4Q1LA

Crystal structure of leucurolysin-a complexed with an endogenous tripeptide (qsw).
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
202
structure length
202
Chain Sequence
QQFSPRYIELVVVADHGMFKKYNSNLNTIRKWVHEMLNTVNGFFRSMNVDASLVNLEVWSKKDLIKVEKDSSKTLTSFGEWRERDLLPRISHDHAQLLTVIVFDEETIGIAYTAGMCDLSQSVAVVMDHSKKNLRVAVTMAHELGHNLGMRHDGNQCHCNAPSCIMADTLSKGLSFEFSDCSQNQYQTYLTKHNPQCILNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Leucurolysin-a complexed with an endogenous tripeptide (QSW).
rcsb
molecule keywords Snake venom metalloproteinase leucurolysin-A
molecule tags Hydrolase
total genus 73
structure length 202
sequence length 202
ec nomenclature ec 3.4.24.-:
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4q1lA00
1HV5A 3ZXHA 5BOTA 1CK7A 1EB6A 2E2DA 1OS9A 2OW2A 1C8TA 1C3IA 4IN9A 4G0DA 2J83A 2WOAA 3RTSA 1UMTA 1SMPA 1AKLA 1R1HA 4ILWD 1D7XA 2OW9A 1KUHA 1FM1A 1CGEA 1OO9A 4GR8A 1CXVA 4J4MA 1JAQA 1KUKA 4WKIA 2W12A 1BM6A 2D1OA 4JQGA 1HFSA 3B8ZA 1CGFA 4H30A 3F1AA 1XFZA 1MMRA 3G42A 3LIRA 3KHIA 1QJJA 3LEAA 2POJA 3LJTA 4H49A 2Y6DA 2YB9A 3VTGA 4XM8A 1MMQA 3K7NA 1G12A 4FXQA 1IAEA 1KBCA 1QUAA 1R1IA 4PKRA 1UTTA 2OVXA 1MMBA 1RMZA 1QJIA 3LKAA 3OHLA 1AYKA 1K7GA 2OXUA 1SATA 4EFSA 2OXWA 1GO8P 1YQYA 4GUYA 1OS2A 3V96B 3ZUKA 5I4OA 1KUIA 1L6JA 1B3DA 2DW1A 1G05A 1A85A 4A3WA 1I73A 4PKWA 2OVZA 1IABA 1GO7P 2O3EA 5D3CA 1OM8A 2OY4A 1D5JA 4PKUA 3HDAP 1R54A 1UTZA 3Q2GA 2DW0A 4I35A 3Q2HA 4GR3A 2L0RA 1DTHA 1XUDA 3TS4A 3N2VA 2WO9A 2X3CA 1XFXA 2ERQA 1AF0A 1BIWA 3LILA 4WZVA 4DPEA 3P24A 1I1IP 3AYUA 1GKDA 5L79A 3I7GA 3LJGA 2OI0A 4AXQA 4H2EA 3DL1A 4XBHA 3P1VA 2V4BA 1ZVXA 1KUFA 1PWQA 2RJPA 3NX7A 2JT6A 1K7QA 1XFYA 1Y93A 4AUOA 1RM8A 3LQBA 1MNCA 1GE6A 5I3MA 3LUMA 966CA 3KRYA 5I12A 2N8RA 3HBUP 5BPAA 3RTTA 1XFWA 2E3XA 1R1JA 2PJTA 2W13A 4JP4A 4AIGA 1PWPA 830CA 1J7NA 3F19A 2FV5A 5CXAA 4PKVA 1CIZA 3F17A 1IADA 1CGLA 5H8XA 1FBLA 1I76A 1JIWP 1HTDA 2CLTA 2X3BA 3ELMA 4GQLA 2JSDA 1EAKA 2I47A 2K2GA 2Y6CA 1G4KA 5D7WA 3UVCA 4XM7A 3U1RA 1KUGA 4H84A 3EDZA 4XM6A 3N2UA 3B92A 1G49A 1ROSA 2AYKA 1SLNA 3LJZA 5I43A 4GWNA 3WV2A 2JT5A 3BA0A 1XUCA 1Q3AA 3EDGA 3WV1A 2MLSA 2HU6A 1FLSA 5D1UA 3SHIA 1H71P 3TT4A 4HMAA 2Z2DA 2W15A 3HY7A 3LMCA 1DMTA 4L63A 5L7FA 1OM7A 3HB2P 1BZSA 3I7IA 3F15A 1ND1A 4FVLA 5D1SA 1HFCA 4WF6A 1BUVM 3DNGA 1BKCA 3AIGA 1JAOA 3EWJA 3E8RA 2YIGA 3O2XA 1O0QA 1KAPP 2TCLA 1Z3JA 1OMJA 3DPFA 2DDYA 3DPEA 3LK8A 3HYGA 3EDIA 4GF1A 1CQRA 2JNPA 3EHYA 1GE5A 4CTHA 3HDBA 4WKEA 1USNA 1S4BP 1BSWA 3MA2A 1HOVA 5I0LA 2JIHA 5LABA 4JA1A 4XCTA 2WO8A 1WNIA 1GXDA 2AIGP 1XFUA 3HBVP 2MZEA 4R3VA 4DF9A 2ERPA 5BOYA 2A8HA 4H1QA 3K7LA 2OY2A 1C7KA 1UEAA 4IUWA 4ON1A 2W0DA 1BQQM 3WV3A 1JIZA 2K9CA 1XURA 5CZMA 5B5PA 1QICA 3AYKA 4AYKA 1ATLA 2XS4A 3HY9A 2O36A 1PWVA 3GBOA 1EUBA 1JH1A 1JJ9A 5D2BA 3OHOA 1ZXCA 5D1TA 