1BM6A

Solution structure of the catalytic domain of human stromelysin-1 complexed to a potent non-peptidic inhibitor, nmr, 20 structures
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
173
structure length
173
Chain Sequence
b'FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMELYSIN-1
publication title Solution structure of the catalytic domain of human stromelysin-1 complexed to a potent, nonpeptidic inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease
total genus 24
structure length 173
sequence length 173
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1bm6A00
3DWBA 4G9LA 1J7NA 1PWWA 4R3VA 1D7XA 3LILA 2OVXA 2AYKA 3OHOA 3KRYA 1OMJA 4JPAA 1HTDA 1ZS0A 3EHXA 1XFVA 3B8ZA 1PWVA 1JAPA 1KUHA 4DD8A 3OHLA 1HY7A 1JIZA 2FV9A 2DDYA 2POJA 3K7NA 5D1TA 3KMCA 4GQLA 1JANA 1BKCI 1DMTA 3F19A 4H1QA 1KUGA 1YCMA 4AIGA 2W12A 4H84A 4JP4A 2Z2DA 1Y0VA 3HDBA 1DTHA 4FXQA 1HOVA 1XUCA 3ZUKA 3HY7A 2OVZA 1SLMA 5BPAA 4H82A 3B92A 1Y8JA 1G9KA 4WF6A 1G49A 2O36A 3SHIA 1UEAA 3P24A 2ERPA 4ZR5A 3LK8A 5CZMA 1KUKA 2AIGP 2D1OA 3HY9A 4JIJA 1BQOA 2YB9A 4HX3A 1BM6A 3TVCA 4L6TA 2XS3A 4XBHA 4PKRA 1XUDA 2DW2A 3U1RA 5CUHA 4ILWD 2JSDA 3F16A 4DPEA 4FU4A 1BZSA 1UMSA 4H49A 1BKCA 1I1IP 3DPFA 3HYGA 3GBOA 1KAPP 2K9CA 2N8RA 5B5PA 4CTHA 2DW1A 2PJTA 1QIAA 2K2GA 1EUBA 3ELMA 3KECA 4HMAA 3AYUA 2X7MA 2X3AA 3Q2HA 3DNGA 1GE6A 3LUMA 3EWJA 3KEKA 3KHIA 1QICA 2W13A 1BUDA 4IN9A 4DF9A 1ZVXA 5JMYA 4PKTA 3I7IA 1O0QA 5I43A 3BA0A 3F15A 2OXUA 3LIKA 5I12A 3KWVC 1JAOA 1MNCA 1D5JA 1IAEA 3DSLA 3KMEA 1BQQM 1IADA 4WZVA 1BKCE 3EDGA 1XURA 3B2ZA 4JA1A 1R1IA 3LEAA 2FV5A 1IABA 3N2VA 1YQYA 2MZHA 1AYKA 1JK3A 4L63A 2J83A 4FVLA 1GE7A 3L0VA 1OS9A 1PWQA 3TT4A 4GWNA 1CIZA 1XFUA 2MZIA 1QJIA 2OXZA 1UTZA 3N2UA 3F17A 5D2BA 1MMRA 1C8TA 1G05A 3E8RA 1SLNA 1O0TA 1OM8A 2Y6CA 1OS2A 4XCTA 4WK7A 2KRJA 1CGFA 4H76A 2QPJA 1C7KA 1SRPA 4GR8A 1ROSA 1ZP5A 1QJJA 2OW2A 5B5OA 4PKSA 4Q1LA 2X3CA 1S4BP 4GWMA 1Y93A 3KEJA 2WO9A 4ON1A 3L0TA 2ERQA 2L0RA 3LIRA 4PKQA 2W15A 1CQRA 3MA2A 1QIBA 2USNA 1WNIA 2JT5A 1UTTA 2JNPA 4PKUA 1SATA 2X3BA 1OM7A 2WOAA 4AYKA 1FBLA 2J0TA 2RJPA 2EROA 4GF1A 1D8FA 1D8MA 1IACA 4XM6A 3G42A 1XFXA 1FM1A 3CKIA 3ZVSA 3RTSA 3AIGA 5I4OA 3WV2A 3TS4A 2HU6A 4FXYP 3LJGA 1HFCA 2OW0A 1JH1A 4GR0A 1ZXCA 2A8HA 5I2ZA 1ZTQA 2DW0A 5CXAA 1G12A 2JIHA 4PKVA 1UMTA 1KUFA 2RJQA 3EHYA 1CGLA 2OZRA 2I47A 3V96B 5I3MA 3LJTA 2CLTA 2E3XA 456CA 2OW1A 3DL1A 1ZXVA 1CXVA 2MLSA 1XFZA 2OY4A 3I7GA 1JAQA 2OI0A 2E2DA 3F18A 1JKYA 5BOTA 3LQ0A 3O2XA 4A7BA 1AKLA 2XS4A 4G0DA 1PWUA 3EDIA 2CKIA 3LQBA 1I73A 1HV5A 3HBVP 1PWPA 3K7LA 2DDFA 2OXWA 1H71P 4QKZA 1BSWA 1B3DA 1GKCA 1MMBA 1K7GA 1BIWA 4L19A 5D1UA 1ND1A 3TSKA 1AF0A 4WKEA 5D1SA 3LJZA 1MMPA 5H8XA 1RM8A 4IJOA 2O3EA 4PKWA 2MLRA 1K7IA 3USNA 2Y6DA 4AUOA 2W14A 1L6JA 1GO8P 3VI1A 1A85A 3LGPA 