1ROSA

Crystal structure of mmp-12 complexed to 2-(1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)ethyl-4-(4-ethoxy[1,1-biphenyl]-4-yl)-4-oxobutanoic acid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Crystal structures of novel non-peptidic, non-zinc chelating inhibitors bound to MMP-12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1rosA00
1SU3A 2OZRA 4WK7A 3RTSA 2WO8A 1G05A 1R1HA 4GWMA 1G12A 1Y93A 2A8HA 3N2UA 4H2EA 1CGEA 4XBHA 3G5CA 4PKUA 1GKCA 1MMPA 3F16A 5I2ZA 3DNGA 1JKYA 3Q2HA 2K9CA 1L6JA 4G9LA 1SRPA 1OM8A 4GQLA 3CKIA 1KUIA 2OXUA 2MZIA 830CA 1CXVA 3KHIA 3DSLA 4FXYP 2MLSA 3L0VA 1XFXA 3LMCA 1G4KA 4DV8A 1ND1A 1Y8JA 2Y6DA 1C8TA 2RJPA 3KECA 3EHXA 2OW9A 5D1SA 1XUCA 1I76A 4DF9A 1BKCA 3VTGA 3P1VA 1PWPA 1CK7A 3KEKA 2DW0A 1QJJA 1S4BP 1AYKA 2Z2DA 3DL1A 4AUOA 1RMZA 1ZXCA 1H71P 1B3DA 1OO9A 1XFWA 1AF0A 1D7XA 4CTHA 1ZP5A 1KUKA 4GR8A 3LJTA 1KUFA 4Q1LA 3WV3A 3P24A 3G42A 1OMJA 2FV5A 1EAKA 4WKIA 1DTHA 5I12A 1XFVA 3B8ZA 1XFZA 1SLNA 1XFUA 1YP1A 1O0TA 4J4MA 3AIGA 1C3IA 5H8XA 3TS4A 1RM8A 1K7QA 4G0DA 3GBOA 3O2XA 3N2VA 5I0LA 4GUYA 2JIHA 2X3CA 3F15A 1JAQA 1ZTQA 3HY9A 1R1JA 2OXZA 1QIAA 4WZVA 3DWBA 1R54A 4XCTA 1EB6A 4ILWD 2XS4A 1A86A 2OW0A 3LK8A 3TSKA 4WKEA 1CGLA 1SMPA 1A85A 1KUGA 5JMYA 456CA 5L79A 4AYKA 1HOVA 5BOYA 4FVLA 1CGFA 1MNCA 4L6TA 1XFYA 3V96B 3K7LA 2O36A 2W13A 4GR0A 4AIGA 1HY7A 4A3WA 3UVCA 1BUDA 1OM7A 2USNA 3KWVC 3B92A 1FBLA 5D1TA 1K7IA 4H30A 3HBVP 3USNA 3Q2GA 3EDIA 4XM7A 1CAQA 2X3AA 2I47A 1O0QA 3LQBA 4ZR5A 3RTTA 1PWQA 2SRTA 3LUNA 1ATLA 1JIWP 2EROA 1SATA 2OW1A 2FV9A 4HX3A 1XUDA 2ERQA 3OHLA 1JK3A 1QJIA 4JP4A 2DDYA 3AYUA 4H76A 2W12A 1ROSA 3HDBA 1IAGA 4L63A 1GE6A 2J0TA 1BQQM 4JQGA 3HYGA 1GXDA 3HB2P 1ASTA 1MMBA 4PKVA 3WV1A 5I3MA 4JPAA 3K7NA 3EWJA 2QPJA 1D8MA 1HV5A 4R3VA 2MZHA 3BA0A 5D7WA 4FU4A 4FXQA 4H84A 3F18A 1IADA 2CLTA 5L7FA 2DW2A 1FLSA 1ZS0A 4DD8A 3U1RA 3KEJA 2E2DA 2D1OA 3SHIA 4XM8A 1PWWA 2D1NA 1IAEA 2JSDA 1BKCI 1PWUA 1HFSA 2AIGP 2X3BA 2TCLA 4WF6A 5B5OA 2PJTA 1PWVA 1JAOA 1MMQA 2WO9A 3KMCA 2DW1A 3LEAA 1KUHA 3ZUKA 4GWNA 1QIBA 3F19A 3LQ0A 4JIJA 4A7BA 4ON1A 2J83A 1IAAA 1OM6A 5B5PA 2L0RA 2MZEA 3EDZA 1UEAA 4H3XA 3DPFA 4IUWA 5CXAA 3WV2A 1JANA 5I4OA 2OY4A 1D8FA 3TT4A 1HTDA 1R1IA 3LIRA 2W14A 1KBCA 1JJ9A 3TVCA 1CQRA 1SLMA 3LUMA 3LJZA 3F1AA 1UTZA 2JT5A 1G49A 1QUAA 1UTTA 4GF1A 3F17A 1FM1A 1OS9A 1YCMA 1GO7P 1C7KA 3I7IA 4I03A 2O3EA 1BQOA 4H1QA 4PKQA 3O64A 1GO8P 1GE7A 1I1IP 2N8RA 1USNA 4PKSA 3NX7A 1QICA 2OVXA 2V4BA 2X7MA 1DMTA 1BUVM 4PKRA 3ZXHA 2RJQA 3KMEA 3HDAP 1BZSA 1Z3JA 2POJA 1R55A 1J7NA 1YQYA 1UMSA 2OW2A 1EUBA 1GKDA 3E8RA 3LIKA 1G9KA 1IACA 1ZVXA 1MMRA 2W0DA 1Y0VA 1BM6A 3HBUP 3MA2A 3EHYA 2OI0A 2DDFA 2AYKA 3EDGA 3I7GA 1ZXVA 4I35A 1D5JA 2HU6A 2YIGA 3L0TA 1UMTA 5CZMA 3DPEA 3LILA 5BOTA 1JAPA 1Q3AA 