4Q1LA

Crystal structure of leucurolysin-a complexed with an endogenous tripeptide (qsw).
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
202
structure length
202
Chain Sequence
QQFSPRYIELVVVADHGMFKKYNSNLNTIRKWVHEMLNTVNGFFRSMNVDASLVNLEVWSKKDLIKVEKDSSKTLTSFGEWRERDLLPRISHDHAQLLTVIVFDEETIGIAYTAGMCDLSQSVAVVMDHSKKNLRVAVTMAHELGHNLGMRHDGNQCHCNAPSCIMADTLSKGLSFEFSDCSQNQYQTYLTKHNPQCILNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snake venom metalloproteinase leucurolysin-A
publication title Crystal structure of Leucurolysin-a complexed with an endogenous tripeptide (QSW).
rcsb
molecule tags Hydrolase
total genus 73
structure length 202
sequence length 202
ec nomenclature ec 3.4.24.-:
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4q1lA00
4G9LA 1R55A 4AYKA 3DPFA 1XFUA 1G05A 1I76A 1K7GA 1PWUA 2J0TA 2K9CA 2MZEA 2OY4A 4WKIA 1PWPA 4FU4A 3LIKA 1CIZA 1GKDA 5I3MA 1PWVA 5JMYA 3KEKA 1QIBA 1QJIA 2MLRA 4WK7A 1GE5A 3WV2A 3F17A 4J4MA 3F18A 2RJPA 1DMTA 1C3IA 1CAQA 4GWMA 1ND1A 3KMCA 3RTSA 2D1OA 1YCMA 2OY2A 4AXQA 1XUCA 5H8XA 2E3XA 1GE6A 1A85A 1JKYA 1SATA 4GR0A 1CGFA 4EFSA 4WF6A 4AIGA 1Z3JA 2OZRA 3K7LA 1UMSA 4H3XA 2X3BA 4HMAA 5D2BA 2OVXA 1FBLA 3P1VA 1BKCE 2DW1A 4DF9A 2OXUA 1BQQM 1JK3A 3B8ZA 1AKLA 3EDZA 1ZXCA 4L63A 5B5OA 2JT6A 2JNPA 1AYKA 4A3WA 456CA 1OM7A 2WOAA 3KWVC 1GE7A 3F1AA 1QIAA 4XM8A 4IUWA 3AYKA 3MA2A 3DSLA 1IAGA 3LKAA 1QICA 3KRYA 1SLNA 4ON1A 2DDYA 3KEJA 2WO8A 3LJZA 3P24A 1D7XA 1GXDA 1GO8P 2SRTA 1ZVXA 1R1JA 4DD8A 3DNGA 2ERQA 1Q3AA 2WO9A 4H82A 1Y93A 4GQLA 1UTTA 1O0QA 3O64A 1CXVA 2K2GA 1Y0VA 1HTDA 1OMJA 2QPJA 1R1IA 1BIWA 5CZMA 3TS4A 1KUGA 3L0VA 5BPAA 3O2XA 2AYKA 2TCLA 2I47A 2POJA 4XCTA 1YP1A 2OW2A 1ZTQA 3EDGA 4GR8A 2PJTA 1WNIA 4L6TA 2YB9A 1R1HA 1QJJA 3LQ0A 1YOUA 2L0RA 4IN9A 4IJOA 1MMRA 4JPAA 3BA0A 1IAEA 4FVLA 3LUMA 3LK8A 1SMPA 1JANA 2J83A 1D8MA 2OW1A 2MZIA 3EHYA 1IACA 3F19A 3TSKA 3N2UA 966CA 1OM8A 3V96B 3SHIA 3LE9A 2JIHA 1RMZA 2A8HA 1B8YA 3HY7A 1XUDA 2W14A 3LEAA 5L7FA 4L19A 1K7QA 4A7BA 4GWNA 1JAPA 1PWWA 1C7KA 1ZS0A 3OHOA 1OM6A 3LJGA 3LGPA 5I0LA 2X3CA 4H49A 1YQYA 1XFYA 1KUIA 4H1QA 5D3CA 4WZVA 1K7IA 5I12A 4R3VA 2YIGA 1H71P 1SU3A 1J7NA 1JIZA 5BOYA 5D7WA 4JIJA 1BM6A 3HDBA 3G5CA 4I35A 5D1SA 3HY9A 5I43A 5L79A 2DW0A 3DL1A 2W13A 5CUHA 3CKIA 2W0DA 4ZR5A 2FV9A 3WV3A 3HBUP 4PKUA 1BKCA 2USNA 4GR3A 3DWBA 2CKIA 3LQBA 1D5JA 1IABA 3F16A 1ZP5A 2DDFA 3HDAP 3USNA 1CK7A 2MZHA 1G49A 3VI1A 3LJTA 2AIGP 3L0TA 1KUHA 1L6JA 2W15A 3TVCA 4DV8A 1R54A 2D1NA 1RM8A 2EROA 3RTTA 1O0TA 2MLSA 1EAKA 3LIRA 2KRJA 1FLSA 5D1UA 1IADA 1OO9A 4I03A 3ZXHA 5BOTA 2XS4A 1SRPA 4XM6A 1JH1A 4HX3A 1BUDA 1EB6A 3HBVP 1XFVA 3G42A 4CTHA 3Q2HA 1CGLA 1KAPP 3K7NA 1G4KA 2HU6A 4PKTA 1BUVM 1HY7A 1EUBA 830CA 3UVCA 5I4OA 1S4BP 3I7GA 1USNA 1JAOA 3F15A 1UTZA 1BKCI 2X7MA 2FV5A 1PWQA 1FM1A 2X3AA 1IAAA 1MMPA 