1CAQA 1PWWA 2QPJA 1ZTQA 456CA 2EROA 2SRTA 1QIAA 1ZP5A 1SLMA 2DDFA 2OW1A 3TSKA 4DD8A 4FU4A 1ASTA 1B8YA 4GR0A 1SU3A 1Y0VA 1UMSA 2MZIA 1G9KA 3VI1A 2XS3A 1YCMA 1D8FA 4PKTA 4H76A 2USNA 3LQ0A 3KMCA 4QKZA 4DV8A 1O0TA 1BUDA 2X3AA 1XFVA 1ZXVA 1YP1A 3L0TA 3KEJA 1PWUA 1Y8JA 4GWMA 2X7MA 5I2ZA 1IAGA 4Q1LA 5JMYA 2KRJA 1K7IA 3KMEA 1D8MA 3DSLA 4G9LA 3CKIA 3KECA 1YOUA 3KWVC 4IJOA 4PKQA 4JIJA 3USNA 4HX3A 3LIKA 1GKCA 2J0TA 4A7BA 4I03A 1JAPA 2OXZA 3TVCA 1ZS0A 1OM6A 2CKIA 4H82A 2MZHA 3L0VA 2OZRA 4H3XA 4JPAA 1JK3A 1GE7A 2W14A 3LGPA 1JKYA 1BKCI 1HY7A 1QIBA 2RJQA 4L6TA 1JANA 3KEKA 2D1NA 4L19A 2DW2A 4PKSA 3F16A 5CUHA 3DWBA 1MMPA 1BQOA 3G5CA 2MLRA 3EDHA 3B2ZA 4FXYP 3F18A 3ZVSA 1R55A 3EHXA 3LUNA 1IAAA 1A86A 1SRPA 2OW0A 1BKCE 4WK7A 5B5OA 4ZR5A 2FV9A 1IACA 3O64A 3LE9A
chains in the Genus database with same CATH superfamily
1HV5A 3ZXHA 5BOTA 1CK7A 1EB6A 2E2DA 1OS9A 2OW2A 1C8TA 1C3IA 4IN9A 4G0DA 2J83A 2WOAA 3RTSA 1UMTA 1SMPA 1AKLA 1R1HA 4ILWD 1D7XA 2OW9A 1KUHA 1FM1A 1CGEA 1OO9A 4GR8A 1CXVA 4J4MA 1JAQA 1KUKA 4WKIA 2W12A 1BM6A 2D1OA 4JQGA 1HFSA 3B8ZA 1CGFA 4H30A 3F1AA 1XFZA 1MMRA 3G42A 3LIRA 3KHIA 1QJJA 3LEAA 2POJA 3LJTA 4H49A 2Y6DA 2YB9A 3VTGA 4XM8A 1MMQA 3K7NA 1G12A 4FXQA 1IAEA 1KBCA 1QUAA 1R1IA 4PKRA 1UTTA 2OVXA 1MMBA 1RMZA 1QJIA 3LKAA 3OHLA 1AYKA 1K7GA 2OXUA 1SATA 4EFSA 2OXWA 1GO8P 1YQYA 4GUYA 1OS2A 3V96B 3ZUKA 5I4OA 1KUIA 1L6JA 1B3DA 2DW1A 1G05A 1A85A 4A3WA 1I73A 4PKWA 2OVZA 1IABA 1GO7P 2O3EA 5D3CA 1OM8A 2OY4A 2YUFA 1D5JA 4PKUA 3HDAP 1R54A 1UTZA 3Q2GA 2DW0A 4I35A 3Q2HA 4GR3A 2L0RA 1DTHA 1XUDA 3TS4A 3N2VA 2WO9A 2X3CA 1XFXA 2ERQA 1AF0A 1BIWA 3LILA 4WZVA 4DPEA 3P24A 1I1IP 3AYUA 1GKDA 5L79A 3I7GA 3LJGA 2OI0A 4AXQA 4H2EA 3DL1A 4XBHA 3P1VA 2V4BA 1ZVXA 1KUFA 1PWQA 2RJPA 3NX7A 1XAXA 2JT6A 1K7QA 1XFYA 1Y93A 4AUOA 1RM8A 3LQBA 1MNCA 1GE6A 5I3MA 3LUMA 966CA 3KRYA 5I12A 2N8RA 3HBUP 5BPAA 3RTTA 1XFWA 2E3XA 1R1JA 2PJTA 2W13A 4JP4A 4AIGA 3DTEA 1PWPA 830CA 1J7NA 3F19A 2FV5A 5CXAA 4PKVA 4L7AA 1CIZA 3F17A 1IADA 1CGLA 5H8XA 1FBLA 1I76A 1JIWP 1HTDA 2CLTA 2X3BA 3ELMA 4GQLA 2JSDA 1EAKA 2I47A 2K2GA 2Y6CA 1G4KA 5D7WA 3UVCA 4XM7A 3U1RA 1KUGA 4H84A 3EDZA 4XM6A 3N2UA 3B92A 1G49A 1ROSA 2AYKA 1SLNA 3LJZA 5I43A 4GWNA 3WV2A 2JT5A 3BA0A 1XUCA 1Q3AA 3EDGA 3WV1A 2MLSA 3DTIA 2HU6A 1FLSA 5D1UA 3SHIA 1H71P 3TT4A 4HMAA 2Z2DA 2W15A 3HY7A 3LMCA 1DMTA 4L63A 5L7FA 1OM7A 3HB2P 1BZSA 3I7IA 3F15A 1ND1A 4FVLA 5D1SA 1HFCA 4WF6A 1BUVM 3DNGA 1BKCA 3AIGA 1JAOA 3EWJA 3E8RA 2YIGA 3O2XA 1O0QA 1KAPP 2TCLA 1Z3JA 1OMJA 3DPFA 2DDYA 3DPEA 3LK8A 3HYGA 3EDIA 4GF1A 1CQRA 2JNPA 3EHYA 1GE5A 4CTHA 3HDBA 4WKEA 1USNA 1S4BP 1BSWA 3MA2A 1HOVA 5I0LA 2JIHA 5LABA 4JA1A 4XCTA 2WO8A 1WNIA 1GXDA 2AIGP 1XFUA 3HBVP 2MZEA 4R3VA 4DF9A 1TVIA 2ERPA 5BOYA 2A8HA 4H1QA 3K7LA 2OY2A 1C7KA 1UEAA 4IUWA 4ON1A 2W0DA 1BQQM 3WV3A 1JIZA 2K9CA 1XURA 1XM5A 