5I43A 2OXWA 1CIZA 5LABA 966CA 3KRYA 3LKAA 3ELMA 4JA1A 2JT6A 5CUHA 5D1UA 2MLRA 1BSWA 4XM6A 1I73A 2OY2A 2WOAA 2JNPA 1OS2A 4PKWA 4PKTA 1AKLA 1K7GA 3AYKA 4H49A 4HMAA 2CKIA 1IABA 2Y6CA 1XURA 2E3XA 4QKZA 1HFCA 1JIZA 1WNIA 4L19A 2YB9A 4H82A 4EFSA 3LGPA 3LE9A 1BKCE 3B2ZA 2XS3A 1GE5A 2W15A 3LJGA 3EDHA 1BIWA 1KAPP 1YOUA 3OHOA 4DPEA 1JH1A 2ERPA 2K2GA 3VI1A 4GR3A 4IN9A 3HY7A 4AXQA 1B8YA 5D2BA 2OVZA 4IJOA 5BPAA 3ZVSA 2KRJA 5D3CA
chains in the Genus database with same CATH superfamily
1SU3A 2OZRA 4WK7A 3RTSA 2WO8A 1G05A 1R1HA 4GWMA 1G12A 1Y93A 2A8HA 3N2UA 4H2EA 1CGEA 4XBHA 3G5CA 4PKUA 1GKCA 1MMPA 3F16A 5I2ZA 3DNGA 1JKYA 3Q2HA 2K9CA 1L6JA 4G9LA 1SRPA 1OM8A 4GQLA 3CKIA 1KUIA 2OXUA 2MZIA 830CA 1CXVA 3KHIA 3DSLA 4FXYP 2MLSA 3L0VA 1XFXA 3LMCA 1G4KA 4DV8A 1ND1A 1Y8JA 2Y6DA 1C8TA 2RJPA 3KECA 3EHXA 2OW9A 5D1SA 1XUCA 1I76A 4DF9A 1BKCA 3VTGA 3P1VA 1PWPA 1CK7A 3KEKA 2DW0A 1QJJA 1S4BP 1AYKA 2Z2DA 3DL1A 4AUOA 1RMZA 1ZXCA 1H71P 1B3DA 1OO9A 1XFWA 1AF0A 1D7XA 4CTHA 1ZP5A 1KUKA 4GR8A 3LJTA 1KUFA 4Q1LA 3WV3A 3P24A 3G42A 1OMJA 2FV5A 1EAKA 4WKIA 1DTHA 5I12A 1XFVA 3B8ZA 1XFZA 1SLNA 1XFUA 1YP1A 1O0TA 4J4MA 3AIGA 1C3IA 5H8XA 3TS4A 1RM8A 1K7QA 4G0DA 3GBOA 3O2XA 3N2VA 5I0LA 4GUYA 2JIHA 2X3CA 3F15A 1JAQA 1ZTQA 3HY9A 1R1JA 2OXZA 1QIAA 4WZVA 3DWBA 1R54A 4XCTA 1EB6A 4ILWD 2XS4A 1A86A 2OW0A 3LK8A 3TSKA 4WKEA 1CGLA 1SMPA 1A85A 1KUGA 5JMYA 456CA 5L79A 4AYKA 1HOVA 5BOYA 4FVLA 1CGFA 1MNCA 4L6TA 1XFYA 3V96B 1OZ9A 3K7LA 2O36A 2W13A 4GR0A 4AIGA 1HY7A 4A3WA 3UVCA 1BUDA 1OM7A 2USNA 3KWVC 3B92A 1FBLA 5D1TA 1K7IA 4H30A 3HBVP 3USNA 3Q2GA 3EDIA 4XM7A 1CAQA 2X3AA 2I47A 1O0QA 3LQBA 4ZR5A 3RTTA 1PWQA 2SRTA 3LUNA 1ATLA 1JIWP 2EROA 1SATA 2OW1A 2FV9A 4HX3A 1XUDA 2ERQA 3OHLA 1JK3A 1QJIA 4JP4A 2DDYA 3AYUA 4H76A 2W12A 1ROSA 3HDBA 1IAGA 4L63A 1GE6A 2J0TA 1BQQM 4JQGA 3HYGA 1GXDA 3HB2P 1ASTA 1MMBA 4PKVA 3WV1A 5I3MA 4JPAA 3K7NA 3EWJA 2QPJA 1D8MA 1HV5A 4R3VA 2MZHA 3BA0A 5D7WA 4FU4A 4FXQA 4H84A 3F18A 1IADA 2CLTA 5L7FA 2DW2A 1FLSA 1ZS0A 1XM5A 4DD8A 3U1RA 3KEJA 2E2DA 2D1OA 3SHIA 4XM8A 1PWWA 2D1NA 1IAEA 2JSDA 1BKCI 1PWUA 1HFSA 2AIGP 2X3BA 2TCLA 4WF6A 5B5OA 2PJTA 1PWVA 1JAOA 1MMQA 2WO9A 3KMCA 2DW1A 3LEAA 1KUHA 3ZUKA 4GWNA 1QIBA 3F19A 3LQ0A 4JIJA 4A7BA 3DTIA 4ON1A 2J83A 1IAAA 1OM6A 5B5PA 2L0RA 2MZEA 3EDZA 1UEAA 4H3XA 3DPFA 4IUWA 5CXAA 3WV2A 1JANA 5I4OA 2OY4A 1D8FA 3TT4A 1HTDA 1R1IA 3LIRA 2W14A 1KBCA 1JJ9A 3TVCA 1CQRA 1SLMA 3LUMA 3LJZA 3F1AA 1UTZA 2JT5A 1G49A 1QUAA 1UTTA 4GF1A 3F17A 1FM1A 1OS9A 1YCMA 1GO7P 1C7KA 3I7IA 4I03A 2O3EA 1BQOA 4H1QA 4PKQA 3O64A 1GO8P 1GE7A 1I1IP 2N8RA 1USNA 4PKSA 3NX7A 1XAXA 1QICA 2OVXA 2V4BA 2X7MA 1DMTA 1BUVM 3DTEA 4PKRA 3ZXHA 2RJQA 3KMEA 3HDAP 1BZSA 1Z3JA 2POJA 1R55A 1J7NA 1YQYA 1UMSA 2OW2A 1EUBA 1GKDA 3E8RA 3LIKA 1G9KA 1IACA 1ZVXA 1MMRA 