4PKSA 1B3DA 2E2DA 1JAQA 1XFWA 3LMCA 4H30A 3KHIA 1JIWP 1ROSA 4H84A 3E8RA 5B5PA 2OXZA 4WKEA 3AIGA 3GBOA 1KBCA 4G0DA 3TT4A 3ZVSA 4H2EA 4GUYA 1ZXVA 4Q1LA 1I1IP 1Y8JA 3AYUA 2Z2DA 4H76A 3I7IA 3KECA 1KUKA 1AF0A 3B92A 1HOVA 4PKRA 1JJ9A 1KUFA 4XBHA 2Y6DA 1BQOA 1A86A 1HV5A 3NX7A 2OXWA 3HYGA 2JSDA 3WV1A 3DPEA 1ASTA 2W12A 1UMTA 1BSWA 2RJQA 4PKQA 2JT5A 4XM7A 1OS9A 3OHLA 1HFSA 2O3EA 3LUNA 3ELMA 1OS2A 1XURA 2V4BA 3EDIA 1CGEA 1BZSA 1G9KA 1DTHA 5LABA 3ZUKA 1I73A 3VTGA 2OVZA 4FXQA 2ERPA 4DPEA 4ILWD 3EHXA 1C8TA 4QKZA 2DW2A 3U1RA 1MNCA 4JQGA 5D1TA 4PKVA 1D8FA 1G12A 2OI0A 4GF1A 2N8RA 4AUOA 1CQRA 1MMBA 3B2ZA 3KMEA 1ATLA 2Y6CA 3HB2P 1SLMA 1QUAA 2CLTA 3EWJA 4FXYP 5I2ZA 1MMQA 3LILA 4JP4A 2O36A 2OW9A 1XFXA 2XS3A 2OW0A 1GO7P 5CXAA 1GKCA 1HFCA 1UEAA 3N2VA 4JA1A 1XFZA 3EDHA 3Q2GA 4PKWA
chains in the Genus database with same CATH superfamily
4G9LA 1R55A 4AYKA 3DPFA 1XFUA 1G05A 1I76A 1K7GA 1PWUA 2J0TA 2K9CA 2MZEA 2OY4A 4WKIA 1PWPA 4FU4A 3LIKA 1CIZA 1GKDA 5I3MA 1PWVA 5JMYA 3KEKA 1QIBA 1QJIA 2MLRA 4WK7A 1GE5A 3WV2A 3F17A 4J4MA 3F18A 2RJPA 1DMTA 1C3IA 1CAQA 4GWMA 1ND1A 3KMCA 3RTSA 2D1OA 1YCMA 2OY2A 4AXQA 1XUCA 5H8XA 2E3XA 1GE6A 1A85A 1JKYA 1SATA 4GR0A 1CGFA 4EFSA 4WF6A 4AIGA 1Z3JA 2OZRA 3K7LA 1UMSA 4H3XA 2X3BA 4HMAA 5D2BA 2OVXA 1FBLA 3P1VA 1BKCE 2DW1A 4DF9A 2OXUA 1BQQM 1JK3A 3B8ZA 1AKLA 3EDZA 1ZXCA 4L63A 5B5OA 2JT6A 2JNPA 1AYKA 4A3WA 456CA 1OM7A 2WOAA 3KWVC 1GE7A 3F1AA 1QIAA 4XM8A 4IUWA 3AYKA 3MA2A 3DSLA 1IAGA 3LKAA 1QICA 3KRYA 1SLNA 4ON1A 2DDYA 3KEJA 2WO8A 3LJZA 3P24A 1D7XA 1GXDA 1GO8P 2SRTA 1ZVXA 1R1JA 4DD8A 3DNGA 2ERQA 1Q3AA 2WO9A 4H82A 1Y93A 4GQLA 1XAXA 1UTTA 1O0QA 3O64A 1CXVA 2K2GA 1Y0VA 1HTDA 1OMJA 2QPJA 1R1IA 1BIWA 5CZMA 3TS4A 1KUGA 3L0VA 5BPAA 3O2XA 2AYKA 2TCLA 2I47A 2POJA 4XCTA 1YP1A 2OW2A 1ZTQA 3EDGA 4GR8A 2PJTA 1WNIA 4L6TA 2YB9A 1R1HA 1QJJA 3LQ0A 1YOUA 2L0RA 4IN9A 4IJOA 1MMRA 4JPAA 3BA0A 1IAEA 4FVLA 3LUMA 3LK8A 1SMPA 1JANA 2J83A 1D8MA 2OW1A 2MZIA 3EHYA 1IACA 3F19A 3TSKA 3N2UA 966CA 1OM8A 3V96B 3SHIA 3LE9A 2JIHA 1RMZA 2A8HA 4L7AA 1B8YA 3HY7A 1XUDA 2W14A 3LEAA 5L7FA 4L19A 1K7QA 4A7BA 4GWNA 1JAPA 1PWWA 1C7KA 1ZS0A 3OHOA 1OM6A 3LJGA 3LGPA 5I0LA 2X3CA 4H49A 1YQYA 1XFYA 1KUIA 4H1QA 5D3CA 4WZVA 1K7IA 1TVIA 5I12A 4R3VA 2YIGA 1H71P 1SU3A 1J7NA 1JIZA 5BOYA 5D7WA 4JIJA 1BM6A 3HDBA 3G5CA 4I35A 5D1SA 3HY9A 5I43A 5L79A 2DW0A 3DL1A 2W13A 5CUHA 3CKIA 2W0DA 4ZR5A 2FV9A 3WV3A 3HBUP 4PKUA 1BKCA 2USNA 4GR3A 3DWBA 2CKIA 3LQBA 1D5JA 1IABA 3F16A 1ZP5A 2DDFA 3HDAP 3USNA 1CK7A 2MZHA 1G49A 3VI1A 3LJTA 2AIGP 1OZ9A 3L0TA 1KUHA 1L6JA 2W15A 3TVCA 4DV8A 1R54A 2D1NA 1RM8A 2EROA 3RTTA 1O0TA 2MLSA 1EAKA 3LIRA 2KRJA 1FLSA 5D1UA 1IADA 1OO9A 4I03A 3ZXHA 5BOTA 2XS4A 1SRPA 4XM6A 1JH1A 4HX3A 1BUDA 1EB6A 3HBVP 1XFVA 3G42A 4CTHA 3Q2HA 1CGLA 1KAPP 3K7NA 1G4KA 2HU6A 4PKTA 1BUVM 1HY7A 1EUBA 830CA 3UVCA 5I4OA 