4IUWA 966CA 1C3IA 1KBCA 4DV8A 3EDHA 3LUNA 4J4MA 1Q3AA 4XM8A 4H3XA 3EDZA 1RMZA 3VTGA 4JQGA 1G4KA 1R55A 2WO8A 1GE5A 2MZEA 5I0LA 2OW9A 1CK7A 3NX7A 1B8YA 3Q2GA 2W0DA 3HDAP 1XFWA 3LE9A 1JIWP 1GKDA 1USNA 1OO9A 3HB2P 1YOUA 4XM7A 1FLSA 1SMPA 5D3CA 1KUIA 5BOYA 1QUAA 2JT6A 1BUVM 3LMCA 830CA 4I35A 3UVCA 3P1VA 1A86A 1GO7P 1Z3JA 3DPEA 1I76A 1XFYA 3HBUP 4AXQA 1ATLA 5D7WA 3O64A 3RTTA 1R1HA 1HFSA 1YP1A 4GUYA 2V4BA 1CGEA 2OY2A 3AYKA 3WV3A 1JJ9A 1R54A 4WKIA 3WV1A 1SU3A 2YIGA 3G5CA 4GR3A 1IAAA 1EAKA 4A3WA 1K7QA 2D1NA 1CAQA 5LABA 3LKAA 4H2EA 5L7FA 1GXDA 4H30A 1EB6A 2SRTA 1IAGA 4I03A 4EFSA 1MMQA 2TCLA 5L79A 1OM6A 1ASTA 3ZXHA 1R1JA 3F1AA
chains in the Genus database with same CATH superfamily
3DWBA 4G9LA 1J7NA 1PWWA 4R3VA 1D7XA 3LILA 2OVXA 2AYKA 3OHOA 3KRYA 1OMJA 4JPAA 1HTDA 1ZS0A 3EHXA 1XFVA 3B8ZA 1PWVA 1JAPA 1KUHA 4DD8A 3OHLA 1HY7A 1JIZA 2FV9A 2DDYA 2POJA 3K7NA 5D1TA 3KMCA 4GQLA 1JANA 1BKCI 1DMTA 3F19A 4H1QA 1TVIA 1KUGA 1YCMA 4AIGA 2W12A 1OZ9A 4H84A 4JP4A 2Z2DA 1Y0VA 3HDBA 1DTHA 4FXQA 1HOVA 4L7AA 1XUCA 3ZUKA 3HY7A 2OVZA 1SLMA 5BPAA 4H82A 3B92A 1Y8JA 1G9KA 4WF6A 1G49A 2O36A 3SHIA 1UEAA 3P24A 2ERPA 4ZR5A 3LK8A 5CZMA 1KUKA 2AIGP 2D1OA 3HY9A 4JIJA 1BQOA 2YB9A 4HX3A 1BM6A 3TVCA 4L6TA 2XS3A 4XBHA 4PKRA 1XUDA 2DW2A 3U1RA 5CUHA 4ILWD 2JSDA 3F16A 4DPEA 4FU4A 1BZSA 1UMSA 4H49A 1BKCA 1I1IP 3DPFA 3HYGA 3GBOA 1KAPP 2K9CA 2N8RA 5B5PA 4CTHA 2DW1A 2PJTA 1QIAA 2K2GA 1EUBA 3ELMA 3KECA 4HMAA 3AYUA 2X7MA 2X3AA 3Q2HA 3DNGA 1GE6A 3LUMA 3EWJA 3KEKA 3KHIA 1QICA 2W13A 1BUDA 4IN9A 4DF9A 1ZVXA 5JMYA 4PKTA 3I7IA 1O0QA 5I43A 3BA0A 3F15A 2OXUA 3LIKA 5I12A 3KWVC 1JAOA 1MNCA 1D5JA 1IAEA 3DSLA 3KMEA 1BQQM 1IADA 4WZVA 1BKCE 3EDGA 1XURA 3B2ZA 4JA1A 1R1IA 3LEAA 2FV5A 1IABA 3N2VA 1YQYA 2MZHA 1AYKA 1JK3A 4L63A 2J83A 4FVLA 1GE7A 3L0VA 1OS9A 1PWQA 3TT4A 4GWNA 1CIZA 1XFUA 2MZIA 1QJIA 2OXZA 1UTZA 3N2UA 3F17A 5D2BA 1MMRA 1C8TA 1G05A 3E8RA 1SLNA 1O0TA 1OM8A 2Y6CA 1OS2A 4XCTA 4WK7A 2KRJA 1CGFA 4H76A 2QPJA 1C7KA 1SRPA 1XAXA 4GR8A 1ROSA 1ZP5A 1QJJA 2OW2A 5B5OA 4PKSA 4Q1LA 2X3CA 1S4BP 4GWMA 1Y93A 3KEJA 2WO9A 4ON1A 3L0TA 2ERQA 2L0RA 3LIRA 4PKQA 2W15A 1CQRA 3DTKA 3MA2A 1QIBA 2USNA 1WNIA 2JT5A 1UTTA 2JNPA 4PKUA 1SATA 2X3BA 1OM7A 2WOAA 4AYKA 1FBLA 2J0TA 2RJPA 2EROA 4GF1A 1D8FA 1D8MA 1IACA 4XM6A 3G42A 1XFXA 1FM1A 3CKIA 3ZVSA 3RTSA 3AIGA 5I4OA 3WV2A 3TS4A 2HU6A 4FXYP 3LJGA 1HFCA 2OW0A 1JH1A 4GR0A 1ZXCA 2A8HA 5I2ZA 1ZTQA 2DW0A 5CXAA 1G12A 2JIHA 4PKVA 1UMTA 1KUFA 2RJQA 3EHYA 1CGLA 2OZRA 2I47A 3V96B 5I3MA 3LJTA 2CLTA 2E3XA 456CA 2OW1A 3DL1A 1ZXVA 1CXVA 2MLSA 1XFZA 2OY4A 3I7GA 1JAQA 3DTEA 2OI0A 2E2DA 3F18A 1JKYA 5BOTA 3LQ0A 3O2XA 1XM5A 4A7BA 1AKLA 2XS4A 4G0DA 1PWUA 3EDIA 2CKIA 3LQBA 1I73A 1HV5A 3HBVP 1PWPA 3K7LA 2DDFA 2OXWA 1H71P 4QKZA 1BSWA 1B3DA 1GKCA 1MMBA 1K7GA 1BIWA 4L19A 5D1UA 1ND1A 3TSKA 