A;  1BQO A;  1IAA A;  830C A;  4PKW A;  3HYG A;  1K7I A;  1XAX A;  1Q3A A;  2L0R A;  4ON1 A;  3AIG A;  4H76 A;  2XS4 A;  2ERO A;  1L6J A;  2MZI A;  4G0D A;  3DTK A;  2OY4 A;  1XM5 A;  3WV1 A;  1OM6 A;  1XFU A;  3B2Z A;  1HFC A;  2V4B A;  3LGP A;  4XM6 A;  1B8Y A;  3DSL A;  3ZUK A;  4H49 A;  966C A;  2OW1 A;  2WO8 A;  1JIZ A;  1YCM A;  2POJ A;  1KUI A;  4ILW D;  2RJQ A;  3RTS A;  3USN A;  3LE9 A;  1OS2 A;  3HDB A;  3B8Z A;  5B5O A;  1UMS A;  2W14 A;  3LEA A;  5L79 A;  4AYK A;  5L7F A;  1SLN A;  3DPF A;  2OXW A;  4DPE A;  1QUA A;  2J0T A;  2AYK A;  2XS3 A;  1YQY A;  2JNP A;  5I2Z A;  3CKI A;  4PKQ A;  1IAG A;  3KMC A;  3F17 A;  1BKC A;  1ZXC A;  3LJZ A;  5JMY A;  1UTT A;  4WK7 A;  5D3C A;  1XUR A;  1IAB A;  3LIL A;  1R1J A;  3WV2 A;  3RTT A;  2D1O A;  1HTD A;  2MZE A;  4Q1L A;  3KME A;  2RJP A;  4JQG A;  3EDH A;  5D1U A;  1KBC A;  1QJJ A;  2USN A;  4HX3 A;  3K7L A;  1D5J A;  1HY7 A;  5CUH A;  1GE7 A;  4GR0 A;  3G5C A;  4GR3 A;  1R1I A;  3EHY A;  2OXZ A;  3KHI A;  1K7Q A;  3HDA P;  3TT4 A;  4ZR5 A;  5LAB A;  4I35 A;  3WV3 A;  1UMT A;  1GXD A;  1G12 A;  5D2B A;  1XFX A;  1WNI A;  1CGE A;  1IAE A;  3EDG A;  4H2E A;  5I0L A;  1BKC E;  3LUM A;  1OO9 A;  5BOY A;  2YB9 A;  5B5P A;  2W13 A;  1GO8 P;  1PWW A;  1I76 A;  1JH1 A;  1QJI A;  3Q2H A;  4H84 A;  2J83 A;  3LMC A;  1JKY A;  3ELM A;  1A85 A;  4WKE A;  3V96 B;  1RM8 A;  3L0V A;  1AST A;  3P1V A;  4QKZ A;  1C7K A;  1R55 A;  3HY7 A;  3VI1 A;  1HFS A;  2OVX A;  1C3I A;  3I7I A;  1PWV A;  2OW2 A;  2KRJ A;  1UTZ A;  4JPA A;  3DPE A;  4DD8 A;  1BKC I;  1PWQ A;  4DF9 A;  1GKC A;  1G4K A;  3LIR A;  4H1Q A;  4CTH A;  4DV8 A;  1YP1 A;  2X3A A;  4JA1 A;  2OY2 A;  2CLT A;  3ZVS A;  3KEK A;  1Y0V A;  2X3B A;  2MLS A;  2PJT A;  3G42 A;  4FXQ A;  4FU4 A;  1CIZ A;  3F1A A;  1H71 P;  1JJ9 A;  1CK7 A;  4PKS A;  3TSK A;  1OM7 A;  4WF6 A;  4GWN A;  1Z3J A;  4I03 A;  4FXY P;  4PKT A;  2DDY A;  3LIK A;  3DL1 A;  3LJT A;  5CXA A;  1MNC A;  3O64 A;  3MA2 A;  1ZXV A;  3OHO A;  2HU6 A;  1G05 A;  3N2U A;  2QPJ A;  4XM8 A;  2JSD A;  4IUW A;  3UVC A;  1XUD A;  2CKI A;  2Y6D A;  2DW1 A;  1D8M A;  456C A;  1FBL A;  3LUN A;  1USN A;  1EAK A;  3ZXH A;  1JAN A;  1ZVX A;  4GF1 A;  5CZM A;  1JIW P;  1YOU A;  2OW9 A;  3I7G A;  3U1R A;  3F18 A;  1SMP A;  1JAQ A;  2A8H A;  3TVC A;  3DTI A;  5I4O A;  1HOV A;  4H3X A;  2W0D A;  3LQB A;  1ROS A;  2JT6 A;  3LKA A;  1JK3 A;  3P24 A;  1ZS0 A;  4WZV A;  1CGF A;  4HMA A;  5BOT A;  1GO7 P;  1I1I P;  3HB2 P;  1XFW A;  3KWV C;  1R54 A;  