2OXZA

Human mmp-12 in complex with two peptides pqg and iag
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Snapshots of the reaction mechanism of matrix metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2oxzA00
3L0VA 2DW2A 4I03A 5I12A 4IJOA 2USNA 2W15A 1Z3JA 2JSDA 1BZSA 4WK7A 1PWPA 4AUOA 3EDIA 2Y6DA 4ZR5A 1CQRA 4Q1LA 1YQYA 4H49A 4FXYP 1IAEA 1SMPA 4AIGA 4XCTA 456CA 1HFSA 1SATA 5BOTA 966CA 1EB6A 2OI0A 1D7XA 1OO9A 5CZMA 3DL1A 2K2GA 1OS2A 3L0TA 2OW9A 1KUHA 1IABA 1GXDA 3LK8A 4DPEA 4PKVA 1ZVXA 2XS3A 3HB2P 3LQ0A 5L7FA 3EDZA 1G12A 3DNGA 1MNCA 3N2VA 1H71P 4AXQA 4G9LA 1XFWA 2MLRA 3EHYA 2X3CA 2W14A 2OW1A 3B8ZA 5I4OA 3KRYA 1JK3A 1ZP5A 2DW1A 1XFVA 1QIAA 1JIZA 3LGPA 3ELMA 5I2ZA 1FLSA 5D3CA 1DTHA 2XS4A 3BA0A 4PKRA 2OY2A 3TVCA 4WF6A 1CK7A 1MMQA 1PWVA 5CUHA 1CGEA 2POJA 1HV5A 1JIWP 1CAQA 2N8RA 3KMEA 1UMSA 3LIRA 3DSLA 2OVXA 1C3IA 4JPAA 1MMBA 3LMCA 3ZUKA 4HMAA 1D8FA 1K7QA 1K7IA 2OW0A 4J4MA 3EDHA 2A8HA 1BKCE 4PKUA 1IAAA 3DPEA 1HY7A 1K7GA 2PJTA 1D8MA 2D1NA 4FVLA 3LJGA 3EWJA 2TCLA 2W12A 1EAKA 1BUDA 4XM7A 2YIGA 4H30A 4QKZA 1L6JA 3LUMA 4H2EA 3LQBA 4L6TA 3CKIA 1CGFA 1KUFA 1G49A 1A85A 1QJIA 1ZXVA 4WZVA 2DDFA 1ND1A 2EROA 1QJJA 1OMJA 4GF1A 3OHLA 2OY4A 4H84A 1FBLA 1XFZA 3N2UA 5CXAA 2X3AA 4H76A 3HY7A 4R3VA 1BM6A 2MLSA 1WNIA 4DV8A 3LUNA 1HTDA 3P1VA 1AYKA 1R1IA 3NX7A 4XBHA 1R54A 4FU4A 4WKIA 4A7BA 1UTZA 3USNA 2WOAA 4HX3A 2ERPA 1ZXCA 4PKSA 3F1AA 1G9KA 3EHXA 1YOUA 1JJ9A 3K7NA 3LIKA 3LILA 1UTTA 2FV9A 1XFYA 4GWMA 5JMYA 4H82A 3LJTA 4ON1A 1YCMA 1R1HA 3SHIA 3WV2A 1JAQA 4G0DA 4IUWA 1HOVA 1I1IP 1Q3AA 3RTTA 1GO7P 2AIGP 1GE7A 2Y6CA 1YP1A 3DPFA 1MMRA 4JA1A 3F16A 3WV1A 2O3EA 4GQLA 5D1TA 5B5OA 3UVCA 3I7IA 2YB9A 3GBOA 5I43A 1RMZA 3MA2A 1DMTA 1XUCA 1D5JA 5BOYA 2WO9A 3AYUA 1C7KA 4JIJA 2QPJA 1ZS0A 1Y0VA 4PKWA 1GE5A 2SRTA 3RTSA 1S4BP 1ROSA 1RM8A 1SU3A 1Y8JA 2CKIA 1BQOA 4GUYA 4WKEA 3ZVSA 1OM6A 3AYKA 2O36A 5I3MA 