1BM6A

Solution structure of the catalytic domain of human stromelysin-1 complexed to a potent non-peptidic inhibitor, nmr, 20 structures
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
173
structure length
173
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMELYSIN-1
publication title Solution structure of the catalytic domain of human stromelysin-1 complexed to a potent, nonpeptidic inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease
total genus 24
structure length 173
sequence length 173
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1bm6A00
1OM7A 3ZXHA 1L6JA 2TCLA 1GXDA 1Y8JA 2JNPA 4WKIA 1IAEA 2D1OA 1ZXVA 1GE6A 1XFYA 5D1TA 1MMRA 1BQOA 1OM8A 1MMBA 1R1IA 4JA1A 4CTHA 2OZRA 5D1SA 2K9CA 4ZR5A 1WNIA 2RJPA 1XFUA 3HBVP 3I7GA 2SRTA 3WV1A 4G9LA 830CA 2W12A 1I1IP 5BPAA 4GF1A 3OHLA 1USNA 2MLRA 3Q2GA 3EHXA 1ZS0A 1GE5A 1ROSA 3HYGA 5L7FA 4PKSA 2AYKA 1RMZA 3LJZA 1B3DA 1MMQA 1ZTQA 3F19A 1Q3AA 2OY4A 2HU6A 1UMSA 5I3MA 3LQBA 1DMTA 4R3VA 1CGLA 1OS2A 2DW1A 1D8FA 1JJ9A 1UTZA 4DV8A 1K7IA 1C7KA 1JIWP 1D7XA 1IACA 1A85A 2K2GA 1DTHA 5BOTA 1HFCA 1IABA 5B5PA 1IAGA 4H82A 1I73A 3OHOA 3AIGA 2OXUA 3F16A 4J4MA 1GKCA 4HX3A 1D8MA 4WZVA 1KUKA 1EB6A 4HMAA 1ND1A 1JIZA 2USNA 3F18A 4IJOA 4XBHA 1Y93A 4DF9A 3KHIA 1PWWA 1KUHA 2QPJA 4FU4A 3LILA 1GKDA 4GR0A 456CA 1PWVA 2OI0A 3DSLA 4WK7A 1KAPP 1OO9A 2D1NA 4G0DA 1QUAA 1JAQA 4L19A 1K7GA 4H1QA 4PKVA 4XM8A 1RM8A 4JIJA 1QJIA 3HBUP 4AIGA 3TSKA 1KUFA 2J83A 5I12A 1BUVM 4PKTA 3TVCA 3F15A 3LIRA 3ZUKA 3KEJA 2XS3A 3N2VA 2O3EA 4PKQA 1ATLA 3KWVC 2DDYA 2OVXA 4AYKA 2MLSA 2WO9A 4A3WA 5CUHA 1HOVA 2MZEA 2POJA 1J7NA 4WKEA 1ZVXA 1R1HA 2DW0A 3O2XA 1H71P 3KMCA 1CIZA 2E2DA 2X3BA 1BKCI 3B8ZA 3GBOA 1AF0A 4H30A 4A7BA 4JP4A 3LIKA 3VI1A 3DNGA 4QKZA 1Y0VA 4GWMA 1ZXCA 4FXYP 4L63A 5JMYA 4DPEA 2WO8A 1B8YA 1I76A 3LKAA 4ON1A 2JIHA 3LE9A 1CGEA 3F1AA 1YOUA 1CXVA 1HY7A 4JQGA 4H76A 1HV5A 2O36A 1C8TA 1CQRA 4I03A 5D1UA 3HB2P 3EDZA 1BKCE 1EAKA 2X3CA 2WOAA 1UEAA 3AYKA 3RTTA 2OVZA 4H49A 1QJJA 4WF6A 3ELMA 1OMJA 1G49A 1BQQM 4PKUA 1Z3JA 2OW1A 1IAAA 4GUYA 5D3CA 1BUDA 2L0RA 5CZMA 3LGPA 1BM6A 2JT6A 1YCMA 5B5OA 3LUNA 2X3AA 1MNCA 3EDIA 1UTTA 3LMCA 1G9KA 2CLTA 1AYKA 1PWQA 4XM7A 1PWUA 3LK8A 3N2UA 5L79A 3WV3A 2Y6DA 4Q1LA 2W0DA 2EROA 2XS4A 5CXAA 3G42A 966CA 1ASTA 1SU3A 4IN9A 4GQLA 4PKRA 1OS9A 3HDBA 3U1RA 2YB9A 5I0LA 2JSDA 1K7QA 1GE7A 4DD8A 3K7LA 2Y6CA 3ZVSA 1XURA 3I7IA 1XFWA 3Q2HA 1JAOA 3WV2A 3HY7A 5I2ZA 1XFZA 1KUIA 1BKCA 5D7WA 5I4OA 1SMPA 1QIBA 1SRPA 3LEAA 2W13A 4H84A 3DPFA 2OW2A 1BIWA 2V4BA 3LJGA 5H8XA 4IUWA 2W15A 2ERQA 3O64A 3LQ0A 2W14A 3HY9A 3EDHA 1R1JA 2OW0A 2AIGP 1QIAA 1XFVA 3KMEA 1GO7P 4FVLA 3USNA 4H3XA 2OY2A 4PKWA 3TT4A 1G05A 1BSWA 1MMPA 1O0QA 1JKYA 1G4KA 2A8HA 4L6TA 1JAPA 2YIGA 1D5JA 4GR3A 1EUBA 2OXWA 3DPEA 2KRJA 1QICA 1XUCA 4JPAA 