1S4BP 3I7GA 1USNA 1JAOA 3F15A 1UTZA 1BKCI 2X7MA 2FV5A 1PWQA 1FM1A 2X3AA 1IAAA 1MMPA 4PKSA 1B3DA 2E2DA 1JAQA 1XFWA 3LMCA 4H30A 3KHIA 1JIWP 1ROSA 4H84A 3E8RA 5B5PA 2OXZA 4WKEA 3AIGA 3GBOA 1KBCA 4G0DA 3DTIA 3TT4A 3ZVSA 4H2EA 4GUYA 1ZXVA 4Q1LA 1I1IP 1Y8JA 3AYUA 2Z2DA 4H76A 3I7IA 3KECA 1KUKA 1AF0A 3B92A 1HOVA 4PKRA 1JJ9A 1KUFA 4XBHA 2Y6DA 1BQOA 1A86A 1HV5A 3NX7A 2OXWA 3HYGA 2JSDA 3WV1A 3DPEA 1ASTA 2W12A 1UMTA 1BSWA 2RJQA 4PKQA 2JT5A 2YUFA 4XM7A 1OS9A 3OHLA 1HFSA 3DTEA 2O3EA 3LUNA 3ELMA 1OS2A 3DTKA 1XURA 2V4BA 3EDIA 1CGEA 1BZSA 1G9KA 1DTHA 5LABA 3ZUKA 1I73A 3VTGA 2OVZA 4FXQA 2ERPA 4DPEA 4ILWD 3EHXA 1C8TA 4QKZA 2DW2A 3U1RA 1MNCA 4JQGA 5D1TA 4PKVA 1D8FA 1G12A 2OI0A 4GF1A 2N8RA 1XM5A 4AUOA 1CQRA 1MMBA 3B2ZA 3KMEA 1ATLA 2Y6CA 3HB2P 1SLMA 1QUAA 2CLTA 3EWJA 4FXYP 5I2ZA 1MMQA 3LILA 4JP4A 2O36A 2OW9A 1XFXA 2XS3A 2OW0A 1GO7P 5CXAA 1GKCA 1HFCA 1UEAA 3N2VA 4JA1A 1XFZA 3EDHA 3Q2GA 4PKWA
chains in the Genus database with same CATH topology
4G9LA 1R55A 4AYKA 3DPFA 1XFUA 1G05A 1I76A 1K7GA 1PWUA 2J0TA 2K9CA 2MZEA 2OY4A 4WKIA 1PWPA 4FU4A 3LIKA 1CIZA 1GKDA 5I3MA 1PWVA 5JMYA 3KEKA 1QIBA 1QJIA 2MLRA 4WK7A 1GE5A 3WV2A 3F17A 4J4MA 3F18A 2RJPA 1DMTA 1C3IA 1CAQA 4GWMA 1ND1A 3KMCA 3RTSA 2D1OA 1YCMA 2OY2A 4AXQA 1XUCA 5H8XA 2E3XA 1GE6A 1A85A 1JKYA 1SATA 4GR0A 1CGFA 4EFSA 4WF6A 4AIGA 1Z3JA 2OZRA 3K7LA 1UMSA 4H3XA 2X3BA 4HMAA 5D2BA 2OVXA 1FBLA 3P1VA 1BKCE 2DW1A 4DF9A 2OXUA 1BQQM 1JK3A 3B8ZA 1AKLA 3EDZA 1ZXCA 4L63A 5B5OA 2JT6A 2JNPA 1AYKA 4A3WA 456CA 1OM7A 2WOAA 3KWVC 1GE7A 3F1AA 1QIAA 4XM8A 4IUWA 3AYKA 3MA2A 3DSLA 1IAGA 3LKAA 1QICA 3KRYA 1SLNA 4ON1A 2DDYA 3KEJA 2WO8A 3LJZA 3P24A 1D7XA 1GXDA 1GO8P 2SRTA 1ZVXA 1R1JA 4DD8A 3DNGA 2ERQA 1Q3AA 2WO9A 4H82A 1Y93A 4GQLA 1UTTA 1O0QA 3O64A 1CXVA 2K2GA 1Y0VA 1HTDA 1OMJA 2QPJA 1R1IA 1BIWA 5CZMA 3TS4A 1KUGA 3L0VA 5BPAA 3O2XA 2AYKA 2TCLA 2I47A 2POJA 4XCTA 1YP1A 2OW2A 1ZTQA 3EDGA 4GR8A 2PJTA 1WNIA 4L6TA 2YB9A 1R1HA 1QJJA 3LQ0A 1YOUA 2L0RA 4IN9A 4IJOA 1MMRA 4JPAA 3BA0A 1IAEA 4FVLA 3LUMA 3LK8A 1SMPA 1JANA 2J83A 1D8MA 2OW1A 2MZIA 3EHYA 1IACA 3F19A 3TSKA 3N2UA 966CA 1OM8A 3V96B 3SHIA 3LE9A 2JIHA 1RMZA 2A8HA 4L7AA 1B8YA 3HY7A 1XUDA 2W14A 3LEAA 5L7FA 4L19A 1K7QA 4A7BA 4GWNA 1JAPA 1PWWA 1C7KA 1ZS0A 3OHOA 1OM6A 3LJGA 3LGPA 5I0LA 2X3CA 4H49A 1YQYA 1XFYA 1KUIA 4H1QA 5D3CA 4WZVA 1K7IA 5I12A 4R3VA 2YIGA 1H71P 1SU3A 1J7NA 1JIZA 5BOYA 5D7WA 4JIJA 1BM6A 3HDBA 3G5CA 4I35A 5D1SA 3HY9A 5I43A 5L79A 2DW0A 3DL1A 2W13A 5CUHA 3CKIA 2W0DA 4ZR5A 2FV9A 3WV3A 3HBUP 4PKUA 1BKCA 2USNA 4GR3A 3DWBA 2CKIA 3LQBA 1D5JA 1IABA 3F16A 1ZP5A 2DDFA 3HDAP 3USNA 1CK7A 2MZHA 1G49A 3VI1A 3LJTA 2AIGP 3L0TA 1KUHA 1L6JA 2W15A 3TVCA 4DV8A 1R54A 2D1NA 1RM8A 2EROA 3RTTA 1O0TA 2MLSA 1EAKA 3LIRA 2KRJA 1FLSA 5D1UA 1IADA 1OO9A 4I03A 3ZXHA 5BOTA 2XS4A 1SRPA 4XM6A 1JH1A 4HX3A 1BUDA 1EB6A 3HBVP 