3HYGA 2DW0A 2K9CA 1OM7A 3VI1A 3F19A 3G42A 4PKTA 3KEJA 4GWNA 1B8YA 2Z2DA 2RJQA 3F17A 3DWBA 4I35A 5BPAA 1CXVA 3TS4A 3O64A 1BQQM 4JQGA 5L79A 1UMTA 1SRPA 1XURA 3TT4A 2I47A 1ZTQA 1BSWA 2RJPA 5D1SA 3HY9A 2OXZA 3LJZA 4JP4A 1GKCA 3HDBA 4XM8A 3LE9A 1O0QA 2KRJA 4ILWD 4DD8A 3LKAA 1KUIA 1QICA 4EFSA 1Y93A 1USNA 3HBUP 1OM8A 1J7NA 3KHIA 3TSKA 4PKQA 1PWQA 1KUKA 4AYKA 1XFXA 4H3XA 1BIWA 1PWWA 3E8RA 4FXQA 3VTGA 5LABA 1KAPP 3AIGA 3U1RA 2HU6A 2ERQA 1B3DA 3K7LA 1JAOA 4A3WA 2J83A 1GKDA 1ASTA 3V96B 2AYKA 3F15A 5H8XA 4GR3A 1XUDA 3F18A 2D1OA 1IADA 1IACA 1CIZA 1QUAA 3G5CA 2DDYA 5B5PA 3I7GA 2E2DA 3KECA 2JIHA 1I73A 2OW2A 1BKCA 1GE6A 1BUVM 2X3BA 4GR0A 1AKLA 3Q2HA 5D2BA 1MMPA 3EDGA 3P24A 4XM6A 3Q2GA 2OVZA 3LEAA 2JT5A 4L63A 1PWUA 1AF0A 1FM1A 2L0RA 2J0TA 3HDAP 2CLTA 1R1JA 2FV5A 3B2ZA 1I76A 1C8TA 4DF9A 1JANA 1O0TA 3KEKA 2JNPA 2W0DA 5I0LA 3O2XA 4H1QA 3ZXHA 2X7MA 3WV3A 1IAGA 1SLMA 2OZRA 830CA 1EUBA 3HBVP 1GO8P 1QIBA 2V4BA 2WO8A 4CTHA 4L19A 5D7WA 3B92A 1KUGA 1XFUA 1BKCI 4IN9A 1JKYA 2MZIA 1G4KA 1CGLA 1HFCA 1G05A 1UEAA 2E3XA 2OXWA 1JAPA 3KWVC 5D1UA 4GR8A 1OS9A 2MZEA 2W13A 1A86A 2MZHA 2JT6A 3KMCA 1JH1A 1SLNA 3OHOA 1ATLA 1KBCA 1R55A 2OXUA
chains in the Genus database with same CATH superfamily
3L0VA 2DW2A 4I03A 5I12A 4IJOA 2USNA 2W15A 1Z3JA 2JSDA 1BZSA 4WK7A 1PWPA 4AUOA 3EDIA 2YUFA 2Y6DA 4ZR5A 1CQRA 4Q1LA 1YQYA 4H49A 4FXYP 1IAEA 1SMPA 4AIGA 4XCTA 456CA 1HFSA 1SATA 5BOTA 966CA 1EB6A 2OI0A 1D7XA 1OO9A 5CZMA 3DL1A 2K2GA 1OS2A 3L0TA 2OW9A 1KUHA 1IABA 1GXDA 3LK8A 4DPEA 4PKVA 1ZVXA 2XS3A 3HB2P 3LQ0A 5L7FA 3EDZA 1G12A 3DNGA 1MNCA 3N2VA 1H71P 4AXQA 4G9LA 1XFWA 2MLRA 3EHYA 2X3CA 2W14A 2OW1A 3B8ZA 5I4OA 3KRYA 1JK3A 1ZP5A 2DW1A 1XAXA 1XFVA 1QIAA 1JIZA 3LGPA 3ELMA 5I2ZA 1FLSA 5D3CA 1DTHA 2XS4A 3BA0A 4PKRA 2OY2A 3TVCA 4WF6A 1CK7A 1MMQA 1PWVA 5CUHA 1CGEA 2POJA 1HV5A 1JIWP 1CAQA 2N8RA 3KMEA 1UMSA 3LIRA 3DSLA 2OVXA 1C3IA 4JPAA 