1CK7A 5BOYA 1AKLA 1HTDA 2PJTA 2J0TA 3DWBA 1XFXA 3KECA 1SLNA 2I47A 3RTSA 2DW2A 3K7NA 3AYUA 3E8RA 4GR8A 3G5CA 3P1VA 2OXZA 1FLSA 5LABA 1BZSA 2Z2DA 2FV5A 3NX7A 1R54A 2X7MA 4ILWD 5I43A 3EHYA 1CGFA 1XUDA 3LJTA 3L0TA 3KRYA 1ZP5A 1YP1A 4AXQA 4FXQA 3P24A 3SHIA 3DL1A 3LUMA 3L0VA 1FBLA 1O0TA 1GO8P 3MA2A 2FV9A 2ERPA 2N8RA 2CKIA 1SLMA 1R55A 2MZIA 4EFSA 2E3XA 3V96B 3EWJA 3EDGA 3VTGA 4GWNA 3HDAP 1HFSA 1PWPA 3F17A 1UMTA 1FM1A 5D2BA 1JK3A 3UVCA 1JANA 3KEKA 4AUOA 1YQYA 3TS4A 4XCTA 2OW9A 2MZHA 1SATA 2RJQA 1JH1A 3B2ZA 1A86A 1KUGA 4H2EA 1C3IA 3B92A 1G12A 1IADA 3CKIA 2DDFA 3BA0A 4I35A 1S4BP 1OM6A 2JT5A 1CAQA 4XM6A 1KBCA
chains in the Genus database with same CATH superfamily
1OM7A 3ZXHA 1L6JA 2TCLA 1GXDA 1Y8JA 2JNPA 4WKIA 1IAEA 2D1OA 1ZXVA 1GE6A 1XFYA 5D1TA 1MMRA 1BQOA 1OM8A 1MMBA 1R1IA 4JA1A 4CTHA 2OZRA 5D1SA 2K9CA 4ZR5A 1WNIA 2RJPA 1XFUA 3HBVP 3I7GA 2SRTA 3WV1A 4G9LA 830CA 2W12A 1I1IP 5BPAA 4GF1A 3OHLA 1USNA 2MLRA 3DTKA 3Q2GA 3EHXA 1ZS0A 1GE5A 1ROSA 3HYGA 5L7FA 4PKSA 2AYKA 1RMZA 3LJZA 1B3DA 1MMQA 1ZTQA 3F19A 1Q3AA 2OY4A 2HU6A 1UMSA 5I3MA 3LQBA 1DMTA 4R3VA 1CGLA 1OS2A 2DW1A 1D8FA 1JJ9A 1UTZA 4DV8A 1K7IA 1C7KA 1JIWP 1D7XA 1IACA 1A85A 2K2GA 3DTIA 1DTHA 5BOTA 1HFCA 1IABA 5B5PA 1IAGA 4H82A 1I73A 3OHOA 3AIGA 2OXUA 3F16A 4J4MA 1GKCA 4HX3A 1D8MA 4WZVA 1KUKA 1EB6A 4HMAA 1ND1A 1JIZA 2USNA 3F18A 4IJOA 4XBHA 1Y93A 4DF9A 3KHIA 1PWWA 1KUHA 2QPJA 4FU4A 3LILA 1GKDA 4GR0A 456CA 1PWVA 2OI0A 3DSLA 4WK7A 1KAPP 1OO9A 2D1NA 2YUFA 4G0DA 1QUAA 1JAQA 4L19A 1K7GA 4H1QA 4PKVA 4XM8A 1RM8A 4JIJA 1QJIA 3HBUP 4AIGA 3TSKA 1KUFA 1XAXA 2J83A 5I12A 1BUVM 4PKTA 3TVCA 3F15A 3LIRA 3ZUKA 3KEJA 2XS3A 3N2VA 2O3EA 4PKQA 1ATLA 3KWVC 2DDYA 2OVXA 4AYKA 2MLSA 2WO9A 4A3WA 5CUHA 1HOVA 2MZEA 2POJA 1J7NA 4WKEA 1ZVXA 1R1HA 2DW0A 3O2XA 1H71P 3KMCA 1CIZA 2E2DA 2X3BA 1BKCI 3B8ZA 3GBOA 4L7AA 1AF0A 4H30A 4A7BA 4JP4A 3LIKA 3VI1A 3DNGA 4QKZA 1Y0VA 4GWMA 1ZXCA 4FXYP 4L63A 5JMYA 4DPEA 1TVIA 2WO8A 1B8YA 1I76A 3LKAA 4ON1A 2JIHA 3LE9A 1CGEA 3F1AA 1YOUA 1CXVA 1HY7A 4JQGA 4H76A 1HV5A 2O36A 1C8TA 1CQRA 4I03A 5D1UA 3HB2P 3EDZA 1BKCE 1EAKA 2X3CA 2WOAA 1UEAA 3AYKA 3RTTA 2OVZA 4H49A 1QJJA 4WF6A 3ELMA 1OMJA 1G49A 1BQQM 4PKUA 1Z3JA 2OW1A 1IAAA 4GUYA 5D3CA 1BUDA 2L0RA 5CZMA 3LGPA 1BM6A 2JT6A 1YCMA 5B5OA 3LUNA 2X3AA 1MNCA 3EDIA 1UTTA 3LMCA 1G9KA 2CLTA 1AYKA 1PWQA 4XM7A 1PWUA 3LK8A 3N2UA 5L79A 3WV3A 2Y6DA 4Q1LA 2W0DA 2EROA 2XS4A 5CXAA 3G42A 966CA 1ASTA 1SU3A 4IN9A 4GQLA 4PKRA 1OZ9A 1OS9A 3HDBA 3U1RA 2YB9A 3DTEA 5I0LA 2JSDA 1K7QA 1GE7A 4DD8A 3K7LA 2Y6CA 3ZVSA 1XURA 3I7IA 1XFWA 3Q2HA 1JAOA 3WV2A 3HY7A 5I2ZA 1XFZA 1KUIA 1BKCA 5D7WA 5I4OA 1SMPA 1QIBA 1SRPA 3LEAA 2W13A 4H84A 3DPFA 2OW2A 1BIWA 2V4BA 3LJGA 5H8XA 4IUWA 2W15A 2ERQA 3O64A 3LQ0A 2W14A 3HY9A 3EDHA 1R1JA 2OW0A 2AIGP 1QIAA 1XFVA 3KMEA 1GO7P 4FVLA 3USNA 4H3XA 