1AF0A 4WKEA 5D1SA 3LJZA 1MMPA 5H8XA 1RM8A 4IJOA 2O3EA 3DTIA 4PKWA 2MLRA 1K7IA 3USNA 2Y6DA 4AUOA 2W14A 1L6JA 1GO8P 3VI1A 1A85A 3LGPA 4IUWA 966CA 1C3IA 1KBCA 4DV8A 3EDHA 3LUNA 4J4MA 1Q3AA 4XM8A 4H3XA 3EDZA 1RMZA 3VTGA 4JQGA 1G4KA 1R55A 2WO8A 1GE5A 2MZEA 5I0LA 2OW9A 1CK7A 3NX7A 1B8YA 3Q2GA 2W0DA 2YUFA 3HDAP 1XFWA 3LE9A 1JIWP 1GKDA 1USNA 1OO9A 3HB2P 1YOUA 4XM7A 1FLSA 1SMPA 5D3CA 1KUIA 5BOYA 1QUAA 2JT6A 1BUVM 3LMCA 830CA 4I35A 3UVCA 3P1VA 1A86A 1GO7P 1Z3JA 3DPEA 1I76A 1XFYA 3HBUP 4AXQA 1ATLA 5D7WA 3O64A 3RTTA 1R1HA 1HFSA 1YP1A 4GUYA 2V4BA 1CGEA 2OY2A 3AYKA 3WV3A 1JJ9A 1R54A 4WKIA 3WV1A 1SU3A 2YIGA 3G5CA 4GR3A 1IAAA 1EAKA 4A3WA 1K7QA 2D1NA 1CAQA 5LABA 3LKAA 4H2EA 5L7FA 1GXDA 4H30A 1EB6A 2SRTA 1IAGA 4I03A 4EFSA 1MMQA 2TCLA 5L79A 1OM6A 1ASTA 3ZXHA 1R1JA 3F1AA
chains in the Genus database with same CATH topology
3DWBA 4G9LA 1J7NA 1PWWA 4R3VA 1D7XA 3LILA 2OVXA 2AYKA 3OHOA 3KRYA 1OMJA 4JPAA 1HTDA 1ZS0A 3EHXA 1XFVA 3B8ZA 1PWVA 1JAPA 1KUHA 4DD8A 3OHLA 1HY7A 1JIZA 2FV9A 2DDYA 2POJA 3K7NA 5D1TA 3KMCA 4GQLA 1JANA 1BKCI 1DMTA 3F19A 4H1QA 1KUGA 1YCMA 4AIGA 2W12A 4H84A 4JP4A 2Z2DA 1Y0VA 3HDBA 1DTHA 4FXQA 1HOVA 4L7AA 1XUCA 3ZUKA 3HY7A 2OVZA 1SLMA 5BPAA 4H82A 3B92A 1Y8JA 1G9KA 4WF6A 1G49A 2O36A 3SHIA 1UEAA 3P24A 2ERPA 4ZR5A 3LK8A 5CZMA 1KUKA 2AIGP 2D1OA 3HY9A 4JIJA 1BQOA 2YB9A 4HX3A 1BM6A 3TVCA 4L6TA 2XS3A 4XBHA 4PKRA 1XUDA 2DW2A 3U1RA 5CUHA 4ILWD 2JSDA 3F16A 4DPEA 4FU4A 1BZSA 1UMSA 4H49A 1BKCA 1I1IP 3DPFA 3HYGA 3GBOA 1KAPP 2K9CA 2N8RA 5B5PA 4CTHA 2DW1A 2PJTA 1QIAA 2K2GA 1EUBA 3ELMA 3KECA 4HMAA 3AYUA 2X7MA 2X3AA 3Q2HA 3DNGA 1GE6A 3LUMA 3EWJA 3KEKA 3KHIA 1QICA 2W13A 1BUDA 4IN9A 4DF9A 1ZVXA 5JMYA 4PKTA 3I7IA 1O0QA 5I43A 3BA0A 3F15A 2OXUA 3LIKA 5I12A 3KWVC 1JAOA 1MNCA 1D5JA 1IAEA 3DSLA 3KMEA 1BQQM 1IADA 4WZVA 1BKCE 3EDGA 1XURA 3B2ZA 4JA1A 1R1IA 3LEAA 2FV5A 1IABA 3N2VA 1YQYA 2MZHA 1AYKA 1JK3A 4L63A 2J83A 4FVLA 1GE7A 3L0VA 1OS9A 1PWQA 3TT4A 4GWNA 1CIZA 1XFUA 2MZIA 1QJIA 2OXZA 1UTZA 3N2UA 3F17A 5D2BA 1MMRA 1C8TA 1G05A 3E8RA 1SLNA 1O0TA 1OM8A 2Y6CA 1OS2A 4XCTA 4WK7A 2KRJA 1CGFA 4H76A 2QPJA 1C7KA 1SRPA 4GR8A 1ROSA 1ZP5A 1QJJA 2OW2A 5B5OA 4PKSA 4Q1LA 2X3CA 1S4BP 4GWMA 1Y93A 3KEJA 2WO9A 4ON1A 3L0TA 2ERQA 2L0RA 3LIRA 4PKQA 2W15A 1CQRA 3DTKA 3MA2A 1QIBA 2USNA 1WNIA 2JT5A 1UTTA 2JNPA 4PKUA 1SATA 2X3BA 1OM7A 2WOAA 4AYKA 1FBLA 2J0TA 2RJPA 2EROA 4GF1A 1D8FA 1D8MA 1IACA 4XM6A 3G42A 1XFXA 1FM1A 3CKIA 3ZVSA 3RTSA 3AIGA 5I4OA 3WV2A 3TS4A 2HU6A 4FXYP 3LJGA 1HFCA 2OW0A 1JH1A 4GR0A 1ZXCA 2A8HA 5I2ZA 1ZTQA 2DW0A 5CXAA 1G12A 2JIHA 4PKVA 1UMTA 1KUFA 2RJQA 3EHYA 1CGLA 2OZRA 2I47A 3V96B 5I3MA 3LJTA 2CLTA 2E3XA 456CA 2OW1A 3DL1A 1ZXVA 1CXVA 2MLSA 1XFZA 2OY4A 3I7GA 1JAQA 3DTEA 2OI0A 2E2DA 3F18A 1JKYA 5BOTA 3LQ0A 3O2XA 4A7BA 1AKLA 2XS4A 4G0DA 1PWUA 3EDIA 2CKIA 3LQBA 1I73A 