1MMBA 3LMCA 3ZUKA 4HMAA 1D8FA 1K7QA 1K7IA 2OW0A 4J4MA 3EDHA 2A8HA 1BKCE 4PKUA 1IAAA 3DPEA 1HY7A 1K7GA 2PJTA 1D8MA 2D1NA 4FVLA 3LJGA 3EWJA 2TCLA 2W12A 1EAKA 1BUDA 4XM7A 2YIGA 4H30A 4QKZA 1L6JA 3LUMA 4H2EA 3LQBA 4L6TA 3CKIA 1CGFA 1KUFA 1G49A 1A85A 1QJIA 1ZXVA 4WZVA 2DDFA 1ND1A 2EROA 1QJJA 1OMJA 4GF1A 3OHLA 2OY4A 4H84A 1FBLA 1XFZA 3N2UA 5CXAA 2X3AA 4H76A 3HY7A 4R3VA 1BM6A 2MLSA 1WNIA 4DV8A 3LUNA 1HTDA 3P1VA 1AYKA 1R1IA 3NX7A 4XBHA 1R54A 4FU4A 4WKIA 4A7BA 1UTZA 3USNA 2WOAA 4HX3A 2ERPA 1ZXCA 4PKSA 3F1AA 1G9KA 3EHXA 1OZ9A 1YOUA 1JJ9A 3K7NA 3LIKA 3LILA 1UTTA 2FV9A 1XFYA 4GWMA 5JMYA 4H82A 3LJTA 4ON1A 1YCMA 1R1HA 3SHIA 3WV2A 1JAQA 4G0DA 4IUWA 1HOVA 1I1IP 1Q3AA 3RTTA 1GO7P 2AIGP 1GE7A 2Y6CA 1YP1A 3DPFA 1MMRA 4JA1A 3F16A 3WV1A 2O3EA 4GQLA 5D1TA 5B5OA 3UVCA 3I7IA 2YB9A 3GBOA 5I43A 1RMZA 3MA2A 1DMTA 1XUCA 1D5JA 5BOYA 2WO9A 3AYUA 1C7KA 4JIJA 2QPJA 1ZS0A 1Y0VA 4PKWA 1GE5A 2SRTA 3RTSA 1S4BP 1ROSA 1RM8A 1SU3A 1Y8JA 2CKIA 1BQOA 4GUYA 4WKEA 3ZVSA 1OM6A 3AYKA 2O36A 5I3MA 3DTKA 3HYGA 2DW0A 2K9CA 1OM7A 3VI1A 3F19A 3G42A 4PKTA 3KEJA 4GWNA 1B8YA 2Z2DA 2RJQA 3F17A 3DWBA 4I35A 5BPAA 1CXVA 3TS4A 3DTEA 3O64A 1BQQM 4JQGA 5L79A 1UMTA 1SRPA 1XURA 3TT4A 2I47A 1ZTQA 1BSWA 2RJPA 5D1SA 3HY9A 2OXZA 3LJZA 4JP4A 1GKCA 3HDBA 4XM8A 3LE9A 1O0QA 2KRJA 4ILWD 4DD8A 3LKAA 1KUIA 1QICA 4EFSA 1Y93A 1USNA 3HBUP 1OM8A 1J7NA 3KHIA 3TSKA 4PKQA 1PWQA 1KUKA 4AYKA 1XFXA 4H3XA 1BIWA 1PWWA 3E8RA 4FXQA 3VTGA 5LABA 1KAPP 3AIGA 3U1RA 2HU6A 2ERQA 1B3DA 3K7LA 1JAOA 4A3WA 2J83A 1GKDA 1ASTA 3V96B 2AYKA 3F15A 5H8XA 4GR3A 1XUDA 3F18A 1TVIA 2D1OA 1IADA 1IACA 1CIZA 1QUAA 3G5CA 2DDYA 1XM5A 5B5PA 3I7GA 2E2DA 3KECA 2JIHA 1I73A 2OW2A 1BKCA 1GE6A 1BUVM 2X3BA 4GR0A 1AKLA 3Q2HA 5D2BA 1MMPA 3EDGA 3P24A 4XM6A 3Q2GA 2OVZA 3LEAA 2JT5A 4L63A 1PWUA 1AF0A 1FM1A 2L0RA 2J0TA 3HDAP 2CLTA 1R1JA 2FV5A 3B2ZA 1I76A 1C8TA 3DTIA 4DF9A 1JANA 1O0TA 3KEKA 2JNPA 2W0DA 