1XFVA 3G42A 4CTHA 3Q2HA 1CGLA 1KAPP 3K7NA 1G4KA 2HU6A 4PKTA 1BUVM 1HY7A 1EUBA 830CA 3UVCA 5I4OA 1S4BP 3I7GA 1USNA 1JAOA 3F15A 1UTZA 1BKCI 2X7MA 2FV5A 1PWQA 1FM1A 2X3AA 1IAAA 1MMPA 4PKSA 1B3DA 2E2DA 1JAQA 1XFWA 3LMCA 4H30A 3KHIA 1JIWP 1ROSA 4H84A 3E8RA 5B5PA 2OXZA 4WKEA 3AIGA 3GBOA 1KBCA 4G0DA 3DTIA 3TT4A 3ZVSA 4H2EA 4GUYA 1ZXVA 4Q1LA 1I1IP 1Y8JA 3AYUA 2Z2DA 4H76A 3I7IA 3KECA 1KUKA 1AF0A 3B92A 1HOVA 4PKRA 1JJ9A 1KUFA 4XBHA 2Y6DA 1BQOA 1A86A 1HV5A 3NX7A 2OXWA 3HYGA 2JSDA 3WV1A 3DPEA 1ASTA 2W12A 1UMTA 1BSWA 2RJQA 4PKQA 2JT5A 2YUFA 4XM7A 1OS9A 3OHLA 1HFSA 3DTEA 2O3EA 3LUNA 3ELMA 1OS2A 3DTKA 1XURA 2V4BA 3EDIA 1CGEA 1BZSA 1G9KA 1DTHA 5LABA 3ZUKA 1I73A 3VTGA 2OVZA 4FXQA 2ERPA 4DPEA 4ILWD 3EHXA 1C8TA 4QKZA 2DW2A 3U1RA 1MNCA 4JQGA 5D1TA 4PKVA 1D8FA 1G12A 2OI0A 4GF1A 2N8RA 4AUOA 1CQRA 1MMBA 3B2ZA 3KMEA 1ATLA 2Y6CA 3HB2P 1SLMA 1QUAA 2CLTA 3EWJA 4FXYP 5I2ZA 1MMQA 3LILA 4JP4A 2O36A 2OW9A 1XFXA 2XS3A 2OW0A 1GO7P 5CXAA 1GKCA 1HFCA 1UEAA 3N2VA 4JA1A 1XFZA 3EDHA 3Q2GA 4PKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9L A;  1R55 A;  4AYK A;  3DPF A;  1XFU A;  1G05 A;  1I76 A;  1K7G A;  1PWU A;  2J0T A;  2K9C A;  2MZE A;  2OY4 A;  4WKI A;  1PWP A;  4FU4 A;  3LIK A;  1CIZ A;  1GKD A;  5I3M A;  1PWV A;  5JMY A;  3KEK A;  1QIB A;  1QJI A;  2MLR A;  4WK7 A;  1GE5 A;  3WV2 A;  3F17 A;  4J4M A;  3F18 A;  2RJP A;  1DMT A;  1C3I A;  1CAQ A;  4GWM A;  1ND1 A;  3KMC A;  3RTS A;  2D1O A;  1YCM A;  2OY2 A;  4AXQ A;  1XUC A;  5H8X A;  2E3X A;  1GE6 A;  1A85 A;  1JKY A;  1SAT A;  4GR0 A;  1CGF A;  4EFS A;  4WF6 A;  4AIG A;  1Z3J A;  2OZR A;  3K7L A;  1UMS A;  4H3X A;  2X3B A;  4HMA A;  5D2B A;  2OVX A;  1FBL A;  3P1V A;  1BKC E;  2DW1 A;  4DF9 A;  2OXU A;  1BQQ M;  1JK3 A;  3B8Z A;  1AKL A;  3EDZ A;  1ZXC A;  4L63 A;  5B5O A;  2JT6 A;  2JNP A;  1AYK A;  4A3W A;  456C A;  1OM7 A;  2WOA A;  3KWV C;  1GE7 A;  3F1A A;  1QIA A;  4XM8 A;  4IUW A;  3AYK A;  3MA2 A;  3DSL A;  1IAG A;  3LKA A;  1QIC A;  3KRY A;  1SLN A;  4ON1 A;  2DDY A;  3KEJ A;  2WO8 A;  3LJZ A;  3P24 A;  1D7X A;  1GXD A;  1GO8 P;  2SRT A;  1ZVX A;  1R1J A;  4DD8 A;  3DNG A;  2ERQ A;  1Q3A A;  2WO9 A;  4H82 A;  1Y93 A;  4GQL A;  1UTT A;  1O0Q A;  3O64 A;  1CXV A;  2K2G A;  1Y0V A;  1HTD A;  1OMJ A;  2QPJ A;  1R1I A;  1BIW A;  5CZM A;  3TS4 A;  1KUG A;  3L0V A;  5BPA A;  3O2X A;  2AYK A;  2TCL A;  2I47 A;  2POJ A;  4XCT A;  1YP1 A;  2OW2 A;  1ZTQ A;  3EDG A;  4GR8 A;  2PJT A;  1WNI A;  4L6T A;  2YB9 A;  1R1H A;  1QJJ A;  3LQ0 A;  1YOU A;  2L0R A;  4IN9 A;  4IJO A;  1MMR A;  4JPA A;  3BA0 A;  1IAE A;  4FVL A;  3LUM A;  3LK8 A;  1SMP A;  1JAN A;  2J83 A;  1D8M A;  2OW1 A;  2MZI A;  3EHY A;  1IAC A;  3F19 A;  3TSK A;  3N2U A;  966C A;  1OM8 A;  3V96 B;  3SHI A;  3LE9 A;  2JIH A;  1RMZ A;  2A8H A;  1B8Y A;  