1HV5A 3HBVP 1PWPA 3K7LA 2DDFA 2OXWA 1H71P 4QKZA 1BSWA 1B3DA 1GKCA 1MMBA 1K7GA 1BIWA 4L19A 5D1UA 1ND1A 3TSKA 1AF0A 4WKEA 5D1SA 3LJZA 1MMPA 5H8XA 1RM8A 4IJOA 2O3EA 3DTIA 4PKWA 2MLRA 1K7IA 3USNA 2Y6DA 4AUOA 2W14A 1L6JA 1GO8P 3VI1A 1A85A 3LGPA 4IUWA 966CA 1C3IA 1KBCA 4DV8A 3EDHA 3LUNA 4J4MA 1Q3AA 4XM8A 4H3XA 3EDZA 1RMZA 3VTGA 4JQGA 1G4KA 1R55A 2WO8A 1GE5A 2MZEA 5I0LA 2OW9A 1CK7A 3NX7A 1B8YA 3Q2GA 2W0DA 2YUFA 3HDAP 1XFWA 3LE9A 1JIWP 1GKDA 1USNA 1OO9A 3HB2P 1YOUA 4XM7A 1FLSA 1SMPA 5D3CA 1KUIA 5BOYA 1QUAA 2JT6A 1BUVM 3LMCA 830CA 4I35A 3UVCA 3P1VA 1A86A 1GO7P 1Z3JA 3DPEA 1I76A 1XFYA 3HBUP 4AXQA 1ATLA 5D7WA 3O64A 3RTTA 1R1HA 1HFSA 1YP1A 4GUYA 2V4BA 1CGEA 2OY2A 3AYKA 3WV3A 1JJ9A 1R54A 4WKIA 3WV1A 1SU3A 2YIGA 3G5CA 4GR3A 1IAAA 1EAKA 4A3WA 1K7QA 2D1NA 1CAQA 5LABA 3LKAA 4H2EA 5L7FA 1GXDA 4H30A 1EB6A 2SRTA 1IAGA 4I03A 4EFSA 1MMQA 2TCLA 5L79A 1OM6A 1ASTA 3ZXHA 1R1JA 3F1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWB A;  4G9L A;  1J7N A;  1PWW A;  4R3V A;  1D7X A;  3LIL A;  2OVX A;  2AYK A;  3OHO A;  3KRY A;  1OMJ A;  4JPA A;  1HTD A;  1ZS0 A;  3EHX A;  1XFV A;  3B8Z A;  1PWV A;  1JAP A;  1KUH A;  4DD8 A;  3OHL A;  1HY7 A;  1JIZ A;  2FV9 A;  2DDY A;  2POJ A;  3K7N A;  5D1T A;  3KMC A;  4GQL A;  1JAN A;  1BKC I;  1DMT A;  3F19 A;  4H1Q A;  1KUG A;  1YCM A;  4AIG A;  2W12 A;  4H84 A;  4JP4 A;  2Z2D A;  1Y0V A;  3HDB A;  1DTH A;  4FXQ A;  1HOV A;  1XUC A;  3ZUK A;  3HY7 A;  2OVZ A;  1SLM A;  5BPA A;  4H82 A;  3B92 A;  1Y8J A;  1G9K A;  4WF6 A;  1G49 A;  2O36 A;  3SHI A;  1UEA A;  3P24 A;  2ERP A;  4ZR5 A;  3LK8 A;  5CZM A;  1KUK A;  2AIG P;  2D1O A;  3HY9 A;  4JIJ A;  1BQO A;  2YB9 A;  4HX3 A;  1BM6 A;  3TVC A;  4L6T A;  2XS3 A;  4XBH A;  4PKR A;  1XUD A;  2DW2 A;  3U1R A;  5CUH A;  4ILW D;  2JSD A;  3F16 A;  4DPE A;  4FU4 A;  1BZS A;  1UMS A;  4H49 A;  1BKC A;  1I1I P;  3DPF A;  3HYG A;  3GBO A;  1KAP P;  2K9C A;  2N8R A;  5B5P A;  4CTH A;  2DW1 A;  2PJT A;  1QIA A;  2K2G A;  1EUB A;  3ELM A;  3KEC A;  4HMA A;  3AYU A;  2X7M A;  2X3A A;  3Q2H A;  3DNG A;  1GE6 A;  3LUM A;  3EWJ A;  3KEK A;  3KHI A;  1QIC A;  2W13 A;  1BUD A;  4IN9 A;  4DF9 A;  1ZVX A;  5JMY A;  4PKT A;  3I7I A;  1O0Q A;  5I43 A;  3BA0 A;  3F15 A;  2OXU A;  3LIK A;  5I12 A;  3KWV C;  1JAO A;  1MNC A;  1D5J A;  1IAE A;  3DSL A;  3KME A;  1BQQ M;  1IAD A;  4WZV A;  1BKC E;  3EDG A;  1XUR A;  3B2Z A;  4JA1 A;  1R1I A;  3LEA A;  2FV5 A;  1IAB A;  3N2V A;  1YQY A;  2MZH A;  1AYK A;  1JK3 A;  4L63 A;  2J83 A;  4FVL A;  1GE7 A;  3L0V A;  1OS9 A;  1PWQ A;  3TT4 A;  4GWN A;  1CIZ A;  1XFU A;  2MZI A;  1QJI A;  2OXZ A;  1UTZ A;  3N2U A;  3F17 A;  5D2B A;  1MMR A;  1C8T A;  1G05 A;  3E8R A;  1SLN A;  1O0T A;  1OM8 A;  2Y6C A;  1OS2 A;  4XCT A;  4WK7 A;  2KRJ A;  1CGF A;  