5I0LA 3O2XA 4H1QA 3ZXHA 2X7MA 3WV3A 1IAGA 1SLMA 2OZRA 830CA 1EUBA 3HBVP 1GO8P 1QIBA 2V4BA 2WO8A 4CTHA 4L7AA 4L19A 5D7WA 3B92A 1KUGA 1XFUA 1BKCI 4IN9A 1JKYA 2MZIA 1G4KA 1CGLA 1HFCA 1G05A 1UEAA 2E3XA 2OXWA 1JAPA 3KWVC 5D1UA 4GR8A 1OS9A 2MZEA 2W13A 1A86A 2MZHA 2JT6A 3KMCA 1JH1A 1SLNA 3OHOA 1ATLA 1KBCA 1R55A 2OXUA
chains in the Genus database with same CATH topology
3L0VA 2DW2A 4I03A 5I12A 4IJOA 2USNA 2W15A 1Z3JA 2JSDA 1BZSA 4WK7A 1PWPA 4AUOA 3EDIA 2YUFA 2Y6DA 4ZR5A 1CQRA 4Q1LA 1YQYA 4H49A 4FXYP 1IAEA 1SMPA 4AIGA 4XCTA 456CA 1HFSA 1SATA 5BOTA 966CA 1EB6A 2OI0A 1D7XA 1OO9A 5CZMA 3DL1A 2K2GA 1OS2A 3L0TA 2OW9A 1KUHA 1IABA 1GXDA 3LK8A 4DPEA 4PKVA 1ZVXA 2XS3A 3HB2P 3LQ0A 5L7FA 3EDZA 1G12A 3DNGA 1MNCA 3N2VA 1H71P 4AXQA 4G9LA 1XFWA 2MLRA 3EHYA 2X3CA 2W14A 2OW1A 3B8ZA 5I4OA 3KRYA 1JK3A 1ZP5A 2DW1A 1XFVA 1QIAA 1JIZA 3LGPA 3ELMA 5I2ZA 1FLSA 5D3CA 1DTHA 2XS4A 3BA0A 4PKRA 2OY2A 3TVCA 4WF6A 1CK7A 1MMQA 1PWVA 5CUHA 1CGEA 2POJA 1HV5A 1JIWP 1CAQA 2N8RA 3KMEA 1UMSA 3LIRA 3DSLA 2OVXA 1C3IA 4JPAA 1MMBA 3LMCA 3ZUKA 4HMAA 1D8FA 1K7QA 1K7IA 2OW0A 4J4MA 3EDHA 2A8HA 1BKCE 4PKUA 1IAAA 3DPEA 1HY7A 1K7GA 2PJTA 1D8MA 2D1NA 4FVLA 3LJGA 3EWJA 2TCLA 2W12A 1EAKA 1BUDA 4XM7A 2YIGA 4H30A 4QKZA 1L6JA 3LUMA 4H2EA 3LQBA 4L6TA 3CKIA 1CGFA 1KUFA 1G49A 1A85A 1QJIA 1ZXVA 4WZVA 2DDFA 1ND1A 2EROA 1QJJA 1OMJA 4GF1A 3OHLA 2OY4A 4H84A 1FBLA 1XFZA 3N2UA 5CXAA 2X3AA 4H76A 3HY7A 4R3VA 1BM6A 2MLSA 1WNIA 4DV8A 3LUNA 1HTDA 3P1VA 1AYKA 1R1IA 3NX7A 4XBHA 1R54A 4FU4A 4WKIA 4A7BA 1UTZA 3USNA 2WOAA 4HX3A 2ERPA 1ZXCA 4PKSA 3F1AA 1G9KA 3EHXA 1YOUA 1JJ9A 3K7NA 3LIKA 3LILA 1UTTA 2FV9A 1XFYA 4GWMA 5JMYA 4H82A 3LJTA 4ON1A 1YCMA 1R1HA 3SHIA 3WV2A 1JAQA 4G0DA 4IUWA 1HOVA 1I1IP 1Q3AA 3RTTA 1GO7P 2AIGP 1GE7A 2Y6CA 1YP1A 3DPFA 1MMRA 4JA1A 3F16A 3WV1A 2O3EA 4GQLA 5D1TA 5B5OA 3UVCA 3I7IA 2YB9A 3GBOA 5I43A 1RMZA 3MA2A 1DMTA 1XUCA 1D5JA 5BOYA 2WO9A 