5CZMA 5B5PA 1QICA 3AYKA 4AYKA 1ATLA 2XS4A 3HY9A 2O36A 1PWVA 3GBOA 1EUBA 1JH1A 1JJ9A 3DTKA 5D2BA 3OHOA 1ZXCA 5D1TA 1CAQA 1PWWA 2QPJA 1ZTQA 456CA 2EROA 2SRTA 1QIAA 1ZP5A 1SLMA 2DDFA 2OW1A 3TSKA 1OZ9A 4DD8A 4FU4A 1ASTA 1B8YA 4GR0A 1SU3A 1Y0VA 1UMSA 2MZIA 1G9KA 3VI1A 2XS3A 1YCMA 1D8FA 4PKTA 4H76A 2USNA 3LQ0A 3KMCA 4QKZA 4DV8A 1O0TA 1BUDA 2X3AA 1XFVA 1ZXVA 1YP1A 3L0TA 3KEJA 1PWUA 1Y8JA 4GWMA 2X7MA 5I2ZA 1IAGA 4Q1LA 5JMYA 2KRJA 1K7IA 3KMEA 1D8MA 3DSLA 4G9LA 3CKIA 3KECA 1YOUA 3KWVC 4IJOA 4PKQA 4JIJA 3USNA 4HX3A 3LIKA 1GKCA 2J0TA 4A7BA 4I03A 1JAPA 2OXZA 3TVCA 1ZS0A 1OM6A 2CKIA 4H82A 2MZHA 3L0VA 2OZRA 4H3XA 4JPAA 1JK3A 1GE7A 2W14A 3LGPA 1JKYA 1BKCI 1HY7A 1QIBA 2RJQA 4L6TA 1JANA 3KEKA 2D1NA 4L19A 2DW2A 4PKSA 3F16A 5CUHA 3DWBA 1MMPA 1BQOA 3G5CA 2MLRA 3EDHA 3B2ZA 4FXYP 3F18A 3ZVSA 1R55A 3EHXA 3LUNA 1IAAA 1A86A 1SRPA 2OW0A 1BKCE 4WK7A 5B5OA 4ZR5A 2FV9A 1IACA 3O64A 3LE9A
chains in the Genus database with same CATH topology
1HV5A 3ZXHA 5BOTA 1CK7A 1EB6A 2E2DA 1OS9A 2OW2A 1C8TA 1C3IA 4IN9A 4G0DA 2J83A 2WOAA 3RTSA 1UMTA 1SMPA 1AKLA 1R1HA 4ILWD 1D7XA 2OW9A 1KUHA 1FM1A 1CGEA 1OO9A 4GR8A 1CXVA 4J4MA 1JAQA 1KUKA 4WKIA 2W12A 1BM6A 2D1OA 4JQGA 1HFSA 3B8ZA 1CGFA 4H30A 3F1AA 1XFZA 1MMRA 3G42A 3LIRA 3KHIA 1QJJA 3LEAA 2POJA 3LJTA 4H49A 2Y6DA 2YB9A 3VTGA 4XM8A 1MMQA 3K7NA 1G12A 4FXQA 1IAEA 1KBCA 1QUAA 1R1IA 4PKRA 1UTTA 2OVXA 1MMBA 1RMZA 1QJIA 3LKAA 3OHLA 1AYKA 1K7GA 2OXUA 1SATA 4EFSA 2OXWA 1GO8P 1YQYA 4GUYA 1OS2A 3V96B 3ZUKA 5I4OA 1KUIA 1L6JA 1B3DA 2DW1A 1G05A 1A85A 4A3WA 1I73A 4PKWA 2OVZA 1IABA 1GO7P 2O3EA 5D3CA 1OM8A 2OY4A 2YUFA 1D5JA 4PKUA 3HDAP 1R54A 1UTZA 3Q2GA 2DW0A 4I35A 3Q2HA 4GR3A 2L0RA 1DTHA 1XUDA 3TS4A 3N2VA 2WO9A 2X3CA 1XFXA 2ERQA 1AF0A 1BIWA 3LILA 4WZVA 4DPEA 3P24A 1I1IP 3AYUA 1GKDA 5L79A 3I7GA 3LJGA 2OI0A 4AXQA 4H2EA 3DL1A 4XBHA 3P1VA 2V4BA 1ZVXA 1KUFA 1PWQA 2RJPA 3NX7A 2JT6A 1K7QA 1XFYA 1Y93A 4AUOA 1RM8A 3LQBA 1MNCA 1GE6A 5I3MA 3LUMA 966CA 3KRYA 5I12A 2N8RA 3HBUP 5BPAA 3RTTA 1XFWA 2E3XA 1R1JA 2PJTA 2W13A 4JP4A 4AIGA 3DTEA 1PWPA 830CA 1J7NA 3F19A 2FV5A 5CXAA 4PKVA 4L7AA 1CIZA 3F17A 1IADA 1CGLA 5H8XA 1FBLA 1I76A 1JIWP 1HTDA 2CLTA 2X3BA 3ELMA 4GQLA 2JSDA 1EAKA 2I47A 2K2GA 2Y6CA 1G4KA 5D7WA 3UVCA 4XM7A 3U1RA 1KUGA 4H84A 3EDZA 4XM6A 3N2UA 3B92A 1G49A 1ROSA 2AYKA 1SLNA 3LJZA 5I43A 4GWNA 3WV2A 2JT5A 3BA0A 1XUCA 1Q3AA 3EDGA 3WV1A 2MLSA 3DTIA 2HU6A 1FLSA 5D1UA 3SHIA 1H71P 3TT4A 4HMAA 2Z2DA 2W15A 3HY7A 3LMCA 1DMTA 4L63A 5L7FA 1OM7A 3HB2P 1BZSA 3I7IA 3F15A 1ND1A 4FVLA 5D1SA 1HFCA 4WF6A 1BUVM 3DNGA 1BKCA 3AIGA 1JAOA 3EWJA 3E8RA 2YIGA 3O2XA 1O0QA 1KAPP 2TCLA 1Z3JA 1OMJA 3DPFA 2DDYA 3DPEA 3LK8A 3HYGA 3EDIA 4GF1A 1CQRA 2JNPA 3EHYA 1GE5A 4CTHA 3HDBA 4WKEA 1USNA 1S4BP 1BSWA 3MA2A 1HOVA 5I0LA 2JIHA 5LABA 4JA1A 4XCTA 2WO8A 1WNIA 1GXDA 2AIGP 1XFUA 3HBVP 2MZEA 4R3VA 4DF9A 