4H76 A;  2QPJ A;  1C7K A;  1SRP A;  4GR8 A;  1ROS A;  1ZP5 A;  1QJJ A;  2OW2 A;  5B5O A;  4PKS A;  4Q1L A;  2X3C A;  1S4B P;  4GWM A;  1Y93 A;  3KEJ A;  2WO9 A;  4ON1 A;  3L0T A;  2ERQ A;  2L0R A;  3LIR A;  4PKQ A;  2W15 A;  1CQR A;  3MA2 A;  1QIB A;  2USN A;  1WNI A;  2JT5 A;  1UTT A;  2JNP A;  4PKU A;  1SAT A;  2X3B A;  1OM7 A;  2WOA A;  4AYK A;  1FBL A;  2J0T A;  2RJP A;  2ERO A;  4GF1 A;  1D8F A;  1D8M A;  1IAC A;  4XM6 A;  3G42 A;  1XFX A;  1FM1 A;  3CKI A;  3ZVS A;  3RTS A;  3AIG A;  5I4O A;  3WV2 A;  3TS4 A;  2HU6 A;  4FXY P;  3LJG A;  1HFC A;  2OW0 A;  1JH1 A;  4GR0 A;  1ZXC A;  2A8H A;  5I2Z A;  1ZTQ A;  2DW0 A;  5CXA A;  1G12 A;  2JIH A;  4PKV A;  1UMT A;  1KUF A;  2RJQ A;  3EHY A;  1CGL A;  2OZR A;  2I47 A;  3V96 B;  5I3M A;  3LJT A;  2CLT A;  2E3X A;  456C A;  2OW1 A;  3DL1 A;  1ZXV A;  1CXV A;  2MLS A;  1XFZ A;  2OY4 A;  3I7G A;  1JAQ A;  2OI0 A;  2E2D A;  3F18 A;  1JKY A;  5BOT A;  3LQ0 A;  3O2X A;  4A7B A;  1AKL A;  2XS4 A;  4G0D A;  1PWU A;  3EDI A;  2CKI A;  3LQB A;  1I73 A;  1HV5 A;  3HBV P;  1PWP A;  3K7L A;  2DDF A;  2OXW A;  1H71 P;  4QKZ A;  1BSW A;  1B3D A;  1GKC A;  1MMB A;  1K7G A;  1BIW A;  4L19 A;  5D1U A;  1ND1 A;  3TSK A;  1AF0 A;  4WKE A;  5D1S A;  3LJZ A;  1MMP A;  5H8X A;  1RM8 A;  4IJO A;  2O3E A;  4PKW A;  2MLR A;  1K7I A;  3USN A;  2Y6D A;  4AUO A;  2W14 A;  1L6J A;  1GO8 P;  3VI1 A;  1A85 A;  3LGP A;  4IUW A;  966C A;  1C3I A;  1KBC A;  4DV8 A;  3EDH A;  3LUN A;  4J4M A;  1Q3A A;  4XM8 A;  4H3X A;  3EDZ A;  1RMZ A;  3VTG A;  4JQG A;  1G4K A;  1R55 A;  2WO8 A;  1GE5 A;  2MZE A;  5I0L A;  2OW9 A;  1CK7 A;  3NX7 A;  1B8Y A;  3Q2G A;  2W0D A;  3HDA P;  1XFW A;  3LE9 A;  1JIW P;  1GKD A;  1USN A;  1OO9 A;  3HB2 P;  1YOU A;  4XM7 A;  1FLS A;  1SMP A;  5D3C A;  1KUI A;  5BOY A;  1QUA A;  2JT6 A;  1BUV M;  3LMC A;  830C A;  4I35 A;  3UVC A;  3P1V A;  1A86 A;  1GO7 P;  1Z3J A;  3DPE A;  1I76 A;  1XFY A;  3HBU P;  4AXQ A;  1ATL A;  5D7W A;  3O64 A;  3RTT A;  1R1H A;  1HFS A;  1YP1 A;  4GUY A;  2V4B A;  1CGE A;  2OY2 A;  3AYK A;  3WV3 A;  1JJ9 A;  1R54 A;  4WKI A;  3WV1 A;  1SU3 A;  2YIG A;  3G5C A;  4GR3 A;  1IAA A;  1EAK A;  4A3W A;  1K7Q A;  2D1N A;  1CAQ A;  5LAB A;  3LKA A;  4H2E A;  5L7F A;  1GXD A;  4H30 A;  1EB6 A;  2SRT A;  1IAG A;  4I03 A;  4EFS A;  1MMQ A;  2TCL A;  5L79 A;  1OM6 A;  1AST A;  3ZXH A;  1R1J A;  3F1A A; 
#chains in the Genus database with same CATH topology