3NX7 A;  1MMB A;  1GKD A;  1BUV M;  4IN9 A;  1C8T A;  4PKU A;  1KUK A;  4XM7 A;  2SRT A;  2N8R A;  4JP4 A;  1QIB A;  3EDI A;  1KUH A;  2OVZ A;  1CGL A;  2YIG A;  1CAQ A;  4GR8 A;  3HBV P;  1KUG A;  2OXU A;  3F19 A;  1BSW A;  1SAT A;  2DW2 A;  1EB6 A;  1EUB A;  3LJG A;  3EDZ A;  1JAO A;  3LQ0 A;  3DNG A;  5H8X A;  2W15 A;  4XBH A;  2K9C A;  4L7A A;  1A86 A;  1XFZ A;  5BPA A;  1QIA A;  1I73 A;  3BA0 A;  2WOA A;  1DMT A;  1ZTQ A;  1OZ9 A;  1ND1 A;  1GE6 A;  4G9L A;  3EWJ A;  5D7W A;  3GBO A;  3OHL A;  2JT5 A;  1FM1 A;  1O0Q A;  3DTE A;  3EHX A;  4R3V A;  1S4B P;  2DDF A;  1XFY A;  2TCL A;  3KEC A;  4L63 A;  1AKL A;  2Y6C A;  1R1H A;  4AIG A;  4GWM A; 
#chains in the Genus database with same CATH homology
 4AXQ A;  3N2V A;  2DW0 A;  1J7N A;  2YUF A;  1Y93 A;  2MZH A;  5I3M A;  3LK8 A;  1CXV A;  1OMJ A;  3SHI A;  3L0T A;  4L6T A;  3AYU A;  1HV5 A;  4PKR A;  2FV5 A;  1B3D A;  1KUF A;  1SU3 A;  4FVL A;  2D1N A;  4J4M A;  1OM8 A;  4L19 A;  1G49 A;  3AYK A;  1QIC A;  5I12 A;  1O0T A;  2MLR A;  1BUD A;  1XUC A;  1MMP A;  4H30 A;  4PKV A;  3F16 A;  3VTG A;  1BQQ M;  5D1T A;  4XCT A;  1XFV A;  2E3X A;  2OZR A;  2WO9 A;  3E8R A;  1K7G A;  1OS9 A;  1BZS A;  2OI0 A;  1ZP5 A;  4WKI A;  1ATL A;  1JAP A;  2OW0 A;  5I43 A;  2JIH A;  1KAP P;  1RMZ A;  1SLM A;  2ERQ A;  1GE5 A;  4EFS A;  2ERP A;  4A7B A;  3HBU P;  2K2G A;  3HY9 A;  4H82 A;  3TS4 A;  4A3W A;  1IAD A;  3K7N A;  3F15 A;  1BM6 A;  2E2D A;  3B92 A;  4GUY A;  1BIW A;  2O3E A;  2FV9 A;  3KRY A;  1PWP A;  1MMQ A;  3Q2G A;  1MMR A;  1AF0 A;  3DWB A;  2O36 A;  4JIJ A;  1G9K A;  4AUO A;  1DTH A;  1D7X A;  2W12 A;  2Z2D A;  4IJO A;  4GQL A;  1Y8J A;  2X3C A;  2I47 A;  1CQR A;  3KEJ A;  1SRP A;  1IAC A;  5D1S A;  1D8F A;  1PWU A;  2AIG P;  3O2X A;  1UEA A;  1AYK A;  2X7M A;  1FLS A;  1BQO A;  1IAA A;  830C A;  4PKW A;  3HYG A;  1K7I A;  1Q3A A;  2L0R A;  4ON1 A;  3AIG A;  4H76 A;  2XS4 A;  2ERO A;  1L6J A;  2MZI A;  4G0D A;  3DTK A;  2OY4 A;  3WV1 A;  1OM6 A;  1XFU A;  3B2Z A;  1HFC A;  2V4B A;  3LGP A;  4XM6 A;  1B8Y A;  3DSL A;  3ZUK A;  4H49 A;  966C A;  2OW1 A;  2WO8 A;  1JIZ A;  1YCM A;  2POJ A;  1KUI A;  4ILW D;  2RJQ A;  3RTS A;  3USN A;  3LE9 A;  1OS2 A;  3HDB A;  3B8Z A;  5B5O A;  1UMS A;  2W14 A;  3LEA A;  5L79 A;  4AYK A;  5L7F A;  1SLN A;  3DPF A;  2OXW A;  4DPE A;  1QUA A;  2J0T A;  2AYK A;  2XS3 A;  1YQY A;  2JNP A;  5I2Z A;  3CKI A;  4PKQ A;  1IAG A;  3KMC A;  3F17 A;  1BKC A;  1ZXC A;  3LJZ A;  5JMY A;  1UTT A;  4WK7 A;  5D3C A;  