2W0DA 1Y0VA 2YUFA 1BM6A 3HBUP 3MA2A 3EHYA 2OI0A 2DDFA 2AYKA 3EDGA 3I7GA 1ZXVA 4I35A 1D5JA 2HU6A 2YIGA 3L0TA 1UMTA 5CZMA 3DPEA 3LILA 5BOTA 1JAPA 1Q3AA 5I43A 2OXWA 1CIZA 5LABA 966CA 3KRYA 3LKAA 3ELMA 4JA1A 2JT6A 5CUHA 5D1UA 2MLRA 1BSWA 4XM6A 1I73A 2OY2A 2WOAA 2JNPA 1OS2A 4PKWA 4PKTA 1AKLA 1K7GA 3AYKA 4H49A 4HMAA 2CKIA 1IABA 2Y6CA 1XURA 2E3XA 4QKZA 1HFCA 1JIZA 1WNIA 4L19A 2YB9A 4H82A 4EFSA 3LGPA 3LE9A 1BKCE 3B2ZA 2XS3A 1GE5A 2W15A 3LJGA 3EDHA 1BIWA 1KAPP 1YOUA 3OHOA 4DPEA 1JH1A 2ERPA 2K2GA 3VI1A 4GR3A 4IN9A 4L7AA 3HY7A 4AXQA 1B8YA 5D2BA 2OVZA 4IJOA 3DTKA 1TVIA 5BPAA 3ZVSA 2KRJA 5D3CA
chains in the Genus database with same CATH topology
1SU3A 2OZRA 4WK7A 3RTSA 2WO8A 1G05A 1R1HA 4GWMA 1G12A 1Y93A 2A8HA 3N2UA 4H2EA 1CGEA 4XBHA 3G5CA 4PKUA 1GKCA 1MMPA 3F16A 5I2ZA 3DNGA 1JKYA 3Q2HA 2K9CA 1L6JA 4G9LA 1SRPA 1OM8A 4GQLA 3CKIA 1KUIA 2OXUA 2MZIA 830CA 1CXVA 3KHIA 3DSLA 4FXYP 2MLSA 3L0VA 1XFXA 3LMCA 1G4KA 4DV8A 1ND1A 1Y8JA 2Y6DA 1C8TA 2RJPA 3KECA 3EHXA 2OW9A 5D1SA 1XUCA 1I76A 4DF9A 1BKCA 3VTGA 3P1VA 1PWPA 1CK7A 3KEKA 2DW0A 1QJJA 1S4BP 1AYKA 2Z2DA 3DL1A 4AUOA 1RMZA 1ZXCA 1H71P 1B3DA 1OO9A 1XFWA 1AF0A 1D7XA 4CTHA 1ZP5A 1KUKA 4GR8A 3LJTA 1KUFA 4Q1LA 3WV3A 3P24A 3G42A 1OMJA 2FV5A 1EAKA 4WKIA 1DTHA 5I12A 1XFVA 3B8ZA 1XFZA 1SLNA 1XFUA 1YP1A 1O0TA 4J4MA 3AIGA 1C3IA 5H8XA 3TS4A 1RM8A 1K7QA 4G0DA 3GBOA 3O2XA 3N2VA 5I0LA 4GUYA 2JIHA 2X3CA 3F15A 1JAQA 1ZTQA 3HY9A 1R1JA 2OXZA 1QIAA 4WZVA 3DWBA 1R54A 4XCTA 1EB6A 4ILWD 2XS4A 1A86A 2OW0A 3LK8A 3TSKA 4WKEA 1CGLA 1SMPA 1A85A 1KUGA 5JMYA 456CA 5L79A 4AYKA 1HOVA 5BOYA 4FVLA 1CGFA 1MNCA 4L6TA 1XFYA 3V96B 3K7LA 2O36A 2W13A 4GR0A 4AIGA 1HY7A 4A3WA 3UVCA 1BUDA 1OM7A 2USNA 3KWVC 3B92A 1FBLA 5D1TA 1K7IA 4H30A 3HBVP 3USNA 3Q2GA 3EDIA 4XM7A 1CAQA 2X3AA 2I47A 1O0QA 3LQBA 4ZR5A 3RTTA 1PWQA 2SRTA 3LUNA 1ATLA 1JIWP 2EROA 1SATA 2OW1A 2FV9A 4HX3A 1XUDA 2ERQA 3OHLA 1JK3A 1QJIA 4JP4A 2DDYA 3AYUA 4H76A 2W12A 1ROSA 3HDBA 1IAGA 4L63A 1GE6A 2J0TA 1BQQM 4JQGA 3HYGA 1GXDA 3HB2P 1ASTA 1MMBA 4PKVA 3WV1A 5I3MA 4JPAA 3K7NA 3EWJA 2QPJA 1D8MA 1HV5A 4R3VA 2MZHA 3BA0A 5D7WA 4FU4A 4FXQA 4H84A 3F18A 1IADA 2CLTA 5L7FA 2DW2A 1FLSA 1ZS0A 4DD8A 3U1RA 3KEJA 2E2DA 2D1OA 3SHIA 4XM8A 1PWWA 2D1NA 1IAEA 2JSDA 1BKCI 1PWUA 1HFSA 2AIGP 2X3BA 2TCLA 4WF6A 5B5OA 2PJTA 1PWVA 1JAOA 1MMQA 2WO9A 3KMCA 2DW1A 3LEAA 1KUHA 3ZUKA 4GWNA 1QIBA 3F19A 3LQ0A 4JIJA 4A7BA 3DTIA 4ON1A 2J83A 1IAAA 1OM6A 5B5PA 2L0RA 2MZEA 3EDZA 1UEAA 4H3XA 3DPFA 4IUWA 5CXAA 3WV2A 1JANA 5I4OA 2OY4A 1D8FA 3TT4A 1HTDA 1R1IA 3LIRA 2W14A 1KBCA 1JJ9A 3TVCA 1CQRA 1SLMA 3LUMA 3LJZA 3F1AA 1UTZA 2JT5A 1G49A 1QUAA 1UTTA 4GF1A 3F17A 1FM1A 1OS9A 1YCMA 1GO7P 1C7KA 3I7IA 4I03A 2O3EA 1BQOA 4H1QA 4PKQA 3O64A 1GO8P 1GE7A 1I1IP 2N8RA 1USNA 4PKSA 3NX7A 1QICA 2OVXA 2V4BA 2X7MA 