 3DWB A;  4G9L A;  1J7N A;  1PWW A;  4R3V A;  1D7X A;  3LIL A;  2OVX A;  2AYK A;  3OHO A;  3KRY A;  1OMJ A;  4JPA A;  1HTD A;  1ZS0 A;  3EHX A;  1XFV A;  3B8Z A;  1PWV A;  1JAP A;  1KUH A;  4DD8 A;  3OHL A;  1HY7 A;  1JIZ A;  2FV9 A;  2DDY A;  2POJ A;  3K7N A;  5D1T A;  3KMC A;  4GQL A;  1JAN A;  1BKC I;  1DMT A;  3F19 A;  4H1Q A;  1TVI A;  1KUG A;  1YCM A;  4AIG A;  2W12 A;  1OZ9 A;  4H84 A;  4JP4 A;  2Z2D A;  1Y0V A;  3HDB A;  1DTH A;  4FXQ A;  1HOV A;  4L7A A;  1XUC A;  3ZUK A;  3HY7 A;  2OVZ A;  1SLM A;  5BPA A;  4H82 A;  3B92 A;  1Y8J A;  1G9K A;  4WF6 A;  1G49 A;  2O36 A;  3SHI A;  1UEA A;  3P24 A;  2ERP A;  4ZR5 A;  3LK8 A;  5CZM A;  1KUK A;  2AIG P;  2D1O A;  3HY9 A;  4JIJ A;  1BQO A;  2YB9 A;  4HX3 A;  1BM6 A;  3TVC A;  4L6T A;  2XS3 A;  4XBH A;  4PKR A;  1XUD A;  2DW2 A;  3U1R A;  5CUH A;  4ILW D;  2JSD A;  3F16 A;  4DPE A;  4FU4 A;  1BZS A;  1UMS A;  4H49 A;  1BKC A;  1I1I P;  3DPF A;  3HYG A;  3GBO A;  1KAP P;  2K9C A;  2N8R A;  5B5P A;  4CTH A;  2DW1 A;  2PJT A;  1QIA A;  2K2G A;  1EUB A;  3ELM A;  3KEC A;  4HMA A;  3AYU A;  2X7M A;  2X3A A;  3Q2H A;  3DNG A;  1GE6 A;  3LUM A;  3EWJ A;  3KEK A;  3KHI A;  1QIC A;  2W13 A;  1BUD A;  4IN9 A;  4DF9 A;  1ZVX A;  5JMY A;  4PKT A;  3I7I A;  1O0Q A;  5I43 A;  3BA0 A;  3F15 A;  2OXU A;  3LIK A;  5I12 A;  3KWV C;  1JAO A;  1MNC A;  1D5J A;  1IAE A;  3DSL A;  3KME A;  1BQQ M;  1IAD A;  4WZV A;  1BKC E;  3EDG A;  1XUR A;  3B2Z A;  4JA1 A;  1R1I A;  3LEA A;  2FV5 A;  1IAB A;  3N2V A;  1YQY A;  2MZH A;  1AYK A;  1JK3 A;  4L63 A;  2J83 A;  4FVL A;  1GE7 A;  3L0V A;  1OS9 A;  1PWQ A;  3TT4 A;  4GWN A;  1CIZ A;  1XFU A;  2MZI A;  1QJI A;  2OXZ A;  1UTZ A;  3N2U A;  3F17 A;  5D2B A;  1MMR A;  1C8T A;  1G05 A;  3E8R A;  1SLN A;  1O0T A;  1OM8 A;  2Y6C A;  1OS2 A;  4XCT A;  4WK7 A;  2KRJ A;  1CGF A;  4H76 A;  2QPJ A;  1C7K A;  1SRP A;  1XAX A;  4GR8 A;  1ROS A;  1ZP5 A;  1QJJ A;  2OW2 A;  5B5O A;  4PKS A;  4Q1L A;  2X3C A;  1S4B P;  4GWM A;  1Y93 A;  3KEJ A;  2WO9 A;  4ON1 A;  3L0T A;  2ERQ A;  2L0R A;  3LIR A;  4PKQ A;  2W15 A;  1CQR A;  3DTK A;  3MA2 A;  1QIB A;  2USN A;  1WNI A;  2JT5 A;  1UTT A;  2JNP A;  4PKU A;  1SAT A;  2X3B A;  1OM7 A;  2WOA A;  4AYK A;  1FBL A;  2J0T A;  2RJP A;  2ERO A;  4GF1 A;  1D8F A;  1D8M A;  1IAC A;  4XM6 A;  3G42 A;  1XFX A;  1FM1 A;  3CKI A;  3ZVS A;  3RTS A;  3AIG A;  5I4O A;  3WV2 A;  3TS4 A;  2HU6 A;  4FXY P;  3LJG A;  1HFC A;  2OW0 A;  1JH1 A;  4GR0 A;  1ZXC A;  2A8H A;  5I2Z A;  1ZTQ A;  2DW0 A;  5CXA A;  1G12 A;  2JIH A;  4PKV A;  1UMT A;  1KUF A;  2RJQ A;  3EHY A;  1CGL A;  2OZR A;  2I47 A;  3V96 B;  5I3M A;  3LJT A;  2CLT A;  2E3X A;  456C A;  2OW1 A;  3DL1 A;  1ZXV A;  1CXV A;  2MLS A;  1XFZ A;  2OY4 A;  3I7G A;  1JAQ A;  3DTE A;  2OI0 A;  2E2D A;  3F18 A;  1JKY A;  5BOT A;  3LQ0 A;  3O2X A;  1XM5 A;  4A7B A;  1AKL A;  2XS4 A;  4G0D A;  1PWU A;  3EDI A;  2CKI A;  3LQB A;  1I73 A;  1HV5 A;  3HBV P;  1PWP A;  3K7L A;  2DDF A;  2OXW A;  1H71 P;  4QKZ A;  1BSW A;  1B3D A;  1GKC A;  1MMB A;  1K7G A;  1BIW A;  4L19 A;  5D1U A;  1ND1 A;  3TSK A;  