2OY2A 4PKWA 3TT4A 1G05A 1BSWA 1MMPA 1O0QA 1JKYA 1G4KA 2A8HA 4L6TA 1JAPA 2YIGA 1D5JA 4GR3A 1EUBA 2OXWA 3DPEA 2KRJA 1QICA 1XUCA 4JPAA 1CK7A 5BOYA 1AKLA 1HTDA 2PJTA 2J0TA 3DWBA 1XFXA 3KECA 1SLNA 2I47A 3RTSA 2DW2A 3K7NA 3AYUA 3E8RA 4GR8A 3G5CA 3P1VA 2OXZA 1FLSA 5LABA 1BZSA 2Z2DA 2FV5A 3NX7A 1R54A 2X7MA 4ILWD 5I43A 3EHYA 1CGFA 1XUDA 3LJTA 3L0TA 3KRYA 1ZP5A 1YP1A 4AXQA 4FXQA 3P24A 3SHIA 3DL1A 3LUMA 3L0VA 1FBLA 1O0TA 1GO8P 3MA2A 2FV9A 2ERPA 2N8RA 2CKIA 1SLMA 1R55A 2MZIA 4EFSA 2E3XA 3V96B 3EWJA 3EDGA 3VTGA 4GWNA 3HDAP 1HFSA 1PWPA 3F17A 1UMTA 1FM1A 5D2BA 1JK3A 3UVCA 1JANA 3KEKA 4AUOA 1YQYA 3TS4A 4XCTA 2OW9A 1XM5A 2MZHA 1SATA 2RJQA 1JH1A 3B2ZA 1A86A 1KUGA 4H2EA 1C3IA 3B92A 1G12A 1IADA 3CKIA 2DDFA 3BA0A 4I35A 1S4BP 1OM6A 2JT5A 1CAQA 4XM6A 1KBCA
chains in the Genus database with same CATH topology
1OM7A 3ZXHA 1L6JA 2TCLA 1GXDA 1Y8JA 2JNPA 4WKIA 1IAEA 2D1OA 1ZXVA 1GE6A 1XFYA 5D1TA 1MMRA 1BQOA 1OM8A 1MMBA 1R1IA 4JA1A 4CTHA 2OZRA 5D1SA 2K9CA 4ZR5A 1WNIA 2RJPA 1XFUA 3HBVP 3I7GA 2SRTA 3WV1A 4G9LA 830CA 2W12A 1I1IP 5BPAA 4GF1A 3OHLA 1USNA 2MLRA 3DTKA 3Q2GA 3EHXA 1ZS0A 1GE5A 1ROSA 3HYGA 5L7FA 4PKSA 2AYKA 1RMZA 3LJZA 1B3DA 1MMQA 1ZTQA 3F19A 1Q3AA 2OY4A 2HU6A 1UMSA 5I3MA 3LQBA 1DMTA 4R3VA 1CGLA 1OS2A 2DW1A 1D8FA 1JJ9A 1UTZA 4DV8A 1K7IA 1C7KA 1JIWP 1D7XA 1IACA 1A85A 2K2GA 3DTIA 1DTHA 5BOTA 1HFCA 1IABA 5B5PA 1IAGA 4H82A 1I73A 3OHOA 3AIGA 2OXUA 3F16A 4J4MA 1GKCA 4HX3A 1D8MA 4WZVA 1KUKA 1EB6A 4HMAA 1ND1A 1JIZA 2USNA 3F18A 4IJOA 4XBHA 1Y93A 4DF9A 3KHIA 1PWWA 1KUHA 2QPJA 4FU4A 3LILA 1GKDA 4GR0A 456CA 1PWVA 2OI0A 3DSLA 4WK7A 1KAPP 1OO9A 2D1NA 2YUFA 4G0DA 1QUAA 1JAQA 4L19A 1K7GA 4H1QA 4PKVA 4XM8A 1RM8A 4JIJA 1QJIA 3HBUP 4AIGA 3TSKA 1KUFA 2J83A 5I12A 1BUVM 4PKTA 3TVCA 3F15A 3LIRA 3ZUKA 3KEJA 2XS3A 3N2VA 2O3EA 4PKQA 1ATLA 3KWVC 2DDYA 2OVXA 4AYKA 2MLSA 2WO9A 4A3WA 5CUHA 1HOVA 2MZEA 2POJA 1J7NA 4WKEA 1ZVXA 1R1HA 2DW0A 3O2XA 1H71P 3KMCA 1CIZA 2E2DA 2X3BA 1BKCI 3B8ZA 3GBOA 4L7AA 1AF0A 4H30A 4A7BA 4JP4A 3LIKA 3VI1A 3DNGA 4QKZA 1Y0VA 4GWMA 1ZXCA 4FXYP 4L63A 5JMYA 4DPEA 2WO8A 1B8YA 1I76A 3LKAA 4ON1A 2JIHA 3LE9A 1CGEA 3F1AA 1YOUA 1CXVA 1HY7A 4JQGA 4H76A 1HV5A 2O36A 1C8TA 1CQRA 4I03A 5D1UA 3HB2P 3EDZA 1BKCE 1EAKA 2X3CA 2WOAA 1UEAA 3AYKA 3RTTA 2OVZA 4H49A 1QJJA 4WF6A 3ELMA 1OMJA 1G49A 1BQQM 4PKUA 1Z3JA 2OW1A 1IAAA 4GUYA 5D3CA 1BUDA 2L0RA 5CZMA 3LGPA 1BM6A 2JT6A 1YCMA 5B5OA 3LUNA 2X3AA 1MNCA 3EDIA 1UTTA 3LMCA 1G9KA 2CLTA 1AYKA 1PWQA 4XM7A 1PWUA 3LK8A 3N2UA 5L79A 3WV3A 2Y6DA 4Q1LA 2W0DA 2EROA 2XS4A 5CXAA 3G42A 966CA 1ASTA 1SU3A 4IN9A 4GQLA 4PKRA 1OS9A 3HDBA 3U1RA 2YB9A 3DTEA 5I0LA 2JSDA 1K7QA 1GE7A 4DD8A 3K7LA 2Y6CA 3ZVSA 1XURA 3I7IA 1XFWA 3Q2HA 1JAOA 3WV2A 3HY7A 5I2ZA 1XFZA 1KUIA 1BKCA 5D7WA 5I4OA 1SMPA 1QIBA 1SRPA 3LEAA 2W13A 4H84A 3DPFA 2OW2A 1BIWA 2V4BA 3LJGA 5H8XA 4IUWA 2W15A 2ERQA 3O64A 3LQ0A 2W14A 3HY9A 3EDHA 1R1JA 2OW0A 2AIGP 1QIAA 1XFVA 3KMEA 1GO7P 4FVLA 3USNA 4H3XA 2OY2A 4PKWA 3TT4A 1G05A 1BSWA 1MMPA 1O0QA 1JKYA 1G4KA 2A8HA 4L6TA 1JAPA 2YIGA 1D5JA 4GR3A 1EUBA 2OXWA 3DPEA 2KRJA 1QICA 1XUCA 4JPAA 1CK7A 5BOYA 1AKLA 1HTDA 2PJTA 2J0TA 3DWBA 1XFXA 3KECA 1SLNA 2I47A 3RTSA 2DW2A 3K7NA 3AYUA 3E8RA 4GR8A 3G5CA 3P1VA 2OXZA 1FLSA 5LABA 1BZSA 2Z2DA 2FV5A 3NX7A 1R54A 2X7MA 4ILWD 5I43A 3EHYA 1CGFA 1XUDA 3LJTA 3L0TA 3KRYA 1ZP5A 1YP1A 4AXQA 4FXQA 3P24A 3SHIA 3DL1A 3LUMA 3L0VA 1FBLA 1O0TA 1GO8P 3MA2A 2FV9A 2ERPA 2N8RA 2CKIA 1SLMA 1R55A 2MZIA 4EFSA 2E3XA 3V96B 3EWJA 3EDGA 3VTGA 4GWNA 3HDAP 1HFSA 1PWPA 3F17A 1UMTA 1FM1A 5D2BA 1JK3A 3UVCA 1JANA 3KEKA 4AUOA 1YQYA 3TS4A 4XCTA 2OW9A 2MZHA 1SATA 2RJQA 1JH1A 3B2ZA 1A86A 1KUGA 4H2EA 1C3IA 3B92A 1G12A 1IADA 3CKIA 2DDFA 3BA0A 4I35A 1S4BP 1OM6A 2JT5A 1CAQA 4XM6A 1KBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OM7 A;  3ZXH A;  1L6J A;  2TCL A;  1GXD A;  1Y8J A;  2JNP A;  4WKI A;  1IAE A;  2D1O A;  1ZXV A;  1GE6 A;  1XFY A;  5D1T A;  1MMR A;  1BQO A;  1OM8 A;  1MMB A;  1R1I A;  4JA1 A;  4CTH A;  2OZR A;  5D1S A;  2K9C A;  4ZR5 A;  1WNI A;  2RJP A;  1XFU A;  3HBV P;  3I7G A;  2SRT A;  3WV1 A;  4G9L A;  830C A;  2W12 A;  1I1I P;  5BPA A;  4GF1 A;  3OHL A;  1USN A;  2MLR A;  3Q2G A;  3EHX A;  1ZS0 A;  1GE5 A;  1ROS A;  3HYG A;  5L7F A;  4PKS A;  2AYK A;  1RMZ A;  3LJZ A;  1B3D A;  1MMQ A;  1ZTQ A;  3F19 A;  1Q3A A;  2OY4 A;  2HU6 A;  1UMS A;  5I3M A;  3LQB A;  1DMT A;  4R3V A;  1CGL A;  1OS2 A;  2DW1 A;  1D8F A;  1JJ9 A;  1UTZ A;  4DV8 A;  1K7I A;  1C7K A;  1JIW P;  1D7X A;  1IAC A;  1A85 A;  2K2G A;  1DTH A;  5BOT A;  1HFC A;  1IAB A;  5B5P A;  1IAG A;  4H82 A;  1I73 A;  3OHO A;  3AIG A;  2OXU A;  3F16 A;  4J4M A;  1GKC A;  4HX3 A;  1D8M A;  4WZV A;  1KUK A;  1EB6 A;  4HMA A;  1ND1 A;  1JIZ A;  2USN A;  3F18 A;  4IJO A;  4XBH A;  1Y93 A;  4DF9 A;  3KHI A;  1PWW A;  1KUH A;  2QPJ A;  4FU4 A;  3LIL A;  1GKD A;  4GR0 A;  456C A;  1PWV A;  2OI0 A;  3DSL A;  4WK7 A;  1KAP P;  1OO9 A;  2D1N A;  4G0D A;  1QUA A;  1JAQ A;  4L19 A;  1K7G A;  4H1Q A;  4PKV A;  4XM8 A;  1RM8 A;  4JIJ A;  1QJI A;  3HBU P;  4AIG A;  3TSK A;  1KUF A;  2J83 A;  5I12 A;  1BUV M;  4PKT A;  3TVC A;  3F15 A;  3LIR A;  3ZUK A;  3KEJ A;  2XS3 A;  3N2V A;  2O3E A;  4PKQ A;  1ATL A;  3KWV C;  2DDY A;  2OVX A;  4AYK A;  2MLS A;  2WO9 A;  4A3W A;  5CUH A;  1HOV A;  2MZE A;  2POJ A;  1J7N A;  4WKE A;  1ZVX A;  1R1H A;  2DW0 A;  3O2X A;  1H71 P;  3KMC A;  1CIZ A;  2E2D A;  2X3B A;  1BKC I;  3B8Z A;  3GBO A;  1AF0 A;  4H30 A;  4A7B A;  4JP4 A;  3LIK A;  3VI1 A;  3DNG A;  4QKZ A;  1Y0V A;  4GWM A;  1ZXC A;  4FXY P;  4L63 A;  5JMY A;  4DPE A;  2WO8 A;  1B8Y A;  1I76 A;  3LKA A;  