2ERPA 5BOYA 2A8HA 4H1QA 3K7LA 2OY2A 1C7KA 1UEAA 4IUWA 4ON1A 2W0DA 1BQQM 3WV3A 1JIZA 2K9CA 1XURA 5CZMA 5B5PA 1QICA 3AYKA 4AYKA 1ATLA 2XS4A 3HY9A 2O36A 1PWVA 3GBOA 1EUBA 1JH1A 1JJ9A 3DTKA 5D2BA 3OHOA 1ZXCA 5D1TA 1CAQA 1PWWA 2QPJA 1ZTQA 456CA 2EROA 2SRTA 1QIAA 1ZP5A 1SLMA 2DDFA 2OW1A 3TSKA 4DD8A 4FU4A 1ASTA 1B8YA 4GR0A 1SU3A 1Y0VA 1UMSA 2MZIA 1G9KA 3VI1A 2XS3A 1YCMA 1D8FA 4PKTA 4H76A 2USNA 3LQ0A 3KMCA 4QKZA 4DV8A 1O0TA 1BUDA 2X3AA 1XFVA 1ZXVA 1YP1A 3L0TA 3KEJA 1PWUA 1Y8JA 4GWMA 2X7MA 5I2ZA 1IAGA 4Q1LA 5JMYA 2KRJA 1K7IA 3KMEA 1D8MA 3DSLA 4G9LA 3CKIA 3KECA 1YOUA 3KWVC 4IJOA 4PKQA 4JIJA 3USNA 4HX3A 3LIKA 1GKCA 2J0TA 4A7BA 4I03A 1JAPA 2OXZA 3TVCA 1ZS0A 1OM6A 2CKIA 4H82A 2MZHA 3L0VA 2OZRA 4H3XA 4JPAA 1JK3A 1GE7A 2W14A 3LGPA 1JKYA 1BKCI 1HY7A 1QIBA 2RJQA 4L6TA 1JANA 3KEKA 2D1NA 4L19A 2DW2A 4PKSA 3F16A 5CUHA 3DWBA 1MMPA 1BQOA 3G5CA 2MLRA 3EDHA 3B2ZA 4FXYP 3F18A 3ZVSA 1R55A 3EHXA 3LUNA 1IAAA 1A86A 1SRPA 2OW0A 1BKCE 4WK7A 5B5OA 4ZR5A 2FV9A 1IACA 3O64A 3LE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HV5 A;  3ZXH A;  5BOT A;  1CK7 A;  1EB6 A;  2E2D A;  1OS9 A;  2OW2 A;  1C8T A;  1C3I A;  4IN9 A;  4G0D A;  2J83 A;  2WOA A;  3RTS A;  1UMT A;  1SMP A;  1AKL A;  1R1H A;  4ILW D;  1D7X A;  2OW9 A;  1KUH A;  1FM1 A;  1CGE A;  1OO9 A;  4GR8 A;  1CXV A;  4J4M A;  1JAQ A;  1KUK A;  4WKI A;  2W12 A;  1BM6 A;  2D1O A;  4JQG A;  1HFS A;  3B8Z A;  1CGF A;  4H30 A;  3F1A A;  1XFZ A;  1MMR A;  3G42 A;  3LIR A;  3KHI A;  1QJJ A;  3LEA A;  2POJ A;  3LJT A;  4H49 A;  2Y6D A;  2YB9 A;  3VTG A;  4XM8 A;  1MMQ A;  3K7N A;  1G12 A;  4FXQ A;  1IAE A;  1KBC A;  1QUA A;  1R1I A;  4PKR A;  1UTT A;  2OVX A;  1MMB A;  1RMZ A;  1QJI A;  3LKA A;  3OHL A;  1AYK A;  1K7G A;  2OXU A;  1SAT A;  4EFS A;  2OXW A;  1GO8 P;  1YQY A;  4GUY A;  1OS2 A;  3V96 B;  3ZUK A;  5I4O A;  1KUI A;  1L6J A;  1B3D A;  2DW1 A;  1G05 A;  1A85 A;  4A3W A;  1I73 A;  4PKW A;  2OVZ A;  1IAB A;  1GO7 P;  2O3E A;  5D3C A;  1OM8 A;  2OY4 A;  1D5J A;  4PKU A;  3HDA P;  1R54 A;  1UTZ A;  3Q2G A;  2DW0 A;  4I35 A;  3Q2H A;  4GR3 A;  2L0R A;  1DTH A;  1XUD A;  3TS4 A;  3N2V A;  2WO9 A;  2X3C A;  1XFX A;  2ERQ A;  1AF0 A;  1BIW A;  3LIL A;  4WZV A;  4DPE A;  3P24 A;  1I1I P;  3AYU A;  1GKD A;  5L79 A;  3I7G A;  3LJG A;  2OI0 A;  4AXQ A;  4H2E A;  3DL1 A;  4XBH A;  3P1V A;  2V4B A;  1ZVX A;  1KUF A;  1PWQ A;  2RJP A;  3NX7 A;  2JT6 A;  1K7Q A;  1XFY A;  1Y93 A;  4AUO A;  1RM8 A;  3LQB A;  1MNC A;  1GE6 A;  5I3M A;  3LUM A;  966C A;  3KRY A;  5I12 A;  2N8R A;  3HBU P;  5BPA A;  3RTT A;  1XFW A;  2E3X A;  1R1J A;  2PJT A;  2W13 A;  4JP4 A;  4AIG A;  1PWP A;  830C A;  1J7N A;  3F19 A;  2FV5 A;  5CXA A;  4PKV A;  1CIZ A;  3F17 A;  1IAD A;  1CGL A;  5H8X A;  1FBL A;  1I76 A;  1JIW P;  1HTD A;  2CLT A;  2X3B A;  