3AYUA 1C7KA 4JIJA 2QPJA 1ZS0A 1Y0VA 4PKWA 1GE5A 2SRTA 3RTSA 1S4BP 1ROSA 1RM8A 1SU3A 1Y8JA 2CKIA 1BQOA 4GUYA 4WKEA 3ZVSA 1OM6A 3AYKA 2O36A 5I3MA 3DTKA 3HYGA 2DW0A 2K9CA 1OM7A 3VI1A 3F19A 3G42A 4PKTA 3KEJA 4GWNA 1B8YA 2Z2DA 2RJQA 3F17A 3DWBA 4I35A 5BPAA 1CXVA 3TS4A 3DTEA 3O64A 1BQQM 4JQGA 5L79A 1UMTA 1SRPA 1XURA 3TT4A 2I47A 1ZTQA 1BSWA 2RJPA 5D1SA 3HY9A 2OXZA 3LJZA 4JP4A 1GKCA 3HDBA 4XM8A 3LE9A 1O0QA 2KRJA 4ILWD 4DD8A 3LKAA 1KUIA 1QICA 4EFSA 1Y93A 1USNA 3HBUP 1OM8A 1J7NA 3KHIA 3TSKA 4PKQA 1PWQA 1KUKA 4AYKA 1XFXA 4H3XA 1BIWA 1PWWA 3E8RA 4FXQA 3VTGA 5LABA 1KAPP 3AIGA 3U1RA 2HU6A 2ERQA 1B3DA 3K7LA 1JAOA 4A3WA 2J83A 1GKDA 1ASTA 3V96B 2AYKA 3F15A 5H8XA 4GR3A 1XUDA 3F18A 2D1OA 1IADA 1IACA 1CIZA 1QUAA 3G5CA 2DDYA 5B5PA 3I7GA 2E2DA 3KECA 2JIHA 1I73A 2OW2A 1BKCA 1GE6A 1BUVM 2X3BA 4GR0A 1AKLA 3Q2HA 5D2BA 1MMPA 3EDGA 3P24A 4XM6A 3Q2GA 2OVZA 3LEAA 2JT5A 4L63A 1PWUA 1AF0A 1FM1A 2L0RA 2J0TA 3HDAP 2CLTA 1R1JA 2FV5A 3B2ZA 1I76A 1C8TA 3DTIA 4DF9A 1JANA 1O0TA 3KEKA 2JNPA 2W0DA 5I0LA 3O2XA 4H1QA 3ZXHA 2X7MA 3WV3A 1IAGA 1SLMA 2OZRA 830CA 1EUBA 3HBVP 1GO8P 1QIBA 2V4BA 2WO8A 4CTHA 4L7AA 4L19A 5D7WA 3B92A 1KUGA 1XFUA 1BKCI 4IN9A 1JKYA 2MZIA 1G4KA 1CGLA 1HFCA 1G05A 1UEAA 2E3XA 2OXWA 1JAPA 3KWVC 5D1UA 4GR8A 1OS9A 2MZEA 2W13A 1A86A 2MZHA 2JT6A 3KMCA 1JH1A 1SLNA 3OHOA 1ATLA 1KBCA 1R55A 2OXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0V A;  2DW2 A;  4I03 A;  5I12 A;  4IJO A;  2USN A;  2W15 A;  1Z3J A;  2JSD A;  1BZS A;  4WK7 A;  1PWP A;  4AUO A;  3EDI A;  2Y6D A;  4ZR5 A;  1CQR A;  4Q1L A;  1YQY A;  4H49 A;  4FXY P;  1IAE A;  1SMP A;  4AIG A;  4XCT A;  456C A;  1HFS A;  1SAT A;  5BOT A;  966C A;  1EB6 A;  2OI0 A;  1D7X A;  1OO9 A;  5CZM A;  3DL1 A;  2K2G A;  1OS2 A;  3L0T A;  2OW9 A;  1KUH A;  1IAB A;  1GXD A;  3LK8 A;  4DPE A;  4PKV A;  1ZVX A;  2XS3 A;  3HB2 P;  3LQ0 A;  5L7F A;  3EDZ A;  