4ON1 A;  2JIH A;  3LE9 A;  1CGE A;  3F1A A;  1YOU A;  1CXV A;  1HY7 A;  4JQG A;  4H76 A;  1HV5 A;  2O36 A;  1C8T A;  1CQR A;  4I03 A;  5D1U A;  3HB2 P;  3EDZ A;  1BKC E;  1EAK A;  2X3C A;  2WOA A;  1UEA A;  3AYK A;  3RTT A;  2OVZ A;  4H49 A;  1QJJ A;  4WF6 A;  3ELM A;  1OMJ A;  1G49 A;  1BQQ M;  4PKU A;  1Z3J A;  2OW1 A;  1IAA A;  4GUY A;  5D3C A;  1BUD A;  2L0R A;  5CZM A;  3LGP A;  1BM6 A;  2JT6 A;  1YCM A;  5B5O A;  3LUN A;  2X3A A;  1MNC A;  3EDI A;  1UTT A;  3LMC A;  1G9K A;  2CLT A;  1AYK A;  1PWQ A;  4XM7 A;  1PWU A;  3LK8 A;  3N2U A;  5L79 A;  3WV3 A;  2Y6D A;  4Q1L A;  2W0D A;  2ERO A;  2XS4 A;  5CXA A;  3G42 A;  966C A;  1AST A;  1SU3 A;  4IN9 A;  4GQL A;  4PKR A;  1OS9 A;  3HDB A;  3U1R A;  2YB9 A;  5I0L A;  2JSD A;  1K7Q A;  1GE7 A;  4DD8 A;  3K7L A;  2Y6C A;  3ZVS A;  1XUR A;  3I7I A;  1XFW A;  3Q2H A;  1JAO A;  3WV2 A;  3HY7 A;  5I2Z A;  1XFZ A;  1KUI A;  1BKC A;  5D7W A;  5I4O A;  1SMP A;  1QIB A;  1SRP A;  3LEA A;  2W13 A;  4H84 A;  3DPF A;  2OW2 A;  1BIW A;  2V4B A;  3LJG A;  5H8X A;  4IUW A;  2W15 A;  2ERQ A;  3O64 A;  3LQ0 A;  2W14 A;  3HY9 A;  3EDH A;  1R1J A;  2OW0 A;  2AIG P;  1QIA A;  1XFV A;  3KME A;  1GO7 P;  4FVL A;  3USN A;  4H3X A;  2OY2 A;  4PKW A;  3TT4 A;  1G05 A;  1BSW A;  1MMP A;  1O0Q A;  1JKY A;  1G4K A;  2A8H A;  4L6T A;  1JAP A;  2YIG A;  1D5J A;  4GR3 A;  1EUB A;  2OXW A;  3DPE A;  2KRJ A;  1QIC A;  1XUC A;  4JPA A;  1CK7 A;  5BOY A;  1AKL A;  1HTD A;  2PJT A;  2J0T A;  3DWB A;  1XFX A;  3KEC A;  1SLN A;  2I47 A;  3RTS A;  2DW2 A;  3K7N A;  3AYU A;  3E8R A;  4GR8 A;  3G5C A;  3P1V A;  2OXZ A;  1FLS A;  5LAB A;  1BZS A;  2Z2D A;  2FV5 A;  3NX7 A;  1R54 A;  2X7M A;  4ILW D;  5I43 A;  3EHY A;  1CGF A;  1XUD A;  3LJT A;  3L0T A;  3KRY A;  1ZP5 A;  1YP1 A;  4AXQ A;  4FXQ A;  3P24 A;  3SHI A;  3DL1 A;  3LUM A;  3L0V A;  1FBL A;  1O0T A;  1GO8 P;  3MA2 A;  2FV9 A;  2ERP A;  2N8R A;  2CKI A;  1SLM A;  1R55 A;  2MZI A;  4EFS A;  2E3X A;  3V96 B;  3EWJ A;  3EDG A;  3VTG A;  4GWN A;  3HDA P;  1HFS A;  1PWP A;  3F17 A;  1UMT A;  1FM1 A;  5D2B A;  1JK3 A;  3UVC A;  1JAN A;  3KEK A;  4AUO A;  1YQY A;  3TS4 A;  4XCT A;  2OW9 A;  2MZH A;  1SAT A;  2RJQ A;  1JH1 A;  3B2Z A;  1A86 A;  1KUG A;  4H2E A;  1C3I A;  3B92 A;  1G12 A;  1IAD A;  3CKI A;  2DDF A;  3BA0 A;  4I35 A;  1S4B P;  1OM6 A;  2JT5 A;  1CAQ A;  4XM6 A;  1KBC A; 
#chains in the Genus database with same CATH topology