1DMTA 1BUVM 3DTEA 4PKRA 3ZXHA 2RJQA 3KMEA 3HDAP 1BZSA 1Z3JA 2POJA 1R55A 1J7NA 1YQYA 1UMSA 2OW2A 1EUBA 1GKDA 3E8RA 3LIKA 1G9KA 1IACA 1ZVXA 1MMRA 2W0DA 1Y0VA 2YUFA 1BM6A 3HBUP 3MA2A 3EHYA 2OI0A 2DDFA 2AYKA 3EDGA 3I7GA 1ZXVA 4I35A 1D5JA 2HU6A 2YIGA 3L0TA 1UMTA 5CZMA 3DPEA 3LILA 5BOTA 1JAPA 1Q3AA 5I43A 2OXWA 1CIZA 5LABA 966CA 3KRYA 3LKAA 3ELMA 4JA1A 2JT6A 5CUHA 5D1UA 2MLRA 1BSWA 4XM6A 1I73A 2OY2A 2WOAA 2JNPA 1OS2A 4PKWA 4PKTA 1AKLA 1K7GA 3AYKA 4H49A 4HMAA 2CKIA 1IABA 2Y6CA 1XURA 2E3XA 4QKZA 1HFCA 1JIZA 1WNIA 4L19A 2YB9A 4H82A 4EFSA 3LGPA 3LE9A 1BKCE 3B2ZA 2XS3A 1GE5A 2W15A 3LJGA 3EDHA 1BIWA 1KAPP 1YOUA 3OHOA 4DPEA 1JH1A 2ERPA 2K2GA 3VI1A 4GR3A 4IN9A 4L7AA 3HY7A 4AXQA 1B8YA 5D2BA 2OVZA 4IJOA 3DTKA 5BPAA 3ZVSA 2KRJA 5D3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SU3 A;  2OZR A;  4WK7 A;  3RTS A;  2WO8 A;  1G05 A;  1R1H A;  4GWM A;  1G12 A;  1Y93 A;  2A8H A;  3N2U A;  4H2E A;  1CGE A;  4XBH A;  3G5C A;  4PKU A;  1GKC A;  1MMP A;  3F16 A;  5I2Z A;  3DNG A;  1JKY A;  3Q2H A;  2K9C A;  1L6J A;  4G9L A;  1SRP A;  1OM8 A;  4GQL A;  3CKI A;  1KUI A;  2OXU A;  2MZI A;  830C A;  1CXV A;  3KHI A;  3DSL A;  4FXY P;  2MLS A;  3L0V A;  1XFX A;  3LMC A;  1G4K A;  4DV8 A;  1ND1 A;  1Y8J A;  2Y6D A;  1C8T A;  2RJP A;  3KEC A;  3EHX A;  2OW9 A;  5D1S A;  1XUC A;  1I76 A;  4DF9 A;  1BKC A;  3VTG A;  3P1V A;  1PWP A;  1CK7 A;  3KEK A;  2DW0 A;  1QJJ A;  1S4B P;  1AYK A;  2Z2D A;  3DL1 A;  4AUO A;  1RMZ A;  1ZXC A;  1H71 P;  1B3D A;  1OO9 A;  1XFW A;  1AF0 A;  1D7X A;  4CTH A;  1ZP5 A;  1KUK A;  4GR8 A;  3LJT A;  1KUF A;  4Q1L A;  3WV3 A;  3P24 A;  3G42 A;  1OMJ A;  2FV5 A;  1EAK A;  4WKI A;  1DTH A;  5I12 A;  1XFV A;  3B8Z A;  1XFZ A;  1SLN A;  1XFU A;  1YP1 A;  1O0T A;  4J4M A;  3AIG A;  1C3I A;  5H8X A;  3TS4 A;  1RM8 A;  1K7Q A;  4G0D A;  3GBO A;  3O2X A;  3N2V A;  5I0L A;  4GUY A;  2JIH A;  2X3C A;  3F15 A;  1JAQ A;  1ZTQ A;  3HY9 A;  1R1J A;  2OXZ A;  1QIA A;  4WZV A;  3DWB A;  1R54 A;  4XCT A;  1EB6 A;  4ILW D;  2XS4 A;  1A86 A;  2OW0 A;  3LK8 A;  3TSK A;  4WKE A;  1CGL A;  1SMP A;  1A85 A;  1KUG A;  5JMY A;  456C A;  5L79 A;  4AYK A;  1HOV A;  5BOY A;  4FVL A;  1CGF A;  1MNC A;  4L6T A;  1XFY A;  3V96 B;  3K7L A;  2O36 A;  2W13 A;  4GR0 A;  4AIG A;  1HY7 A;  4A3W A;  3UVC A;  1BUD A;  1OM7 A;  2USN A;  3KWV C;  3B92 A;  1FBL A;  5D1T A;  1K7I A;  4H30 A;  3HBV P;  3USN A;  3Q2G A;  3EDI A;  4XM7 A;  1CAQ A;  2X3A A;  2I47 A;  1O0Q A;  3LQB A;  4ZR5 A;  3RTT A;  1PWQ A;  2SRT A;  3LUN A;  1ATL A;  1JIW P;  2ERO A;  1SAT A;  2OW1 A;  2FV9 A;  4HX3 A;  1XUD A;  2ERQ A;  3OHL A;  1JK3 A;  1QJI A;  4JP4 A;  2DDY A;  3AYU A;  4H76 A;  2W12 A;  1ROS A;  3HDB A;  1IAG A;  4L63 A;  1GE6 A;  2J0T A;  1BQQ M;  4JQG A;  3HYG A;  1GXD A;  3HB2 P;  1AST A;  1MMB A;  4PKV A;  3WV1 A;  5I3M A;  4JPA A;  3K7N A;  3EWJ A;  2QPJ A;  1D8M A;  1HV5 A;  4R3V A;  2MZH A;  3BA0 A;  5D7W A;  4FU4 A;  4FXQ A;  4H84 A;  3F18 A;  1IAD A;  2CLT A;  5L7F A;  2DW2 A;  1FLS A;  1ZS0 A;  4DD8 A;  3U1R A;  3KEJ A;  2E2D A;  2D1O A;  3SHI A;  4XM8 A;  1PWW A;  2D1N A;  1IAE A;  2JSD A;  1BKC I;  1PWU A;  1HFS A;  2AIG P;  2X3B A;  2TCL A;  4WF6 A;  5B5O A;  2PJT A;  1PWV A;  1JAO A;  1MMQ A;  2WO9 A;  3KMC A;  2DW1 A;  3LEA A;  1KUH A;  3ZUK A;  4GWN A;  1QIB A;  3F19 A;  3LQ0 A;  4JIJ A;  4A7B A;  4ON1 A;  2J83 A;  1IAA A;  1OM6 A;  5B5P A;  2L0R A;  2MZE A;  3EDZ A;  1UEA A;  4H3X A;  3DPF A;  4IUW A;  5CXA A;  3WV2 A;  1JAN A;  5I4O A;  2OY4 A;  1D8F A;  3TT4 A;  1HTD A;  1R1I A;  3LIR A;  2W14 A;  1KBC A;  1JJ9 A;  3TVC A;  1CQR A;  1SLM A;  3LUM A;  3LJZ A;  3F1A A;  1UTZ A;  2JT5 A;  1G49 A;  1QUA A;  1UTT A;  4GF1 A;  3F17 A;  1FM1 A;  1OS9 A;  1YCM A;  1GO7 P;  1C7K A;  3I7I A;  4I03 A;  2O3E A;  1BQO A;  4H1Q A;  4PKQ A;  3O64 A;  1GO8 P;  1GE7 A;  1I1I P;  2N8R A;  1USN A;  4PKS A;  3NX7 A;  1QIC A;  2OVX A;  2V4B A;  2X7M A;  1DMT A;  1BUV M;  4PKR A;  3ZXH A;  2RJQ A;  3KME A;  3HDA P;  1BZS A;  1Z3J A;  2POJ A;  1R55 A;  1J7N A;  1YQY A;  1UMS A;  2OW2 A;  1EUB A;  1GKD A;  3E8R A;  3LIK A;  1G9K A;  1IAC A;  1ZVX A;  1MMR A;  2W0D A;  1Y0V A;  1BM6 A;  3HBU P;  3MA2 A;  3EHY A;  2OI0 A;  2DDF A;  2AYK A;  3EDG A;  3I7G A;  1ZXV A;  4I35 A;  1D5J A;  2HU6 A;  2YIG A;  3L0T A;  1UMT A;  5CZM A;  3DPE A;  3LIL A;  5BOT A;  1JAP A;  1Q3A A;  5I43 A;  2OXW A;  1CIZ A;  5LAB A;  966C A;  3KRY A;  3LKA A;  3ELM A;  4JA1 A;  2JT6 A;  5CUH A;  5D1U A;  2MLR A;  1BSW A;  4XM6 A;  1I73 A;  2OY2 A;  2WOA A;  2JNP A;  1OS2 A;  4PKW A;  4PKT A;  1AKL A;  1K7G A;  3AYK A;  4H49 A;  4HMA A;  2CKI A;  1IAB A;  2Y6C A;  1XUR A;  2E3X A;  4QKZ A;  1HFC A;  1JIZ A;  1WNI A;  4L19 A;  2YB9 A;  4H82 A;  4EFS A;  3LGP A;  3LE9 A;  1BKC E;  3B2Z A;  2XS3 A;  1GE5 A;  2W15 A;  3LJG A;  3EDH A;  1BIW A;  1KAP P;  1YOU A;  3OHO A;  4DPE A;  1JH1 A;  2ERP A;  2K2G A;  3VI1 A;  4GR3 A;  4IN9 A;  3HY7 A;  4AXQ A;  1B8Y A;  5D2B A;  2OVZ A;  4IJO A;  5BPA A;  3ZVS A;  2KRJ A;  5D3C A; 
#chains in the Genus database with same CATH topology
 1SU3 A;  2OZR A;  4WK7 A;  3RTS A;  2WO8 A;  1G05 A;  1R1H A;  4GWM A;  1G12 A;  1Y93 A;  2A8H A;  3N2U A;  4H2E A;  1CGE A;  4XBH A;  3G5C A;  4PKU A;  1GKC A;  1MMP A;  3F16 A;  5I2Z A;  3DNG A;  1JKY A;  3Q2H A;  2K9C A;  1L6J A;  4G9L A;  1SRP A;  1OM8 A;  4GQL A;  3CKI A;  1KUI A;  2OXU A;  2MZI A;  830C A;  1CXV A;  3KHI A;  3DSL A;  4FXY P;  2MLS A;  3L0V A;  1XFX A;  3LMC A;  1G4K A;  4DV8 