1G12 A;  3DNG A;  1MNC A;  3N2V A;  1H71 P;  4AXQ A;  4G9L A;  1XFW A;  2MLR A;  3EHY A;  2X3C A;  2W14 A;  2OW1 A;  3B8Z A;  5I4O A;  3KRY A;  1JK3 A;  1ZP5 A;  2DW1 A;  1XFV A;  1QIA A;  1JIZ A;  3LGP A;  3ELM A;  5I2Z A;  1FLS A;  5D3C A;  1DTH A;  2XS4 A;  3BA0 A;  4PKR A;  2OY2 A;  3TVC A;  4WF6 A;  1CK7 A;  1MMQ A;  1PWV A;  5CUH A;  1CGE A;  2POJ A;  1HV5 A;  1JIW P;  1CAQ A;  2N8R A;  3KME A;  1UMS A;  3LIR A;  3DSL A;  2OVX A;  1C3I A;  4JPA A;  1MMB A;  3LMC A;  3ZUK A;  4HMA A;  1D8F A;  1K7Q A;  1K7I A;  2OW0 A;  4J4M A;  3EDH A;  2A8H A;  1BKC E;  4PKU A;  1IAA A;  3DPE A;  1HY7 A;  1K7G A;  2PJT A;  1D8M A;  2D1N A;  4FVL A;  3LJG A;  3EWJ A;  2TCL A;  2W12 A;  1EAK A;  1BUD A;  4XM7 A;  2YIG A;  4H30 A;  4QKZ A;  1L6J A;  3LUM A;  4H2E A;  3LQB A;  4L6T A;  3CKI A;  1CGF A;  1KUF A;  1G49 A;  1A85 A;  1QJI A;  1ZXV A;  4WZV A;  2DDF A;  1ND1 A;  2ERO A;  1QJJ A;  1OMJ A;  4GF1 A;  3OHL A;  2OY4 A;  4H84 A;  1FBL A;  1XFZ A;  3N2U A;  5CXA A;  2X3A A;  4H76 A;  3HY7 A;  4R3V A;  1BM6 A;  2MLS A;  1WNI A;  4DV8 A;  3LUN A;  1HTD A;  3P1V A;  1AYK A;  1R1I A;  3NX7 A;  4XBH A;  1R54 A;  4FU4 A;  4WKI A;  4A7B A;  1UTZ A;  3USN A;  2WOA A;  4HX3 A;  2ERP A;  1ZXC A;  4PKS A;  3F1A A;  1G9K A;  3EHX A;  1YOU A;  1JJ9 A;  3K7N A;  3LIK A;  3LIL A;  1UTT A;  2FV9 A;  1XFY A;  4GWM A;  5JMY A;  4H82 A;  3LJT A;  4ON1 A;  1YCM A;  1R1H A;  3SHI A;  3WV2 A;  1JAQ A;  4G0D A;  4IUW A;  1HOV A;  1I1I P;  1Q3A A;  3RTT A;  1GO7 P;  2AIG P;  1GE7 A;  2Y6C A;  1YP1 A;  3DPF A;  1MMR A;  4JA1 A;  3F16 A;  3WV1 A;  2O3E A;  4GQL A;  5D1T A;  5B5O A;  3UVC A;  3I7I A;  2YB9 A;  3GBO A;  5I43 A;  1RMZ A;  3MA2 A;  1DMT A;  1XUC A;  1D5J A;  5BOY A;  2WO9 A;  3AYU A;  1C7K A;  4JIJ A;  2QPJ A;  1ZS0 A;  1Y0V A;  4PKW A;  1GE5 A;  2SRT A;  3RTS A;  1S4B P;  1ROS A;  1RM8 A;  1SU3 