 1OM7 A;  3ZXH A;  1L6J A;  2TCL A;  1GXD A;  1Y8J A;  2JNP A;  4WKI A;  1IAE A;  2D1O A;  1ZXV A;  1GE6 A;  1XFY A;  5D1T A;  1MMR A;  1BQO A;  1OM8 A;  1MMB A;  1R1I A;  4JA1 A;  4CTH A;  2OZR A;  5D1S A;  2K9C A;  4ZR5 A;  1WNI A;  2RJP A;  1XFU A;  3HBV P;  3I7G A;  2SRT A;  3WV1 A;  4G9L A;  830C A;  2W12 A;  1I1I P;  5BPA A;  4GF1 A;  3OHL A;  1USN A;  2MLR A;  3DTK A;  3Q2G A;  3EHX A;  1ZS0 A;  1GE5 A;  1ROS A;  3HYG A;  5L7F A;  4PKS A;  2AYK A;  1RMZ A;  3LJZ A;  1B3D A;  1MMQ A;  1ZTQ A;  3F19 A;  1Q3A A;  2OY4 A;  2HU6 A;  1UMS A;  5I3M A;  3LQB A;  1DMT A;  4R3V A;  1CGL A;  1OS2 A;  2DW1 A;  1D8F A;  1JJ9 A;  1UTZ A;  4DV8 A;  1K7I A;  1C7K A;  1JIW P;  1D7X A;  1IAC A;  1A85 A;  2K2G A;  3DTI A;  1DTH A;  5BOT A;  1HFC A;  1IAB A;  5B5P A;  1IAG A;  4H82 A;  1I73 A;  3OHO A;  3AIG A;  2OXU A;  3F16 A;  4J4M A;  1GKC A;  4HX3 A;  1D8M A;  4WZV A;  1KUK A;  1EB6 A;  4HMA A;  1ND1 A;  1JIZ A;  2USN A;  3F18 A;  4IJO A;  4XBH A;  1Y93 A;  4DF9 A;  3KHI A;  1PWW A;  1KUH A;  2QPJ A;  4FU4 A;  3LIL A;  1GKD A;  4GR0 A;  456C A;  1PWV A;  2OI0 A;  3DSL A;  4WK7 A;  1KAP P;  1OO9 A;  2D1N A;  2YUF A;  4G0D A;  1QUA A;  1JAQ A;  4L19 A;  1K7G A;  4H1Q A;  4PKV A;  4XM8 A;  1RM8 A;  4JIJ A;  1QJI A;  3HBU P;  4AIG A;  3TSK A;  1KUF A;  1XAX A;  2J83 A;  5I12 A;  1BUV M;  4PKT A;  3TVC A;  3F15 A;  3LIR A;  3ZUK A;  3KEJ A;  2XS3 A;  3N2V A;  2O3E A;  4PKQ A;  1ATL A;  3KWV C;  2DDY A;  2OVX A;  4AYK A;  2MLS A;  2WO9 A;  4A3W A;  5CUH A;  1HOV A;  2MZE A;  2POJ A;  1J7N A;  4WKE A;  1ZVX A;  1R1H A;  2DW0 A;  3O2X A;  1H71 P;  3KMC A;  1CIZ A;  2E2D A;  2X3B A;  1BKC I;  3B8Z A;  3GBO A;  4L7A A;  1AF0 A;  4H30 A;  4A7B A;  4JP4 A;  3LIK A;  3VI1 A;  3DNG A;  4QKZ A;  1Y0V A;  4GWM A;  1ZXC A;  4FXY P;  4L63 A;  5JMY A;  4DPE A;  1TVI A;  2WO8 A;  1B8Y A;  1I76 A;  3LKA A;  4ON1 A;  2JIH A;  3LE9 A;  1CGE A;  3F1A A;  1YOU A;  1CXV A;  1HY7 A;  4JQG A;  4H76 A;  1HV5 A;  2O36 A;  1C8T A;  1CQR A;  4I03 A;  5D1U A;  3HB2 P;  3EDZ A;  1BKC E;  1EAK A;  2X3C A;  2WOA A;  1UEA A;  3AYK A;  3RTT A;  2OVZ A;  4H49 A;  1QJJ A;  4WF6 A;  3ELM A;  1OMJ A;  1G49 A;  1BQQ M;  4PKU A;  1Z3J A;  2OW1 A;  1IAA A;  4GUY A;  5D3C A;  1BUD A;  2L0R A;  5CZM A;  3LGP A;  1BM6 A;  2JT6 A;  1YCM A;  5B5O A;  3LUN A;  2X3A A;  1MNC A;  3EDI A;  1UTT A;  3LMC A;  1G9K A;  2CLT A;  1AYK A;  1PWQ A;  4XM7 A;  1PWU A;  3LK8 A;  3N2U A;  5L79 A;  3WV3 A;  2Y6D A;  4Q1L A;  2W0D A;  2ERO A;  2XS4 A;  5CXA A;  3G42 A;  966C A;  1AST A;  1SU3 A;  4IN9 A;  4GQL A;  4PKR A;  1OZ9 A;  1OS9 A;  3HDB A;  3U1R A;  2YB9 A;  3DTE A;  5I0L A;  2JSD A;  1K7Q A;  1GE7 A;  4DD8 A;  3K7L A;  2Y6C A;  3ZVS A;  1XUR A;  3I7I A;  1XFW A;  3Q2H A;  1JAO A;  3WV2 A;  3HY7 A;  5I2Z A;  1XFZ A;  1KUI A;  1BKC A;  5D7W A;  5I4O A;  1SMP A;  1QIB A;  1SRP A;  3LEA A;  2W13 A;  4H84 A;  3DPF A;  2OW2 A;  1BIW A;  2V4B A;  3LJG A;  5H8X A;  4IUW A;  2W15 A;  2ERQ A;  3O64 A;  3LQ0 A;  2W14 A;  3HY9 A;  3EDH A;  1R1J A;  2OW0 A;  2AIG P;  1QIA A;  1XFV A;  3KME A;  1GO7 P;  4FVL