A;  1ND1 A;  1Y8J A;  2Y6D A;  1C8T A;  2RJP A;  3KEC A;  3EHX A;  2OW9 A;  5D1S A;  1XUC A;  1I76 A;  4DF9 A;  1BKC A;  3VTG A;  3P1V A;  1PWP A;  1CK7 A;  3KEK A;  2DW0 A;  1QJJ A;  1S4B P;  1AYK A;  2Z2D A;  3DL1 A;  4AUO A;  1RMZ A;  1ZXC A;  1H71 P;  1B3D A;  1OO9 A;  1XFW A;  1AF0 A;  1D7X A;  4CTH A;  1ZP5 A;  1KUK A;  4GR8 A;  3LJT A;  1KUF A;  4Q1L A;  3WV3 A;  3P24 A;  3G42 A;  1OMJ A;  2FV5 A;  1EAK A;  4WKI A;  1DTH A;  5I12 A;  1XFV A;  3B8Z A;  1XFZ A;  1SLN A;  1XFU A;  1YP1 A;  1O0T A;  4J4M A;  3AIG A;  1C3I A;  5H8X A;  3TS4 A;  1RM8 A;  1K7Q A;  4G0D A;  3GBO A;  3O2X A;  3N2V A;  5I0L A;  4GUY A;  2JIH A;  2X3C A;  3F15 A;  1JAQ A;  1ZTQ A;  3HY9 A;  1R1J A;  2OXZ A;  1QIA A;  4WZV A;  3DWB A;  1R54 A;  4XCT A;  1EB6 A;  4ILW D;  2XS4 A;  1A86 A;  2OW0 A;  3LK8 A;  3TSK A;  4WKE A;  1CGL A;  1SMP A;  1A85 A;  1KUG A;  5JMY A;  456C A;  5L79 A;  4AYK A;  1HOV A;  5BOY A;  4FVL A;  1CGF A;  1MNC A;  4L6T A;  1XFY A;  3V96 B;  1OZ9 A;  3K7L A;  2O36 A;  2W13 A;  4GR0 A;  4AIG A;  1HY7 A;  4A3W A;  3UVC A;  1BUD A;  1OM7 A;  2USN A;  3KWV C;  3B92 A;  1FBL A;  5D1T A;  1K7I A;  4H30 A;  3HBV P;  3USN A;  3Q2G A;  3EDI A;  4XM7 A;  1CAQ A;  2X3A A;  2I47 A;  1O0Q A;  3LQB A;  4ZR5 A;  3RTT A;  1PWQ A;  2SRT A;  3LUN A;  1ATL A;  1JIW P;  2ERO A;  1SAT A;  2OW1 A;  2FV9 A;  4HX3 A;  1XUD A;  2ERQ A;  3OHL A;  1JK3 A;  1QJI A;  4JP4 A;  2DDY A;  3AYU A;  4H76 A;  2W12 A;  1ROS A;  3HDB A;  1IAG A;  4L63 A;  1GE6 A;  2J0T A;  1BQQ M;  4JQG A;  3HYG A;  1GXD A;  3HB2 P;  1AST A;  1MMB A;  4PKV A;  3WV1 A;  5I3M A;  4JPA A;  3K7N A;  3EWJ A;  2QPJ A;  1D8M A;  1HV5 A;  4R3V A;  2MZH A;  3BA0 A;  5D7W A;  4FU4 A;  4FXQ A;  4H84 A;  3F18 A;  1IAD A;  2CLT A;  5L7F A;  2DW2 A;  1FLS A;  1ZS0 A;  1XM5 A;  4DD8 A;  3U1R A;  3KEJ A;  2E2D A;  2D1O A;  3SHI A;  4XM8 A;  1PWW A;  2D1N A;  1IAE A;  2JSD A;  1BKC I;  1PWU A;  1HFS A;  2AIG P;  2X3B A;  2TCL A;  4WF6 A;  5B5O A;  2PJT A;  1PWV A;  1JAO A;  1MMQ A;  2WO9 A;  3KMC A;  2DW1 A;  3LEA A;  1KUH A;  3ZUK A;  4GWN A;  1QIB A;  3F19 A;  3LQ0 A;  4JIJ A;  4A7B A;  3DTI A;  4ON1 A;  2J83 A;  1IAA A;  1OM6 A;  5B5P A;  2L0R A;  2MZE A;  3EDZ A;  1UEA A;  4H3X A;  3DPF A;  4IUW A;  5CXA A;  3WV2 A;  1JAN A;  5I4O A;  2OY4 A;  1D8F A;  3TT4 A;  1HTD A;  1R1I A;  3LIR A;  2W14 A;  1KBC A;  1JJ9 A;  3TVC A;  1CQR A;  1SLM A;  3LUM A;  3LJZ A;  3F1A A;  1UTZ A;  2JT5 A;  1G49 A;  1QUA A;  1UTT A;  4GF1 A;  3F17 A;  1FM1 A;  1OS9 A;  1YCM A;  1GO7 P;  1C7K A;  3I7I A;  4I03 A;  2O3E A;  1BQO A;  4H1Q A;  4PKQ A;  3O64 A;  1GO8 P;  1GE7 A;  1I1I P;  2N8R A;  1USN A;  4PKS A;  3NX7 A;  1XAX A;  1QIC A;  2OVX A;  2V4B A;  2X7M A;  1DMT A;  1BUV