3ELM A;  4GQL A;  2JSD A;  1EAK A;  2I47 A;  2K2G A;  2Y6C A;  1G4K A;  5D7W A;  3UVC A;  4XM7 A;  3U1R A;  1KUG A;  4H84 A;  3EDZ A;  4XM6 A;  3N2U A;  3B92 A;  1G49 A;  1ROS A;  2AYK A;  1SLN A;  3LJZ A;  5I43 A;  4GWN A;  3WV2 A;  2JT5 A;  3BA0 A;  1XUC A;  1Q3A A;  3EDG A;  3WV1 A;  2MLS A;  2HU6 A;  1FLS A;  5D1U A;  3SHI A;  1H71 P;  3TT4 A;  4HMA A;  2Z2D A;  2W15 A;  3HY7 A;  3LMC A;  1DMT A;  4L63 A;  5L7F A;  1OM7 A;  3HB2 P;  1BZS A;  3I7I A;  3F15 A;  1ND1 A;  4FVL A;  5D1S A;  1HFC A;  4WF6 A;  1BUV M;  3DNG A;  1BKC A;  3AIG A;  1JAO A;  3EWJ A;  3E8R A;  2YIG A;  3O2X A;  1O0Q A;  1KAP P;  2TCL A;  1Z3J A;  1OMJ A;  3DPF A;  2DDY A;  3DPE A;  3LK8 A;  3HYG A;  3EDI A;  4GF1 A;  1CQR A;  2JNP A;  3EHY A;  1GE5 A;  4CTH A;  3HDB A;  4WKE A;  1USN A;  1S4B P;  1BSW A;  3MA2 A;  1HOV A;  5I0L A;  2JIH A;  5LAB A;  4JA1 A;  4XCT A;  2WO8 A;  1WNI A;  1GXD A;  2AIG P;  1XFU A;  3HBV P;  2MZE A;  4R3V A;  4DF9 A;  2ERP A;  5BOY A;  2A8H A;  4H1Q A;  3K7L A;  2OY2 A;  1C7K A;  1UEA A;  4IUW A;  4ON1 A;  2W0D A;  1BQQ M;  3WV3 A;  1JIZ A;  2K9C A;  1XUR A;  5CZM A;  5B5P A;  1QIC A;  3AYK A;  4AYK A;  1ATL A;  2XS4 A;  3HY9 A;  2O36 A;  1PWV A;  3GBO A;  1EUB A;  1JH1 A;  1JJ9 A;  5D2B A;  3OHO A;  1ZXC A;  5D1T A;  1CAQ A;  1PWW A;  2QPJ A;  1ZTQ A;  456C A;  2ERO A;  2SRT A;  1QIA A;  1ZP5 A;  1SLM A;  2DDF A;  2OW1 A;  3TSK A;  4DD8 A;  4FU4 A;  1AST A;  1B8Y A;  4GR0 A;  1SU3 A;  1Y0V A;  1UMS A;  2MZI A;  1G9K A;  3VI1 A;  2XS3 A;  1YCM A;  1D8F A;  4PKT A;  4H76 A;  2USN A;  3LQ0 A;  3KMC A;  4QKZ A;  4DV8 A;  1O0T A;  1BUD A;  2X3A A;  1XFV A;  1ZXV A;  1YP1 A;  3L0T A;  3KEJ A;  1PWU A;  1Y8J A;  4GWM A;  2X7M A;  5I2Z A;  1IAG A;  4Q1L A;  5JMY A;  2KRJ A;  1K7I A;  3KME A;  1D8M A;  3DSL A;  4G9L A;  3CKI A;  3KEC A;  1YOU A;  3KWV C;  4IJO A;  4PKQ A;  4JIJ A;  3USN A;  4HX3 A;  3LIK A;  1GKC A;  2J0T A;  4A7B A;  4I03 A;  1JAP A;  2OXZ A;  3TVC A;  1ZS0 A;  1OM6 A;  2CKI A;  4H82 A;  2MZH A;  3L0V A;  2OZR A;  4H3X A;  4JPA A;  1JK3 A;  1GE7 A;  2W14 A;  3LGP A;  1JKY A;  1BKC I;  1HY7 A;  1QIB A;  2RJQ A;  4L6T A;  1JAN A;  3KEK A;  2D1N A;  4L19 A;  2DW2 A;  4PKS A;  3F16 A;  5CUH A;  3DWB A;  1MMP A;  1BQO A;  3G5C A;  2MLR A;  3EDH A;  3B2Z A;  4FXY P;  3F18 A;  3ZVS A;  1R55 A;  3EHX A;  3LUN A;  1IAA A;  1A86 A;  1SRP A;  2OW0 A;  1BKC E;  4WK7 A;  5B5O A;  4ZR5 A;  2FV9 A;  1IAC A;  3O64 A;  3LE9 A; 
#chains in the Genus database with same CATH topology