A;  1Y8J A;  2CKI A;  1BQO A;  4GUY A;  4WKE A;  3ZVS A;  1OM6 A;  3AYK A;  2O36 A;  5I3M A;  3HYG A;  2DW0 A;  2K9C A;  1OM7 A;  3VI1 A;  3F19 A;  3G42 A;  4PKT A;  3KEJ A;  4GWN A;  1B8Y A;  2Z2D A;  2RJQ A;  3F17 A;  3DWB A;  4I35 A;  5BPA A;  1CXV A;  3TS4 A;  3O64 A;  1BQQ M;  4JQG A;  5L79 A;  1UMT A;  1SRP A;  1XUR A;  3TT4 A;  2I47 A;  1ZTQ A;  1BSW A;  2RJP A;  5D1S A;  3HY9 A;  2OXZ A;  3LJZ A;  4JP4 A;  1GKC A;  3HDB A;  4XM8 A;  3LE9 A;  1O0Q A;  2KRJ A;  4ILW D;  4DD8 A;  3LKA A;  1KUI A;  1QIC A;  4EFS A;  1Y93 A;  1USN A;  3HBU P;  1OM8 A;  1J7N A;  3KHI A;  3TSK A;  4PKQ A;  1PWQ A;  1KUK A;  4AYK A;  1XFX A;  4H3X A;  1BIW A;  1PWW A;  3E8R A;  4FXQ A;  3VTG A;  5LAB A;  1KAP P;  3AIG A;  3U1R A;  2HU6 A;  2ERQ A;  1B3D A;  3K7L A;  1JAO A;  4A3W A;  2J83 A;  1GKD A;  1AST A;  3V96 B;  2AYK A;  3F15 A;  5H8X A;  4GR3 A;  1XUD A;  3F18 A;  2D1O A;  1IAD A;  1IAC A;  1CIZ A;  1QUA A;  3G5C A;  2DDY A;  5B5P A;  3I7G A;  2E2D A;  3KEC A;  2JIH A;  1I73 A;  2OW2 A;  1BKC A;  1GE6 A;  1BUV M;  2X3B A;  4GR0 A;  1AKL A;  3Q2H A;  5D2B A;  1MMP A;  3EDG A;  3P24 A;  4XM6 A;  3Q2G A;  2OVZ A;  3LEA A;  2JT5 A;  4L63 A;  1PWU A;  1AF0 A;  1FM1 A;  2L0R A;  2J0T A;  3HDA P;  2CLT A;  1R1J A;  2FV5 A;  3B2Z A;  1I76 A;  1C8T A;  4DF9 A;  1JAN A;  1O0T A;  3KEK A;  2JNP A;  2W0D A;  5I0L A;  3O2X A;  4H1Q A;  3ZXH A;  2X7M A;  3WV3 A;  1IAG A;  1SLM A;  2OZR A;  830C A;  1EUB A;  3HBV P;  1GO8 P;  1QIB A;  2V4B A;  2WO8 A;  4CTH A;  4L19 A;  5D7W A;  3B92 A;  1KUG A;  1XFU A;  1BKC I;  4IN9 A;  1JKY A;  2MZI A;  1G4K A;  1CGL A;  1HFC A;  1G05 A;  1UEA A;  2E3X A;  2OXW A;  1JAP A;  3KWV C;  5D1U A;  4GR8 A;  1OS9 A;  2MZE A;  2W13 A;  1A86 A;  2MZH A;  2JT6 A;  3KMC A;  1JH1 A;  1SLN A;  3OHO A;  1ATL A;  1KBC A;  1R55 A;  2OXU A; 
#chains in the Genus database with same CATH topology