M;  3DTE A;  4PKR A;  3ZXH A;  2RJQ A;  3KME A;  3HDA P;  1BZS A;  1Z3J A;  2POJ A;  1R55 A;  1J7N A;  1YQY A;  1UMS A;  2OW2 A;  1EUB A;  1GKD A;  3E8R A;  3LIK A;  1G9K A;  1IAC A;  1ZVX A;  1MMR A;  2W0D A;  1Y0V A;  2YUF A;  1BM6 A;  3HBU P;  3MA2 A;  3EHY A;  2OI0 A;  2DDF A;  2AYK A;  3EDG A;  3I7G A;  1ZXV A;  4I35 A;  1D5J A;  2HU6 A;  2YIG A;  3L0T A;  1UMT A;  5CZM A;  3DPE A;  3LIL A;  5BOT A;  1JAP A;  1Q3A A;  5I43 A;  2OXW A;  1CIZ A;  5LAB A;  966C A;  3KRY A;  3LKA A;  3ELM A;  4JA1 A;  2JT6 A;  5CUH A;  5D1U A;  2MLR A;  1BSW A;  4XM6 A;  1I73 A;  2OY2 A;  2WOA A;  2JNP A;  1OS2 A;  4PKW A;  4PKT A;  1AKL A;  1K7G A;  3AYK A;  4H49 A;  4HMA A;  2CKI A;  1IAB A;  2Y6C A;  1XUR A;  2E3X A;  4QKZ A;  1HFC A;  1JIZ A;  1WNI A;  4L19 A;  2YB9 A;  4H82 A;  4EFS A;  3LGP A;  3LE9 A;  1BKC E;  3B2Z A;  2XS3 A;  1GE5 A;  2W15 A;  3LJG A;  3EDH A;  1BIW A;  1KAP P;  1YOU A;  3OHO A;  4DPE A;  1JH1 A;  2ERP A;  2K2G A;  3VI1 A;  4GR3 A;  4IN9 A;  4L7A A;  3HY7 A;  4AXQ A;  1B8Y A;  5D2B A;  2OVZ A;  4IJO A;  3DTK A;  1TVI A;  5BPA A;  3ZVS A;  2KRJ A;  5D3C A; 
#chains in the Genus database with same CATH homology
 1SU3 A;  2OZR A;  4WK7 A;  3RTS A;  2WO8 A;  1G05 A;  1R1H A;  4GWM A;  1G12 A;  1Y93 A;  2A8H A;  3N2U A;  4H2E A;  1CGE A;  4XBH A;  3G5C A;  4PKU A;  1GKC A;  1MMP A;  3F16 A;  5I2Z A;  3DNG A;  1JKY A;  3Q2H A;  2K9C A;  1L6J A;  4G9L A;  1SRP A;  1OM8 A;  4GQL A;  3CKI A;  1KUI A;  2OXU A;  2MZI A;  830C A;  1CXV A;  3KHI A;  3DSL A;  4FXY P;  2MLS A;  3L0V A;  1XFX A;  3LMC A;  1G4K A;  4DV8 A;  1ND1 A;  1Y8J A;  2Y6D A;  1C8T A;  2RJP A;  3KEC A;  3EHX A;  2OW9 A;  5D1S A;  1XUC A;  1I76 A;  4DF9 A;  1BKC A;  3VTG A;  3P1V A;  1PWP A;  1CK7 A;  3KEK A;  2DW0 A;  1QJJ A;  1S4B P;  1AYK A;  2Z2D A;  3DL1 A;  4AUO A;  1RMZ A;  1ZXC A;  1H71 P;  1B3D A;  1OO9 A;  1XFW A;  1AF0 A;  1D7X A;  4CTH A;  1ZP5 A;  1KUK A;  4GR8 A;  3LJT A;  1KUF A;  4Q1L A;  3WV3 A;  3P24 A;  3G42 A;  1OMJ A;  2FV5 A;  1EAK A;  4WKI A;  1DTH A;  5I12 A;  1XFV A;  3B8Z A;  1XFZ A;  1SLN A;  1XFU A;  1YP1 A;  1O0T A;  4J4M A;  3AIG A;  1C3I A;  5H8X A;  3TS4 A;  1RM8 A;  1K7Q A;  4G0D A;  3GBO A;  3O2X A;  3N2V A;  5I0L A;  4GUY A;  2JIH A;  2X3C A;  3F15 A;  1JAQ A;  1ZTQ A;  3HY9 A;  1R1J A;  2OXZ A;  1QIA A;  4WZV A;  3DWB A;  1R54 A;  4XCT A;  1EB6 A;  4ILW D;  2XS4 A;  1A86 A;  2OW0 A;  3LK8 A;  3TSK A;  4WKE A;  1CGL A;  1SMP A;  1A85 A;  1KUG A;  5JMY A;  456C A;  5L79 A;  4AYK A;  1HOV A;  5BOY A;  4FVL A;  1CGF A;  1MNC A;  4L6T A;  1XFY A;  3V96 B;  3K7L A;  2O36 A;  2W13 A;  4GR0 A;  4AIG A;  1HY7 A;  4A3W A;  3UVC A;  1BUD A;  1OM7 A;  2USN A;  3KWV C;  3B92 A;  1FBL A;  5D1T A;  1K7I