 1HV5 A;  3ZXH A;  5BOT A;  1CK7 A;  1EB6 A;  2E2D A;  1OS9 A;  2OW2 A;  1C8T A;  1C3I A;  4IN9 A;  4G0D A;  2J83 A;  2WOA A;  3RTS A;  1UMT A;  1SMP A;  1AKL A;  1R1H A;  4ILW D;  1D7X A;  2OW9 A;  1KUH A;  1FM1 A;  1CGE A;  1OO9 A;  4GR8 A;  1CXV A;  4J4M A;  1JAQ A;  1KUK A;  4WKI A;  2W12 A;  1BM6 A;  2D1O A;  4JQG A;  1HFS A;  3B8Z A;  1CGF A;  4H30 A;  3F1A A;  1XFZ A;  1MMR A;  3G42 A;  3LIR A;  3KHI A;  1QJJ A;  3LEA A;  2POJ A;  3LJT A;  4H49 A;  2Y6D A;  2YB9 A;  3VTG A;  4XM8 A;  1MMQ A;  3K7N A;  1G12 A;  4FXQ A;  1IAE A;  1KBC A;  1QUA A;  1R1I A;  4PKR A;  1UTT A;  2OVX A;  1MMB A;  1RMZ A;  1QJI A;  3LKA A;  3OHL A;  1AYK A;  1K7G A;  2OXU A;  1SAT A;  4EFS A;  2OXW A;  1GO8 P;  1YQY A;  4GUY A;  1OS2 A;  3V96 B;  3ZUK A;  5I4O A;  1KUI A;  1L6J A;  1B3D A;  2DW1 A;  1G05 A;  1A85 A;  4A3W A;  1I73 A;  4PKW A;  2OVZ A;  1IAB A;  1GO7 P;  2O3E A;  5D3C A;  1OM8 A;  2OY4 A;  2YUF A;  1D5J A;  4PKU A;  3HDA P;  1R54 A;  1UTZ A;  3Q2G A;  2DW0 A;  4I35 A;  3Q2H A;  4GR3 A;  2L0R A;  1DTH A;  1XUD A;  3TS4 A;  3N2V A;  2WO9 A;  2X3C A;  1XFX A;  2ERQ A;  1AF0 A;  1BIW A;  3LIL A;  4WZV A;  4DPE A;  3P24 A;  1I1I P;  3AYU A;  1GKD A;  5L79 A;  3I7G A;  3LJG A;  2OI0 A;  4AXQ A;  4H2E A;  3DL1 A;  4XBH A;  3P1V A;  2V4B A;  1ZVX A;  1KUF A;  1PWQ A;  2RJP A;  3NX7 A;  1XAX A;  2JT6 A;  1K7Q A;  1XFY A;  1Y93 A;  4AUO A;  1RM8 A;  3LQB A;  1MNC A;  1GE6 A;  5I3M A;  3LUM A;  966C A;  3KRY A;  5I12 A;  2N8R A;  3HBU P;  5BPA A;  3RTT A;  1XFW A;  2E3X A;  1R1J A;  2PJT A;  2W13 A;  4JP4 A;  4AIG A;  3DTE A;  1PWP A;  830C A;  1J7N A;  3F19 A;  2FV5 A;  5CXA A;  4PKV A;  4L7A A;  1CIZ A;  3F17 A;  1IAD A;  1CGL A;  5H8X A;  1FBL A;  1I76 A;  1JIW P;  1HTD A;  2CLT A;  2X3B A;  3ELM A;  4GQL A;  2JSD A;  1EAK A;  2I47 A;  2K2G A;  2Y6C A;  1G4K A;  5D7W A;  3UVC A;  4XM7 A;  3U1R A;  1KUG A;  4H84 A;  3EDZ A;  4XM6 A;  3N2U A;  3B92 A;  1G49 A;  1ROS A;  2AYK A;  1SLN A;  3LJZ A;  5I43 A;  4GWN A;  3WV2 A;  2JT5 A;  3BA0 A;  1XUC A;  1Q3A A;  3EDG A;  3WV1 A;  2MLS A;  3DTI A;  2HU6 A;  1FLS A;  5D1U A;  3SHI A;  1H71 P;  3TT4 A;  4HMA A;  2Z2D A;  2W15 A;  3HY7 A;  3LMC A;  1DMT A;  4L63 A;  5L7F A;  1OM7 A;  3HB2 P;  1BZS A;  3I7I A;  3F15 A;  1ND1 A;  4FVL A;  5D1S A;  1HFC A;  4WF6 A;  1BUV M;  3DNG A;  1BKC A;  3AIG A;  1JAO A;  3EWJ A;  3E8R A;  2YIG A;  3O2X A;  1O0Q A;  1KAP P;  2TCL A;  1Z3J A;  1OMJ A;  3DPF A;  2DDY A;  3DPE A;  3LK8 A;  3HYG A;  3EDI A;  4GF1 A;  1CQR A;  2JNP A;  3EHY A;  1GE5 A;  4CTH A;  3HDB A;  4WKE A;  1USN A;  1S4B P;  1BSW A;  3MA2 A;  1HOV A;  5I0L A;  2JIH A;  5LAB A;  4JA1 A;  4XCT A;  2WO8 A;  1WNI A;  1GXD A;  2AIG P;  1XFU A;  3HBV P;  2MZE A;  4R3V A;  4DF9 A;  1TVI A;  2ERP A;  5BOY A;  2A8H A;  4H1Q A;  3K7L A;  2OY2 A;  1C7K A;  1UEA A;  4IUW A;  4ON1 A;  2W0D A;  1BQQ M;  3WV3 A;  1JIZ A;  2K9C A;  1XUR A;  1XM5 A;  5CZM A;  5B5P A;  1QIC A;  3AYK A;  4AYK A;  1ATL A;  2XS4 A;  3HY9 A;  2O36 A;  1PWV A;  3GBO A;  1EUB A;  1JH1 A;  1JJ9 A;  