3HY7 A;  1XUD A;  2W14 A;  3LEA A;  5L7F A;  4L19 A;  1K7Q A;  4A7B A;  4GWN A;  1JAP A;  1PWW A;  1C7K A;  1ZS0 A;  3OHO A;  1OM6 A;  3LJG A;  3LGP A;  5I0L A;  2X3C A;  4H49 A;  1YQY A;  1XFY A;  1KUI A;  4H1Q A;  5D3C A;  4WZV A;  1K7I A;  5I12 A;  4R3V A;  2YIG A;  1H71 P;  1SU3 A;  1J7N A;  1JIZ A;  5BOY A;  5D7W A;  4JIJ A;  1BM6 A;  3HDB A;  3G5C A;  4I35 A;  5D1S A;  3HY9 A;  5I43 A;  5L79 A;  2DW0 A;  3DL1 A;  2W13 A;  5CUH A;  3CKI A;  2W0D A;  4ZR5 A;  2FV9 A;  3WV3 A;  3HBU P;  4PKU A;  1BKC A;  2USN A;  4GR3 A;  3DWB A;  2CKI A;  3LQB A;  1D5J A;  1IAB A;  3F16 A;  1ZP5 A;  2DDF A;  3HDA P;  3USN A;  1CK7 A;  2MZH A;  1G49 A;  3VI1 A;  3LJT A;  2AIG P;  3L0T A;  1KUH A;  1L6J A;  2W15 A;  3TVC A;  4DV8 A;  1R54 A;  2D1N A;  1RM8 A;  2ERO A;  3RTT A;  1O0T A;  2MLS A;  1EAK A;  3LIR A;  2KRJ A;  1FLS A;  5D1U A;  1IAD A;  1OO9 A;  4I03 A;  3ZXH A;  5BOT A;  2XS4 A;  1SRP A;  4XM6 A;  1JH1 A;  4HX3 A;  1BUD A;  1EB6 A;  3HBV P;  1XFV A;  3G42 A;  4CTH A;  3Q2H A;  1CGL A;  1KAP P;  3K7N A;  1G4K A;  2HU6 A;  4PKT A;  1BUV M;  1HY7 A;  1EUB A;  830C A;  3UVC A;  5I4O A;  1S4B P;  3I7G A;  1USN A;  1JAO A;  3F15 A;  1UTZ A;  1BKC I;  2X7M A;  2FV5 A;  1PWQ A;  1FM1 A;  2X3A A;  1IAA A;  1MMP A;  4PKS A;  1B3D A;  2E2D A;  1JAQ A;  1XFW A;  3LMC A;  4H30 A;  3KHI A;  1JIW P;  1ROS A;  4H84 A;  3E8R A;  5B5P A;  2OXZ A;  4WKE A;  3AIG A;  3GBO A;  1KBC A;  4G0D A;  3TT4 A;  3ZVS A;  4H2E A;  4GUY A;  1ZXV A;  4Q1L A;  1I1I P;  1Y8J A;  3AYU A;  2Z2D A;  4H76 A;  3I7I A;  3KEC A;  1KUK A;  1AF0 A;  3B92 A;  1HOV A;  4PKR A;  1JJ9 A;  1KUF A;  4XBH A;  2Y6D A;  1BQO A;  1A86 A;  1HV5 A;  3NX7 A;  2OXW A;  3HYG A;  2JSD A;  3WV1 A;  3DPE A;  1AST A;  2W12 A;  1UMT A;  1BSW A;  2RJQ A;  4PKQ A;  2JT5 A;  4XM7 A;  1OS9 A;  3OHL A;  1HFS A;  2O3E A;  3LUN A;  3ELM A;  1OS2 A;  1XUR A;  2V4B A;  3EDI A;  1CGE A;  1BZS A;  1G9K A;  1DTH A;  5LAB A;  3ZUK A;  1I73 A;  3VTG A;  2OVZ A;  4FXQ A;  2ERP A;  4DPE A;  4ILW D;  3EHX A;  1C8T A;  4QKZ A;  2DW2 A;  3U1R A;  1MNC A;  4JQG A;  5D1T A;  4PKV A;  1D8F A;  1G12 A;  2OI0 A;  4GF1 A;  2N8R A;  4AUO A;  1CQR A;  1MMB A;  3B2Z A;  3KME A;  1ATL A;  2Y6C A;  3HB2 P;  1SLM A;  1QUA A;  2CLT A;  3EWJ A;  4FXY P;  5I2Z A;  1MMQ A;  3LIL A;  4JP4 A;  2O36 A;  2OW9 A;  1XFX A;  2XS3 A;  2OW0 A;  1GO7 P;  5CXA A;  1GKC A;  1HFC A;  1UEA A;  3N2V A;  4JA1 A;  1XFZ A;  3EDH A;  3Q2G A;  4PKW A; 
#chains in the Genus database with same CATH topology