A;  3USN A;  4H3X A;  2OY2 A;  4PKW A;  3TT4 A;  1G05 A;  1BSW A;  1MMP A;  1O0Q A;  1JKY A;  1G4K A;  2A8H A;  4L6T A;  1JAP A;  2YIG A;  1D5J A;  4GR3 A;  1EUB A;  2OXW A;  3DPE A;  2KRJ A;  1QIC A;  1XUC A;  4JPA A;  1CK7 A;  5BOY A;  1AKL A;  1HTD A;  2PJT A;  2J0T A;  3DWB A;  1XFX A;  3KEC A;  1SLN A;  2I47 A;  3RTS A;  2DW2 A;  3K7N A;  3AYU A;  3E8R A;  4GR8 A;  3G5C A;  3P1V A;  2OXZ A;  1FLS A;  5LAB A;  1BZS A;  2Z2D A;  2FV5 A;  3NX7 A;  1R54 A;  2X7M A;  4ILW D;  5I43 A;  3EHY A;  1CGF A;  1XUD A;  3LJT A;  3L0T A;  3KRY A;  1ZP5 A;  1YP1 A;  4AXQ A;  4FXQ A;  3P24 A;  3SHI A;  3DL1 A;  3LUM A;  3L0V A;  1FBL A;  1O0T A;  1GO8 P;  3MA2 A;  2FV9 A;  2ERP A;  2N8R A;  2CKI A;  1SLM A;  1R55 A;  2MZI A;  4EFS A;  2E3X A;  3V96 B;  3EWJ A;  3EDG A;  3VTG A;  4GWN A;  3HDA P;  1HFS A;  1PWP A;  3F17 A;  1UMT A;  1FM1 A;  5D2B A;  1JK3 A;  3UVC A;  1JAN A;  3KEK A;  4AUO A;  1YQY A;  3TS4 A;  4XCT A;  2OW9 A;  1XM5 A;  2MZH A;  1SAT A;  2RJQ A;  1JH1 A;  3B2Z A;  1A86 A;  1KUG A;  4H2E A;  1C3I A;  3B92 A;  1G12 A;  1IAD A;  3CKI A;  2DDF A;  3BA0 A;  4I35 A;  1S4B P;  1OM6 A;  2JT5 A;  1CAQ A;  4XM6 A;  1KBC A; 
#chains in the Genus database with same CATH homology
 1OM7 A;  3ZXH A;  1L6J A;  2TCL A;  1GXD A;  1Y8J A;  2JNP A;  4WKI A;  1IAE A;  2D1O A;  1ZXV A;  1GE6 A;  1XFY A;  5D1T A;  1MMR A;  1BQO A;  1OM8 A;  1MMB A;  1R1I A;  4JA1 A;  4CTH A;  2OZR A;  5D1S A;  2K9C A;  4ZR5 A;  1WNI A;  2RJP A;  1XFU A;  3HBV P;  3I7G A;  2SRT A;  3WV1 A;  4G9L A;  830C A;  2W12 A;  1I1I P;  5BPA A;  4GF1 A;  3OHL A;  1USN A;  2MLR A;  3DTK A;  3Q2G A;  3EHX A;  1ZS0 A;  1GE5 A;  1ROS A;  3HYG A;  5L7F A;  4PKS A;  2AYK A;  1RMZ A;  3LJZ A;  1B3D A;  1MMQ A;  1ZTQ A;  3F19 A;  1Q3A A;  2OY4 A;  2HU6 A;  1UMS A;  5I3M A;  3LQB A;  1DMT A;  4R3V A;  1CGL A;  1OS2 A;  2DW1 A;  1D8F A;  1JJ9 A;  1UTZ A;  4DV8 A;  1K7I A;  1C7K A;  1JIW P;  1D7X A;  1IAC A;  1A85 A;  2K2G A;  3DTI A;  1DTH A;  5BOT A;  1HFC A;  1IAB A;  5B5P A;  1IAG A;  4H82 A;  1I73 A;  3OHO A;  3AIG A;  2OXU A;  3F16 A;  4J4M A;  1GKC A;  4HX3 A;  1D8M A;  4WZV A;  1KUK A;  1EB6 A;  4HMA A;  1ND1 A;  1JIZ A;  2USN A;  3F18 A;  4IJO A;  4XBH A;  1Y93 A;  4DF9 A;  3KHI A;  1PWW A;  1KUH A;  2QPJ A;  4FU4 A;  3LIL A;  1GKD A;  4GR0 A;  456C A;  1PWV A;  2OI0 A;  3DSL A;  4WK7 A;  1KAP P;  1OO9 A;  2D1N A;  2YUF A;  4G0D A;  1QUA A;  1JAQ A;  4L19 A;  1K7G A;  4H1Q A;  4PKV A;  4XM8 A;  1RM8 A;  4JIJ A;  1QJI A;  3HBU P;  4AIG A;  3TSK A;  1KUF A;  2J83 A;  5I12 A;  1BUV M;  4PKT A;  3TVC A;  3F15 A;  3LIR A;  3ZUK A;  3KEJ A;  2XS3 A;  3N2V A;  2O3E A;  4PKQ A;  1ATL A;  3KWV C;  2DDY A;  2OVX A;  4AYK A;  2MLS A;  2WO9 A;  4A3W A;  5CUH A;  1HOV A;  2MZE