A;  4H30 A;  3HBV P;  3USN A;  3Q2G A;  3EDI A;  4XM7 A;  1CAQ A;  2X3A A;  2I47 A;  1O0Q A;  3LQB A;  4ZR5 A;  3RTT A;  1PWQ A;  2SRT A;  3LUN A;  1ATL A;  1JIW P;  2ERO A;  1SAT A;  2OW1 A;  2FV9 A;  4HX3 A;  1XUD A;  2ERQ A;  3OHL A;  1JK3 A;  1QJI A;  4JP4 A;  2DDY A;  3AYU A;  4H76 A;  2W12 A;  1ROS A;  3HDB A;  1IAG A;  4L63 A;  1GE6 A;  2J0T A;  1BQQ M;  4JQG A;  3HYG A;  1GXD A;  3HB2 P;  1AST A;  1MMB A;  4PKV A;  3WV1 A;  5I3M A;  4JPA A;  3K7N A;  3EWJ A;  2QPJ A;  1D8M A;  1HV5 A;  4R3V A;  2MZH A;  3BA0 A;  5D7W A;  4FU4 A;  4FXQ A;  4H84 A;  3F18 A;  1IAD A;  2CLT A;  5L7F A;  2DW2 A;  1FLS A;  1ZS0 A;  4DD8 A;  3U1R A;  3KEJ A;  2E2D A;  2D1O A;  3SHI A;  4XM8 A;  1PWW A;  2D1N A;  1IAE A;  2JSD A;  1BKC I;  1PWU A;  1HFS A;  2AIG P;  2X3B A;  2TCL A;  4WF6 A;  5B5O A;  2PJT A;  1PWV A;  1JAO A;  1MMQ A;  2WO9 A;  3KMC A;  2DW1 A;  3LEA A;  1KUH A;  3ZUK A;  4GWN A;  1QIB A;  3F19 A;  3LQ0 A;  4JIJ A;  4A7B A;  3DTI A;  4ON1 A;  2J83 A;  1IAA A;  1OM6 A;  5B5P A;  2L0R A;  2MZE A;  3EDZ A;  1UEA A;  4H3X A;  3DPF A;  4IUW A;  5CXA A;  3WV2 A;  1JAN A;  5I4O A;  2OY4 A;  1D8F A;  3TT4 A;  1HTD A;  1R1I A;  3LIR A;  2W14 A;  1KBC A;  1JJ9 A;  3TVC A;  1CQR A;  1SLM A;  3LUM A;  3LJZ A;  3F1A A;  1UTZ A;  2JT5 A;  1G49 A;  1QUA A;  1UTT A;  4GF1 A;  3F17 A;  1FM1 A;  1OS9 A;  1YCM A;  1GO7 P;  1C7K A;  3I7I A;  4I03 A;  2O3E A;  1BQO A;  4H1Q A;  4PKQ A;  3O64 A;  1GO8 P;  1GE7 A;  1I1I P;  2N8R A;  1USN A;  4PKS A;  3NX7 A;  1QIC A;  2OVX A;  2V4B A;  2X7M A;  1DMT A;  1BUV M;  3DTE A;  4PKR A;  3ZXH A;  2RJQ A;  3KME A;  3HDA P;  1BZS A;  1Z3J A;  2POJ A;  1R55 A;  1J7N A;  1YQY A;  1UMS A;  2OW2 A;  1EUB A;  1GKD A;  3E8R A;  3LIK A;  1G9K A;  1IAC A;  1ZVX A;  1MMR A;  2W0D A;  1Y0V A;  2YUF A;  1BM6 A;  3HBU P;  3MA2 A;  3EHY A;  2OI0 A;  2DDF A;  2AYK A;  3EDG A;  3I7G A;  1ZXV A;  4I35 A;  1D5J A;  2HU6 A;  2YIG A;  3L0T A;  1UMT A;  5CZM A;  3DPE A;  3LIL A;  5BOT A;  1JAP A;  1Q3A A;  5I43 A;  2OXW A;  1CIZ A;  5LAB A;  966C A;  3KRY A;  3LKA A;  3ELM A;  4JA1 A;  2JT6 A;  5CUH A;  5D1U A;  2MLR A;  1BSW A;  4XM6 A;  1I73 A;  2OY2 A;  2WOA A;  2JNP A;  1OS2 A;  4PKW A;  4PKT A;  1AKL A;  1K7G A;  3AYK A;  4H49 A;  4HMA A;  2CKI A;  1IAB A;  2Y6C A;  1XUR A;  2E3X A;  4QKZ A;  1HFC A;  1JIZ A;  1WNI A;  4L19 A;  2YB9 A;  4H82 A;  4EFS A;  3LGP A;  3LE9 A;  1BKC E;  3B2Z A;  2XS3 A;  1GE5 A;  2W15 A;  3LJG A;  3EDH A;  1BIW A;  1KAP P;  1YOU A;  3OHO A;  4DPE A;  1JH1 A;  2ERP A;  2K2G A;  3VI1 A;  4GR3 A;  4IN9 A;  4L7A A;  3HY7 A;  4AXQ A;  1B8Y A;  5D2B A;  2OVZ A;  4IJO A;  3DTK A;  5BPA A;  3ZVS A;  2KRJ A;  5D3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...