1AF0 A;  4WKE A;  5D1S A;  3LJZ A;  1MMP A;  5H8X A;  1RM8 A;  4IJO A;  2O3E A;  3DTI A;  4PKW A;  2MLR A;  1K7I A;  3USN A;  2Y6D A;  4AUO A;  2W14 A;  1L6J A;  1GO8 P;  3VI1 A;  1A85 A;  3LGP A;  4IUW A;  966C A;  1C3I A;  1KBC A;  4DV8 A;  3EDH A;  3LUN A;  4J4M A;  1Q3A A;  4XM8 A;  4H3X A;  3EDZ A;  1RMZ A;  3VTG A;  4JQG A;  1G4K A;  1R55 A;  2WO8 A;  1GE5 A;  2MZE A;  5I0L A;  2OW9 A;  1CK7 A;  3NX7 A;  1B8Y A;  3Q2G A;  2W0D A;  2YUF A;  3HDA P;  1XFW A;  3LE9 A;  1JIW P;  1GKD A;  1USN A;  1OO9 A;  3HB2 P;  1YOU A;  4XM7 A;  1FLS A;  1SMP A;  5D3C A;  1KUI A;  5BOY A;  1QUA A;  2JT6 A;  1BUV M;  3LMC A;  830C A;  4I35 A;  3UVC A;  3P1V A;  1A86 A;  1GO7 P;  1Z3J A;  3DPE A;  1I76 A;  1XFY A;  3HBU P;  4AXQ A;  1ATL A;  5D7W A;  3O64 A;  3RTT A;  1R1H A;  1HFS A;  1YP1 A;  4GUY A;  2V4B A;  1CGE A;  2OY2 A;  3AYK A;  3WV3 A;  1JJ9 A;  1R54 A;  4WKI A;  3WV1 A;  1SU3 A;  2YIG A;  3G5C A;  4GR3 A;  1IAA A;  1EAK A;  4A3W A;  1K7Q A;  2D1N A;  1CAQ A;  5LAB A;  3LKA A;  4H2E A;  5L7F A;  1GXD A;  4H30 A;  1EB6 A;  2SRT A;  1IAG A;  4I03 A;  4EFS A;  1MMQ A;  2TCL A;  5L79 A;  1OM6 A;  1AST A;  3ZXH A;  1R1J A;  3F1A A; 
#chains in the Genus database with same CATH homology
 3DWB A;  4G9L A;  1J7N A;  1PWW A;  4R3V A;  1D7X A;  3LIL A;  2OVX A;  2AYK A;  3OHO A;  3KRY A;  1OMJ A;  4JPA A;  1HTD A;  1ZS0 A;  3EHX A;  1XFV A;  3B8Z A;  1PWV A;  1JAP A;  1KUH A;  4DD8 A;  3OHL A;  1HY7 A;  1JIZ A;  2FV9 A;  2DDY A;  2POJ A;  3K7N A;  5D1T A;  3KMC A;  4GQL A;  1JAN A;  1BKC I;  1DMT A;  3F19 A;  4H1Q A;  1KUG A;  1YCM A;  4AIG A;  2W12 A;  4H84 A;  4JP4 A;  2Z2D A;  1Y0V A;  3HDB A;  1DTH A;  4FXQ A;  1HOV A;  4L7A A;  1XUC A;  3ZUK A;  3HY7 A;  2OVZ A;  1SLM A;  5BPA A;  4H82 A;  3B92 A;  1Y8J A;  1G9K A;  4WF6 A;  1G49 A;  2O36 A;  3SHI A;  1UEA A;  3P24 A;  2ERP A;  4ZR5 A;  3LK8 A;  5CZM A;  1KUK A;  2AIG P;  2D1O A;  3HY9 A;  4JIJ A;  1BQO A;  2YB9 A;  4HX3 A;  1BM6 A;  3TVC A;  4L6T A;  2XS3 A;  4XBH A;  4PKR A;  1XUD A;  2DW2 A;  3U1R A;  5CUH A;  4ILW D;  2JSD A;  3F16 A;  4DPE A;  4FU4 A;  1BZS A;  1UMS A;  4H49 A;  1BKC A;  1I1I P;  3DPF A;  3HYG A;  3GBO A;  1KAP P;  2K9C A;  2N8R A;  5B5P A;  4CTH A;  2DW1 A;  2PJT A;  1QIA A;  2K2G A;  1EUB A;  3ELM A;  3KEC A;  4HMA A;  3AYU A;  2X7M A;  2X3A A;  3Q2H A;  3DNG A;  1GE6 A;  3LUM A;  3EWJ A;  3KEK A;  3KHI A;  1QIC A;  2W13 A;  1BUD A;  4IN9 A;  4DF9 A;  1ZVX A;  5JMY A;  4PKT A;  3I7I A;  1O0Q A;  5I43 A;  3BA0 A;  3F15 A;  2OXU A;  3LIK A;  5I12 A;  3KWV C;  1JAO A;  1MNC A;  1D5J A;  1IAE A;  3DSL A;  3KME A;  1BQQ M;  1IAD A;  4WZV A;  1BKC E;  3EDG A;  1XUR A;  3B2Z A;  4JA1 A;  1R1I A;  3LEA A;  2FV5 A;  1IAB A;  3N2V A;  1YQY A;  2MZH A;  1AYK A;  1JK3 