A;  2POJ A;  1J7N A;  4WKE A;  1ZVX A;  1R1H A;  2DW0 A;  3O2X A;  1H71 P;  3KMC A;  1CIZ A;  2E2D A;  2X3B A;  1BKC I;  3B8Z A;  3GBO A;  4L7A A;  1AF0 A;  4H30 A;  4A7B A;  4JP4 A;  3LIK A;  3VI1 A;  3DNG A;  4QKZ A;  1Y0V A;  4GWM A;  1ZXC A;  4FXY P;  4L63 A;  5JMY A;  4DPE A;  2WO8 A;  1B8Y A;  1I76 A;  3LKA A;  4ON1 A;  2JIH A;  3LE9 A;  1CGE A;  3F1A A;  1YOU A;  1CXV A;  1HY7 A;  4JQG A;  4H76 A;  1HV5 A;  2O36 A;  1C8T A;  1CQR A;  4I03 A;  5D1U A;  3HB2 P;  3EDZ A;  1BKC E;  1EAK A;  2X3C A;  2WOA A;  1UEA A;  3AYK A;  3RTT A;  2OVZ A;  4H49 A;  1QJJ A;  4WF6 A;  3ELM A;  1OMJ A;  1G49 A;  1BQQ M;  4PKU A;  1Z3J A;  2OW1 A;  1IAA A;  4GUY A;  5D3C A;  1BUD A;  2L0R A;  5CZM A;  3LGP A;  1BM6 A;  2JT6 A;  1YCM A;  5B5O A;  3LUN A;  2X3A A;  1MNC A;  3EDI A;  1UTT A;  3LMC A;  1G9K A;  2CLT A;  1AYK A;  1PWQ A;  4XM7 A;  1PWU A;  3LK8 A;  3N2U A;  5L79 A;  3WV3 A;  2Y6D A;  4Q1L A;  2W0D A;  2ERO A;  2XS4 A;  5CXA A;  3G42 A;  966C A;  1AST A;  1SU3 A;  4IN9 A;  4GQL A;  4PKR A;  1OS9 A;  3HDB A;  3U1R A;  2YB9 A;  3DTE A;  5I0L A;  2JSD A;  1K7Q A;  1GE7 A;  4DD8 A;  3K7L A;  2Y6C A;  3ZVS A;  1XUR A;  3I7I A;  1XFW A;  3Q2H A;  1JAO A;  3WV2 A;  3HY7 A;  5I2Z A;  1XFZ A;  1KUI A;  1BKC A;  5D7W A;  5I4O A;  1SMP A;  1QIB A;  1SRP A;  3LEA A;  2W13 A;  4H84 A;  3DPF A;  2OW2 A;  1BIW A;  2V4B A;  3LJG A;  5H8X A;  4IUW A;  2W15 A;  2ERQ A;  3O64 A;  3LQ0 A;  2W14 A;  3HY9 A;  3EDH A;  1R1J A;  2OW0 A;  2AIG P;  1QIA A;  1XFV A;  3KME A;  1GO7 P;  4FVL A;  3USN A;  4H3X A;  2OY2 A;  4PKW A;  3TT4 A;  1G05 A;  1BSW A;  1MMP A;  1O0Q A;  1JKY A;  1G4K A;  2A8H A;  4L6T A;  1JAP A;  2YIG A;  1D5J A;  4GR3 A;  1EUB A;  2OXW A;  3DPE A;  2KRJ A;  1QIC A;  1XUC A;  4JPA A;  1CK7 A;  5BOY A;  1AKL A;  1HTD A;  2PJT A;  2J0T A;  3DWB A;  1XFX A;  3KEC A;  1SLN A;  2I47 A;  3RTS A;  2DW2 A;  3K7N A;  3AYU A;  3E8R A;  4GR8 A;  3G5C A;  3P1V A;  2OXZ A;  1FLS A;  5LAB A;  1BZS A;  2Z2D A;  2FV5 A;  3NX7 A;  1R54 A;  2X7M A;  4ILW D;  5I43 A;  3EHY A;  1CGF A;  1XUD A;  3LJT A;  3L0T A;  3KRY A;  1ZP5 A;  1YP1 A;  4AXQ A;  4FXQ A;  3P24 A;  3SHI A;  3DL1 A;  3LUM A;  3L0V A;  1FBL A;  1O0T A;  1GO8 P;  3MA2 A;  2FV9 A;  2ERP A;  2N8R A;  2CKI A;  1SLM A;  1R55 A;  2MZI A;  4EFS A;  2E3X A;  3V96 B;  3EWJ A;  3EDG A;  3VTG A;  4GWN A;  3HDA P;  1HFS A;  1PWP A;  3F17 A;  1UMT A;  1FM1 A;  5D2B A;  1JK3 A;  3UVC A;  1JAN A;  3KEK A;  4AUO A;  1YQY A;  3TS4 A;  4XCT A;  2OW9 A;  2MZH A;  1SAT A;  2RJQ A;  1JH1 A;  3B2Z A;  1A86 A;  1KUG A;  4H2E A;  1C3I A;  3B92 A;  1G12 A;  1IAD A;  3CKI A;  2DDF A;  3BA0 A;  4I35 A;  1S4B P;  1OM6 A;  2JT5 A;  1CAQ A;  4XM6 A;  1KBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...