1XUR A;  1IAB A;  3LIL A;  1R1J A;  3WV2 A;  3RTT A;  2D1O A;  1HTD A;  2MZE A;  4Q1L A;  3KME A;  2RJP A;  4JQG A;  3EDH A;  5D1U A;  1KBC A;  1QJJ A;  2USN A;  4HX3 A;  3K7L A;  1D5J A;  1HY7 A;  5CUH A;  1GE7 A;  4GR0 A;  3G5C A;  4GR3 A;  1R1I A;  3EHY A;  2OXZ A;  3KHI A;  1K7Q A;  3HDA P;  3TT4 A;  4ZR5 A;  5LAB A;  4I35 A;  3WV3 A;  1UMT A;  1GXD A;  1G12 A;  5D2B A;  1XFX A;  1WNI A;  1CGE A;  1IAE A;  3EDG A;  4H2E A;  5I0L A;  1BKC E;  3LUM A;  1OO9 A;  5BOY A;  2YB9 A;  5B5P A;  2W13 A;  1GO8 P;  1PWW A;  1I76 A;  1JH1 A;  1QJI A;  3Q2H A;  4H84 A;  2J83 A;  3LMC A;  1JKY A;  3ELM A;  1A85 A;  4WKE A;  3V96 B;  1RM8 A;  3L0V A;  1AST A;  3P1V A;  4QKZ A;  1C7K A;  1R55 A;  3HY7 A;  3VI1 A;  1HFS A;  2OVX A;  1C3I A;  3I7I A;  1PWV A;  2OW2 A;  2KRJ A;  1UTZ A;  4JPA A;  3DPE A;  4DD8 A;  1BKC I;  1PWQ A;  4DF9 A;  1GKC A;  1G4K A;  3LIR A;  4H1Q A;  4CTH A;  4DV8 A;  1YP1 A;  2X3A A;  4JA1 A;  2OY2 A;  2CLT A;  3ZVS A;  3KEK A;  1Y0V A;  2X3B A;  2MLS A;  2PJT A;  3G42 A;  4FXQ A;  4FU4 A;  1CIZ A;  3F1A A;  1H71 P;  1JJ9 A;  1CK7 A;  4PKS A;  3TSK A;  1OM7 A;  4WF6 A;  4GWN A;  1Z3J A;  4I03 A;  4FXY P;  4PKT A;  2DDY A;  3LIK A;  3DL1 A;  3LJT A;  5CXA A;  1MNC A;  3O64 A;  3MA2 A;  1ZXV A;  3OHO A;  2HU6 A;  1G05 A;  3N2U A;  2QPJ A;  4XM8 A;  2JSD A;  4IUW A;  3UVC A;  1XUD A;  2CKI A;  2Y6D A;  2DW1 A;  1D8M A;  456C A;  1FBL A;  3LUN A;  1USN A;  1EAK A;  3ZXH A;  1JAN A;  1ZVX A;  4GF1 A;  5CZM A;  1JIW P;  1YOU A;  2OW9 A;  3I7G A;  3U1R A;  3F18 A;  1SMP A;  1JAQ A;  2A8H A;  3TVC A;  3DTI A;  5I4O A;  1HOV A;  4H3X A;  2W0D A;  3LQB A;  1ROS A;  2JT6 A;  3LKA A;  1JK3 A;  3P24 A;  1ZS0 A;  4WZV A;  1CGF A;  4HMA A;  5BOT A;  1GO7 P;  1I1I P;  3HB2 P;  1XFW A;  3KWV C;  1R54 A;  3NX7 A;  1MMB A;  1GKD A;  1BUV M;  4IN9 A;  1C8T A;  4PKU A;  1KUK A;  4XM7 A;  2SRT A;  2N8R A;  4JP4 A;  1QIB A;  3EDI A;  1KUH A;  2OVZ A;  1CGL A;  2YIG A;  1CAQ A;  4GR8 A;  3HBV P;  1KUG A;  2OXU A;  3F19 A;  1BSW A;  1SAT A;  2DW2 A;  1EB6 A;  1EUB A;  3LJG A;  3EDZ A;  1JAO A;  3LQ0 A;  3DNG A;  5H8X A;  2W15 A;  4XBH A;  2K9C A;  4L7A A;  1A86 A;  1XFZ A;  5BPA A;  1QIA A;  1I73 A;  3BA0 A;  2WOA A;  1DMT A;  1ZTQ A;  1ND1 A;  1GE6 A;  4G9L A;  3EWJ A;  5D7W A;  3GBO A;  3OHL A;  2JT5 A;  1FM1 A;  1O0Q A;  3DTE A;  3EHX A;  4R3V A;  1S4B P;  2DDF A;  1XFY A;  2TCL A;  3KEC A;  4L63 A;  1AKL A;  2Y6C A;  1R1H A;  4AIG A;  4GWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...