3DTK A;  5D2B A;  3OHO A;  1ZXC A;  5D1T A;  1CAQ A;  1PWW A;  2QPJ A;  1ZTQ A;  456C A;  2ERO A;  2SRT A;  1QIA A;  1ZP5 A;  1SLM A;  2DDF A;  2OW1 A;  3TSK A;  1OZ9 A;  4DD8 A;  4FU4 A;  1AST A;  1B8Y A;  4GR0 A;  1SU3 A;  1Y0V A;  1UMS A;  2MZI A;  1G9K A;  3VI1 A;  2XS3 A;  1YCM A;  1D8F A;  4PKT A;  4H76 A;  2USN A;  3LQ0 A;  3KMC A;  4QKZ A;  4DV8 A;  1O0T A;  1BUD A;  2X3A A;  1XFV A;  1ZXV A;  1YP1 A;  3L0T A;  3KEJ A;  1PWU A;  1Y8J A;  4GWM A;  2X7M A;  5I2Z A;  1IAG A;  4Q1L A;  5JMY A;  2KRJ A;  1K7I A;  3KME A;  1D8M A;  3DSL A;  4G9L A;  3CKI A;  3KEC A;  1YOU A;  3KWV C;  4IJO A;  4PKQ A;  4JIJ A;  3USN A;  4HX3 A;  3LIK A;  1GKC A;  2J0T A;  4A7B A;  4I03 A;  1JAP A;  2OXZ A;  3TVC A;  1ZS0 A;  1OM6 A;  2CKI A;  4H82 A;  2MZH A;  3L0V A;  2OZR A;  4H3X A;  4JPA A;  1JK3 A;  1GE7 A;  2W14 A;  3LGP A;  1JKY A;  1BKC I;  1HY7 A;  1QIB A;  2RJQ A;  4L6T A;  1JAN A;  3KEK A;  2D1N A;  4L19 A;  2DW2 A;  4PKS A;  3F16 A;  5CUH A;  3DWB A;  1MMP A;  1BQO A;  3G5C A;  2MLR A;  3EDH A;  3B2Z A;  4FXY P;  3F18 A;  3ZVS A;  1R55 A;  3EHX A;  3LUN A;  1IAA A;  1A86 A;  1SRP A;  2OW0 A;  1BKC E;  4WK7 A;  5B5O A;  4ZR5 A;  2FV9 A;  1IAC A;  3O64 A;  3LE9 A; 
#chains in the Genus database with same CATH homology
 1HV5 A;  3ZXH A;  5BOT A;  1CK7 A;  1EB6 A;  2E2D A;  1OS9 A;  2OW2 A;  1C8T A;  1C3I A;  4IN9 A;  4G0D A;  2J83 A;  2WOA A;  3RTS A;  1UMT A;  1SMP A;  1AKL A;  1R1H A;  4ILW D;  1D7X A;  2OW9 A;  1KUH A;  1FM1 A;  1CGE A;  1OO9 A;  4GR8 A;  1CXV A;  4J4M A;  1JAQ A;  1KUK A;  4WKI A;  2W12 A;  1BM6 A;  2D1O A;  4JQG A;  1HFS A;  3B8Z A;  1CGF A;  4H30 A;  3F1A A;  1XFZ A;  1MMR A;  3G42 A;  3LIR A;  3KHI A;  1QJJ A;  3LEA A;  2POJ A;  3LJT A;  4H49 A;  2Y6D A;  2YB9 A;  3VTG A;  4XM8 A;  1MMQ A;  3K7N A;  1G12 A;  4FXQ A;  1IAE A;  1KBC A;  1QUA A;  1R1I A;  4PKR A;  1UTT A;  2OVX A;  1MMB A;  1RMZ A;  1QJI A;  3LKA A;  3OHL A;  1AYK A;  1K7G A;  2OXU A;  1SAT A;  4EFS A;  2OXW A;  1GO8 P;  1YQY A;  4GUY A;  1OS2 A;  3V96 B;  3ZUK A;  5I4O A;  1KUI A;  1L6J A;  1B3D A;  2DW1 A;  1G05 A;  1A85 A;  4A3W A;  1I73 A;  4PKW A;  2OVZ A;  1IAB A;  1GO7 P;  2O3E A;  5D3C A;  1OM8 A;  2OY4 A;  2YUF A;  1D5J A;  4PKU A;  3HDA P;  1R54 A;  1UTZ A;  3Q2G A;  2DW0 A;  4I35 A;  3Q2H A;  4GR3 A;  2L0R A;  1DTH A;  1XUD A;  3TS4 A;  3N2V A;  2WO9 A;  2X3C A;  1XFX A;  2ERQ A;  1AF0 A;  1BIW A;  3LIL A;  4WZV A;  4DPE A;  3P24 A;  1I1I P;  3AYU A;  1GKD A;  5L79 A;  3I7G A;  3LJG A;  2OI0 A;  4AXQ A;  4H2E A;  3DL1 A;  4XBH A;  3P1V A;  2V4B A;  1ZVX A;  1KUF A;  1PWQ A;  2RJP A;  3NX7 A;  2JT6 A;  1K7Q A;  1XFY A;  1Y93 A;  4AUO A;  1RM8 A;  3LQB A;  1MNC A;  1GE6 A;  5I3M A;  3LUM A;  966C A;  3KRY A;  5I12 A;  2N8R A;  3HBU P;  5BPA A;  3RTT