A;  4L63 A;  2J83 A;  4FVL A;  1GE7 A;  3L0V A;  1OS9 A;  1PWQ A;  3TT4 A;  4GWN A;  1CIZ A;  1XFU A;  2MZI A;  1QJI A;  2OXZ A;  1UTZ A;  3N2U A;  3F17 A;  5D2B A;  1MMR A;  1C8T A;  1G05 A;  3E8R A;  1SLN A;  1O0T A;  1OM8 A;  2Y6C A;  1OS2 A;  4XCT A;  4WK7 A;  2KRJ A;  1CGF A;  4H76 A;  2QPJ A;  1C7K A;  1SRP A;  4GR8 A;  1ROS A;  1ZP5 A;  1QJJ A;  2OW2 A;  5B5O A;  4PKS A;  4Q1L A;  2X3C A;  1S4B P;  4GWM A;  1Y93 A;  3KEJ A;  2WO9 A;  4ON1 A;  3L0T A;  2ERQ A;  2L0R A;  3LIR A;  4PKQ A;  2W15 A;  1CQR A;  3DTK A;  3MA2 A;  1QIB A;  2USN A;  1WNI A;  2JT5 A;  1UTT A;  2JNP A;  4PKU A;  1SAT A;  2X3B A;  1OM7 A;  2WOA A;  4AYK A;  1FBL A;  2J0T A;  2RJP A;  2ERO A;  4GF1 A;  1D8F A;  1D8M A;  1IAC A;  4XM6 A;  3G42 A;  1XFX A;  1FM1 A;  3CKI A;  3ZVS A;  3RTS A;  3AIG A;  5I4O A;  3WV2 A;  3TS4 A;  2HU6 A;  4FXY P;  3LJG A;  1HFC A;  2OW0 A;  1JH1 A;  4GR0 A;  1ZXC A;  2A8H A;  5I2Z A;  1ZTQ A;  2DW0 A;  5CXA A;  1G12 A;  2JIH A;  4PKV A;  1UMT A;  1KUF A;  2RJQ A;  3EHY A;  1CGL A;  2OZR A;  2I47 A;  3V96 B;  5I3M A;  3LJT A;  2CLT A;  2E3X A;  456C A;  2OW1 A;  3DL1 A;  1ZXV A;  1CXV A;  2MLS A;  1XFZ A;  2OY4 A;  3I7G A;  1JAQ A;  3DTE A;  2OI0 A;  2E2D A;  3F18 A;  1JKY A;  5BOT A;  3LQ0 A;  3O2X A;  4A7B A;  1AKL A;  2XS4 A;  4G0D A;  1PWU A;  3EDI A;  2CKI A;  3LQB A;  1I73 A;  1HV5 A;  3HBV P;  1PWP A;  3K7L A;  2DDF A;  2OXW A;  1H71 P;  4QKZ A;  1BSW A;  1B3D A;  1GKC A;  1MMB A;  1K7G A;  1BIW A;  4L19 A;  5D1U A;  1ND1 A;  3TSK A;  1AF0 A;  4WKE A;  5D1S A;  3LJZ A;  1MMP A;  5H8X A;  1RM8 A;  4IJO A;  2O3E A;  3DTI A;  4PKW A;  2MLR A;  1K7I A;  3USN A;  2Y6D A;  4AUO A;  2W14 A;  1L6J A;  1GO8 P;  3VI1 A;  1A85 A;  3LGP A;  4IUW A;  966C A;  1C3I A;  1KBC A;  4DV8 A;  3EDH A;  3LUN A;  4J4M A;  1Q3A A;  4XM8 A;  4H3X A;  3EDZ A;  1RMZ A;  3VTG A;  4JQG A;  1G4K A;  1R55 A;  2WO8 A;  1GE5 A;  2MZE A;  5I0L A;  2OW9 A;  1CK7 A;  3NX7 A;  1B8Y A;  3Q2G A;  2W0D A;  2YUF A;  3HDA P;  1XFW A;  3LE9 A;  1JIW P;  1GKD A;  1USN A;  1OO9 A;  3HB2 P;  1YOU A;  4XM7 A;  1FLS A;  1SMP A;  5D3C A;  1KUI A;  5BOY A;  1QUA A;  2JT6 A;  1BUV M;  3LMC A;  830C A;  4I35 A;  3UVC A;  3P1V A;  1A86 A;  1GO7 P;  1Z3J A;  3DPE A;  1I76 A;  1XFY A;  3HBU P;  4AXQ A;  1ATL A;  5D7W A;  3O64 A;  3RTT A;  1R1H A;  1HFS A;  1YP1 A;  4GUY A;  2V4B A;  1CGE A;  2OY2 A;  3AYK A;  3WV3 A;  1JJ9 A;  1R54 A;  4WKI A;  3WV1 A;  1SU3 A;  2YIG A;  3G5C A;  4GR3 A;  1IAA A;  1EAK A;  4A3W A;  1K7Q A;  2D1N A;  1CAQ A;  5LAB A;  3LKA A;  4H2E A;  5L7F A;  1GXD A;  4H30 A;  1EB6 A;  2SRT A;  1IAG A;  4I03 A;  4EFS A;  1MMQ A;  2TCL A;  5L79 A;  1OM6 A;  1AST A;  3ZXH A;  1R1J A;  3F1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...