 4G9L A;  1R55 A;  4AYK A;  3DPF A;  1XFU A;  1G05 A;  1I76 A;  1K7G A;  1PWU A;  2J0T A;  2K9C A;  2MZE A;  2OY4 A;  4WKI A;  1PWP A;  4FU4 A;  3LIK A;  1CIZ A;  1GKD A;  5I3M A;  1PWV A;  5JMY A;  3KEK A;  1QIB A;  1QJI A;  2MLR A;  4WK7 A;  1GE5 A;  3WV2 A;  3F17 A;  4J4M A;  3F18 A;  2RJP A;  1DMT A;  1C3I A;  1CAQ A;  4GWM A;  1ND1 A;  3KMC A;  3RTS A;  2D1O A;  1YCM A;  2OY2 A;  4AXQ A;  1XUC A;  5H8X A;  2E3X A;  1GE6 A;  1A85 A;  1JKY A;  1SAT A;  4GR0 A;  1CGF A;  4EFS A;  4WF6 A;  4AIG A;  1Z3J A;  2OZR A;  3K7L A;  1UMS A;  4H3X A;  2X3B A;  4HMA A;  5D2B A;  2OVX A;  1FBL A;  3P1V A;  1BKC E;  2DW1 A;  4DF9 A;  2OXU A;  1BQQ M;  1JK3 A;  3B8Z A;  1AKL A;  3EDZ A;  1ZXC A;  4L63 A;  5B5O A;  2JT6 A;  2JNP A;  1AYK A;  4A3W A;  456C A;  1OM7 A;  2WOA A;  3KWV C;  1GE7 A;  3F1A A;  1QIA A;  4XM8 A;  4IUW A;  3AYK A;  3MA2 A;  3DSL A;  1IAG A;  3LKA A;  1QIC A;  3KRY A;  1SLN A;  4ON1 A;  2DDY A;  3KEJ A;  2WO8 A;  3LJZ A;  3P24 A;  1D7X A;  1GXD A;  1GO8 P;  2SRT A;  1ZVX A;  1R1J A;  4DD8 A;  3DNG A;  2ERQ A;  1Q3A A;  2WO9 A;  4H82 A;  1Y93 A;  4GQL A;  1XAX A;  1UTT A;  1O0Q A;  3O64 A;  1CXV A;  2K2G A;  1Y0V A;  1HTD A;  1OMJ A;  2QPJ A;  1R1I A;  1BIW A;  5CZM A;  3TS4 A;  1KUG A;  3L0V A;  5BPA A;  3O2X A;  2AYK A;  2TCL A;  2I47 A;  2POJ A;  4XCT A;  1YP1 A;  2OW2 A;  1ZTQ A;  3EDG A;  4GR8 A;  2PJT A;  1WNI A;  4L6T A;  2YB9 A;  1R1H A;  1QJJ A;  3LQ0 A;  1YOU A;  2L0R A;  4IN9 A;  4IJO A;  1MMR A;  4JPA A;  3BA0 A;  1IAE A;  4FVL A;  3LUM A;  3LK8 A;  1SMP A;  1JAN A;  2J83 A;  1D8M A;  2OW1 A;  2MZI A;  3EHY A;  1IAC A;  3F19 A;  3TSK A;  3N2U A;  966C A;  1OM8 A;  3V96 B;  3SHI A;  3LE9 A;  2JIH A;  1RMZ A;  2A8H A;  4L7A A;  1B8Y A;  3HY7 A;  1XUD A;  2W14 A;  3LEA A;  5L7F A;  4L19 A;  1K7Q A;  4A7B A;  4GWN A;  1JAP A;  1PWW A;  1C7K A;  1ZS0 A;  3OHO A;  1OM6 A;  3LJG A;  3LGP A;  5I0L A;  2X3C A;  4H49 A;  1YQY A;  1XFY A;  1KUI A;  4H1Q A;  5D3C A;  4WZV A;  1K7I A;  1TVI A;  5I12 A;  4R3V A;  2YIG A;  1H71 P;  1SU3 A;  1J7N A;  1JIZ A;  5BOY A;  5D7W A;  4JIJ A;  1BM6 A;  3HDB A;  3G5C A;  4I35 A;  5D1S A;  3HY9 A;  5I43 A;  5L79 A;  2DW0 A;  3DL1 A;  2W13 A;  5CUH A;  3CKI A;  2W0D A;  4ZR5 A;  2FV9 A;  3WV3 A;  3HBU P;  4PKU A;  1BKC A;  2USN A;  4GR3 A;  3DWB A;  2CKI A;  3LQB A;  1D5J A;  1IAB A;  3F16 A;  1ZP5 A;  2DDF A;  3HDA P;  3USN A;  1CK7 A;  2MZH A;  1G49 A;  3VI1 A;  3LJT A;  2AIG P;  1OZ9 A;  3L0T A;  1KUH A;  1L6J A;  2W15 A;  3TVC A;  4DV8 A;  1R54 A;  2D1N A;  1RM8 A;  2ERO A;  3RTT A;  1O0T A;  2MLS A;  1EAK A;  3LIR A;  2KRJ A;  1FLS A;  5D1U A;  1IAD A;  1OO9 A;  4I03 A;  3ZXH A;  5BOT A;  2XS4 A;  1SRP A;  4XM6 A;  1JH1 A;  4HX3 A;  1BUD A;  1EB6 A;  3HBV P;  1XFV A;  3G42 A;  4CTH A;  3Q2H A;  1CGL A;  1KAP P;  3K7N A;  1G4K A;  2HU6 A;  4PKT A;  1BUV M;  1HY7 A;  1EUB A;  830C A;  3UVC A;  5I4O A;  1S4B P;  3I7G A;  1USN A;  1JAO A;  3F15 A;  1UTZ A;  1BKC I;  2X7M A;  2FV5 A;  1PWQ A;  1FM1 A;  2X3A A;  1IAA A;  1MMP A;  4PKS A;  1B3D