A;  1XFW A;  2E3X A;  1R1J A;  2PJT A;  2W13 A;  4JP4 A;  4AIG A;  3DTE A;  1PWP A;  830C A;  1J7N A;  3F19 A;  2FV5 A;  5CXA A;  4PKV A;  4L7A A;  1CIZ A;  3F17 A;  1IAD A;  1CGL A;  5H8X A;  1FBL A;  1I76 A;  1JIW P;  1HTD A;  2CLT A;  2X3B A;  3ELM A;  4GQL A;  2JSD A;  1EAK A;  2I47 A;  2K2G A;  2Y6C A;  1G4K A;  5D7W A;  3UVC A;  4XM7 A;  3U1R A;  1KUG A;  4H84 A;  3EDZ A;  4XM6 A;  3N2U A;  3B92 A;  1G49 A;  1ROS A;  2AYK A;  1SLN A;  3LJZ A;  5I43 A;  4GWN A;  3WV2 A;  2JT5 A;  3BA0 A;  1XUC A;  1Q3A A;  3EDG A;  3WV1 A;  2MLS A;  3DTI A;  2HU6 A;  1FLS A;  5D1U A;  3SHI A;  1H71 P;  3TT4 A;  4HMA A;  2Z2D A;  2W15 A;  3HY7 A;  3LMC A;  1DMT A;  4L63 A;  5L7F A;  1OM7 A;  3HB2 P;  1BZS A;  3I7I A;  3F15 A;  1ND1 A;  4FVL A;  5D1S A;  1HFC A;  4WF6 A;  1BUV M;  3DNG A;  1BKC A;  3AIG A;  1JAO A;  3EWJ A;  3E8R A;  2YIG A;  3O2X A;  1O0Q A;  1KAP P;  2TCL A;  1Z3J A;  1OMJ A;  3DPF A;  2DDY A;  3DPE A;  3LK8 A;  3HYG A;  3EDI A;  4GF1 A;  1CQR A;  2JNP A;  3EHY A;  1GE5 A;  4CTH A;  3HDB A;  4WKE A;  1USN A;  1S4B P;  1BSW A;  3MA2 A;  1HOV A;  5I0L A;  2JIH A;  5LAB A;  4JA1 A;  4XCT A;  2WO8 A;  1WNI A;  1GXD A;  2AIG P;  1XFU A;  3HBV P;  2MZE A;  4R3V A;  4DF9 A;  2ERP A;  5BOY A;  2A8H A;  4H1Q A;  3K7L A;  2OY2 A;  1C7K A;  1UEA A;  4IUW A;  4ON1 A;  2W0D A;  1BQQ M;  3WV3 A;  1JIZ A;  2K9C A;  1XUR A;  5CZM A;  5B5P A;  1QIC A;  3AYK A;  4AYK A;  1ATL A;  2XS4 A;  3HY9 A;  2O36 A;  1PWV A;  3GBO A;  1EUB A;  1JH1 A;  1JJ9 A;  3DTK A;  5D2B A;  3OHO A;  1ZXC A;  5D1T A;  1CAQ A;  1PWW A;  2QPJ A;  1ZTQ A;  456C A;  2ERO A;  2SRT A;  1QIA A;  1ZP5 A;  1SLM A;  2DDF A;  2OW1 A;  3TSK A;  4DD8 A;  4FU4 A;  1AST A;  1B8Y A;  4GR0 A;  1SU3 A;  1Y0V A;  1UMS A;  2MZI A;  1G9K A;  3VI1 A;  2XS3 A;  1YCM A;  1D8F A;  4PKT A;  4H76 A;  2USN A;  3LQ0 A;  3KMC A;  4QKZ A;  4DV8 A;  1O0T A;  1BUD A;  2X3A A;  1XFV A;  1ZXV A;  1YP1 A;  3L0T A;  3KEJ A;  1PWU A;  1Y8J A;  4GWM A;  2X7M A;  5I2Z A;  1IAG A;  4Q1L A;  5JMY A;  2KRJ A;  1K7I A;  3KME A;  1D8M A;  3DSL A;  4G9L A;  3CKI A;  3KEC A;  1YOU A;  3KWV C;  4IJO A;  4PKQ A;  4JIJ A;  3USN A;  4HX3 A;  3LIK A;  1GKC A;  2J0T A;  4A7B A;  4I03 A;  1JAP A;  2OXZ A;  3TVC A;  1ZS0 A;  1OM6 A;  2CKI A;  4H82 A;  2MZH A;  3L0V A;  2OZR A;  4H3X A;  4JPA A;  1JK3 A;  1GE7 A;  2W14 A;  3LGP A;  1JKY A;  1BKC I;  1HY7 A;  1QIB A;  2RJQ A;  4L6T A;  1JAN A;  3KEK A;  2D1N A;  4L19 A;  2DW2 A;  4PKS A;  3F16 A;  5CUH A;  3DWB A;  1MMP A;  1BQO A;  3G5C A;  2MLR A;  3EDH A;  3B2Z A;  4FXY P;  3F18 A;  3ZVS A;  1R55 A;  3EHX A;  3LUN A;  1IAA A;  1A86 A;  1SRP A;  2OW0 A;  1BKC E;  4WK7 A;  5B5O A;  4ZR5 A;  2FV9 A;  1IAC A;  3O64 A;  3LE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...