A;  2E2D A;  1JAQ A;  1XFW A;  3LMC A;  4H30 A;  3KHI A;  1JIW P;  1ROS A;  4H84 A;  3E8R A;  5B5P A;  2OXZ A;  4WKE A;  3AIG A;  3GBO A;  1KBC A;  4G0D A;  3DTI A;  3TT4 A;  3ZVS A;  4H2E A;  4GUY A;  1ZXV A;  4Q1L A;  1I1I P;  1Y8J A;  3AYU A;  2Z2D A;  4H76 A;  3I7I A;  3KEC A;  1KUK A;  1AF0 A;  3B92 A;  1HOV A;  4PKR A;  1JJ9 A;  1KUF A;  4XBH A;  2Y6D A;  1BQO A;  1A86 A;  1HV5 A;  3NX7 A;  2OXW A;  3HYG A;  2JSD A;  3WV1 A;  3DPE A;  1AST A;  2W12 A;  1UMT A;  1BSW A;  2RJQ A;  4PKQ A;  2JT5 A;  2YUF A;  4XM7 A;  1OS9 A;  3OHL A;  1HFS A;  3DTE A;  2O3E A;  3LUN A;  3ELM A;  1OS2 A;  3DTK A;  1XUR A;  2V4B A;  3EDI A;  1CGE A;  1BZS A;  1G9K A;  1DTH A;  5LAB A;  3ZUK A;  1I73 A;  3VTG A;  2OVZ A;  4FXQ A;  2ERP A;  4DPE A;  4ILW D;  3EHX A;  1C8T A;  4QKZ A;  2DW2 A;  3U1R A;  1MNC A;  4JQG A;  5D1T A;  4PKV A;  1D8F A;  1G12 A;  2OI0 A;  4GF1 A;  2N8R A;  1XM5 A;  4AUO A;  1CQR A;  1MMB A;  3B2Z A;  3KME A;  1ATL A;  2Y6C A;  3HB2 P;  1SLM A;  1QUA A;  2CLT A;  3EWJ A;  4FXY P;  5I2Z A;  1MMQ A;  3LIL A;  4JP4 A;  2O36 A;  2OW9 A;  1XFX A;  2XS3 A;  2OW0 A;  1GO7 P;  5CXA A;  1GKC A;  1HFC A;  1UEA A;  3N2V A;  4JA1 A;  1XFZ A;  3EDH A;  3Q2G A;  4PKW A; 
#chains in the Genus database with same CATH homology
 4G9L A;  1R55 A;  4AYK A;  3DPF A;  1XFU A;  1G05 A;  1I76 A;  1K7G A;  1PWU A;  2J0T A;  2K9C A;  2MZE A;  2OY4 A;  4WKI A;  1PWP A;  4FU4 A;  3LIK A;  1CIZ A;  1GKD A;  5I3M A;  1PWV A;  5JMY A;  3KEK A;  1QIB A;  1QJI A;  2MLR A;  4WK7 A;  1GE5 A;  3WV2 A;  3F17 A;  4J4M A;  3F18 A;  2RJP A;  1DMT A;  1C3I A;  1CAQ A;  4GWM A;  1ND1 A;  3KMC A;  3RTS A;  2D1O A;  1YCM A;  2OY2 A;  4AXQ A;  1XUC A;  5H8X A;  2E3X A;  1GE6 A;  1A85 A;  1JKY A;  1SAT A;  4GR0 A;  1CGF A;  4EFS A;  4WF6 A;  4AIG A;  1Z3J A;  2OZR A;  3K7L A;  1UMS A;  4H3X A;  2X3B A;  4HMA A;  5D2B A;  2OVX A;  1FBL A;  3P1V A;  1BKC E;  2DW1 A;  4DF9 A;  2OXU A;  1BQQ M;  1JK3 A;  3B8Z A;  1AKL A;  3EDZ A;  1ZXC A;  4L63 A;  5B5O A;  2JT6 A;  2JNP A;  1AYK A;  4A3W A;  456C A;  1OM7 A;  2WOA A;  3KWV C;  1GE7 A;  3F1A A;  1QIA A;  4XM8 A;  4IUW A;  3AYK A;  3MA2 A;  3DSL A;  1IAG A;  3LKA A;  1QIC A;  3KRY A;  1SLN A;  4ON1 A;  2DDY A;  3KEJ A;  2WO8 A;  3LJZ A;  3P24 A;  1D7X A;  1GXD A;  1GO8 P;  2SRT A;  1ZVX A;  1R1J A;  4DD8 A;  3DNG A;  2ERQ A;  1Q3A A;  2WO9 A;  4H82 A;  1Y93 A;  4GQL A;  1UTT A;  1O0Q A;  3O64 A;  1CXV A;  2K2G A;  1Y0V A;  1HTD A;  1OMJ A;  2QPJ A;  1R1I A;  1BIW A;  5CZM A;  3TS4 A;  1KUG A;  3L0V A;  5BPA A;  3O2X A;  2AYK A;  2TCL A;  2I47 A;  2POJ A;  4XCT A;  1YP1 A;  2OW2 A;  1ZTQ A;  3EDG A;  4GR8 A;  2PJT A;  1WNI A;  4L6T A;  2YB9 A;  1R1H A;  1QJJ A;  3LQ0 A;  1YOU A;  2L0R A;  4IN9 A;  4IJO A;  1MMR A;  4JPA A;  3BA0 A;  1IAE A;  4FVL A;  3LUM A;  3LK8 A;  1SMP A;  1JAN A;  2J83 A;  1D8M A;  2OW1 A;  2MZI A;  3EHY A;  1IAC A;  3F19 A;  3TSK A;  3N2U A;  966C A;  1OM8 A;  3V96 B;  3SHI A;  3LE9 A;  2JIH A;  1RMZ A;  2A8H A;  4L7A A;  1B8Y A;  3HY7 A;  1XUD A;  2W14 A;  3LEA A;  5L7F A;  4L19 A;  1K7Q A;  4A7B A;  4GWN A;  1JAP A;  1PWW A;  1C7K A;  1ZS0 A;  3OHO A;  1OM6 A;  3LJG A;  3LGP A;  5I0L A;  2X3C A;  4H49 A;  1YQY A;  1XFY A;  1KUI A;  4H1Q A;  5D3C A;  4WZV A;  1K7I A;  5I12 A;  4R3V A;  2YIG A;  1H71 P;  1SU3 A;  1J7N A;  1JIZ A;  5BOY A;  5D7W A;  4JIJ A;  1BM6 A;  3HDB A;  3G5C A;  4I35 A;  5D1S A;  3HY9 A;  5I43 A;  5L79 A;  2DW0 A;  3DL1 A;  2W13 A;  5CUH A;  3CKI A;  2W0D A;  4ZR5 A;  2FV9 A;  3WV3 A;  3HBU P;  4PKU A;  1BKC A;  2USN A;  4GR3 A;  3DWB A;  2CKI A;  3LQB A;  1D5J A;  1IAB A;  3F16 A;  1ZP5 A;  2DDF A;  3HDA P;  3USN A;  1CK7 A;  2MZH A;  1G49 A;  3VI1 A;  3LJT A;  2AIG P;  3L0T A;  1KUH A;  1L6J A;  2W15 A;  3TVC A;  4DV8 A;  1R54 A;  2D1N A;  1RM8 A;  2ERO A;  3RTT A;  1O0T A;  2MLS A;  1EAK A;  3LIR A;  2KRJ A;  1FLS A;  5D1U A;  1IAD A;  1OO9 A;  4I03 A;  3ZXH A;  5BOT A;  2XS4 A;  1SRP A;  4XM6 A;  1JH1 A;  4HX3 A;  1BUD A;  1EB6 A;  3HBV P;  1XFV A;  3G42 A;  4CTH A;  3Q2H A;  1CGL A;  1KAP P;  3K7N A;  1G4K A;  2HU6 A;  4PKT A;  1BUV M;  1HY7 A;  1EUB A;  830C A;  3UVC A;  5I4O A;  1S4B P;  3I7G A;  1USN A;  1JAO A;  3F15 A;  1UTZ A;  1BKC I;  2X7M A;  2FV5 A;  1PWQ A;  1FM1 A;  2X3A A;  1IAA A;  1MMP A;  4PKS A;  1B3D A;  2E2D A;  1JAQ A;  1XFW A;  3LMC A;  4H30 A;  3KHI A;  1JIW P;  1ROS A;  4H84 A;  3E8R A;  5B5P A;  2OXZ A;  4WKE A;  3AIG A;  3GBO A;  1KBC A;  4G0D A;  3DTI A;  3TT4 A;  3ZVS A;  4H2E A;  4GUY A;  1ZXV A;  4Q1L A;  1I1I P;  1Y8J A;  3AYU A;  2Z2D A;  4H76 A;  3I7I A;  3KEC A;  1KUK A;  1AF0 A;  3B92 A;  1HOV A;  4PKR A;  1JJ9 A;  1KUF A;  4XBH A;  2Y6D A;  1BQO A;  1A86 A;  1HV5 A;  3NX7 A;  2OXW A;  3HYG A;  2JSD A;  3WV1 A;  3DPE A;  1AST A;  2W12 A;  1UMT A;  1BSW A;  2RJQ A;  4PKQ A;  2JT5 A;  2YUF A;  4XM7 A;  1OS9 A;  3OHL A;  1HFS A;  3DTE A;  2O3E A;  3LUN A;  3ELM A;  1OS2 A;  3DTK A;  1XUR A;  2V4B A;  3EDI A;  1CGE A;  1BZS A;  1G9K A;  1DTH A;  5LAB A;  3ZUK A;  1I73 A;  3VTG A;  2OVZ A;  4FXQ A;  2ERP A;  4DPE A;  4ILW D;  3EHX A;  1C8T A;  4QKZ A;  2DW2 A;  3U1R A;  1MNC A;  4JQG A;  5D1T A;  4PKV A;  1D8F A;  1G12 A;  2OI0 A;  4GF1 A;  2N8R A;  4AUO A;  1CQR A;  1MMB A;  3B2Z A;  3KME A;  1ATL A;  2Y6C A;  3HB2 P;  1SLM A;  1QUA A;  2CLT A;  3EWJ A;  4FXY P;  5I2Z A;  1MMQ A;  3LIL A;  4JP4 A;  2O36 A;  2OW9 A;  1XFX A;  2XS3 A;  2OW0 A;  1GO7 P;  5CXA A;  1GKC A;  1HFC A;  1UEA A;  3N2V A;  4JA1 A;  1XFZ A;  3EDH A;  3Q2G A;  4PKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...