 3L0V A;  2DW2 A;  4I03 A;  5I12 A;  4IJO A;  2USN A;  2W15 A;  1Z3J A;  2JSD A;  1BZS A;  4WK7 A;  1PWP A;  4AUO A;  3EDI A;  2YUF A;  2Y6D A;  4ZR5 A;  1CQR A;  4Q1L A;  1YQY A;  4H49 A;  4FXY P;  1IAE A;  1SMP A;  4AIG A;  4XCT A;  456C A;  1HFS A;  1SAT A;  5BOT A;  966C A;  1EB6 A;  2OI0 A;  1D7X A;  1OO9 A;  5CZM A;  3DL1 A;  2K2G A;  1OS2 A;  3L0T A;  2OW9 A;  1KUH A;  1IAB A;  1GXD A;  3LK8 A;  4DPE A;  4PKV A;  1ZVX A;  2XS3 A;  3HB2 P;  3LQ0 A;  5L7F A;  3EDZ A;  1G12 A;  3DNG A;  1MNC A;  3N2V A;  1H71 P;  4AXQ A;  4G9L A;  1XFW A;  2MLR A;  3EHY A;  2X3C A;  2W14 A;  2OW1 A;  3B8Z A;  5I4O A;  3KRY A;  1JK3 A;  1ZP5 A;  2DW1 A;  1XAX A;  1XFV A;  1QIA A;  1JIZ A;  3LGP A;  3ELM A;  5I2Z A;  1FLS A;  5D3C A;  1DTH A;  2XS4 A;  3BA0 A;  4PKR A;  2OY2 A;  3TVC A;  4WF6 A;  1CK7 A;  1MMQ A;  1PWV A;  5CUH A;  1CGE A;  2POJ A;  1HV5 A;  1JIW P;  1CAQ A;  2N8R A;  3KME A;  1UMS A;  3LIR A;  3DSL A;  2OVX A;  1C3I A;  4JPA A;  1MMB A;  3LMC A;  3ZUK A;  4HMA A;  1D8F A;  1K7Q A;  1K7I A;  2OW0 A;  4J4M A;  3EDH A;  2A8H A;  1BKC E;  4PKU A;  1IAA A;  3DPE A;  1HY7 A;  1K7G A;  2PJT A;  1D8M A;  2D1N A;  4FVL A;  3LJG A;  3EWJ A;  2TCL A;  2W12 A;  1EAK A;  1BUD A;  4XM7 A;  2YIG A;  4H30 A;  4QKZ A;  1L6J A;  3LUM A;  4H2E A;  3LQB A;  4L6T A;  3CKI A;  1CGF A;  1KUF A;  1G49 A;  1A85 A;  1QJI A;  1ZXV A;  4WZV A;  2DDF A;  1ND1 A;  2ERO A;  1QJJ A;  1OMJ A;  4GF1 A;  3OHL A;  2OY4 A;  4H84 A;  1FBL A;  1XFZ A;  3N2U A;  5CXA A;  2X3A A;  4H76 A;  3HY7 A;  4R3V A;  1BM6 A;  2MLS A;  1WNI A;  4DV8 A;  3LUN A;  1HTD A;  3P1V A;  1AYK A;  1R1I A;  3NX7 A;  4XBH A;  1R54 A;  4FU4 A;  4WKI A;  4A7B A;  1UTZ A;  3USN A;  2WOA A;  4HX3 A;  2ERP A;  1ZXC A;  4PKS A;  3F1A A;  1G9K A;  3EHX A;  1OZ9 A;  1YOU A;  1JJ9 A;  3K7N A;  3LIK A;  3LIL A;  1UTT A;  2FV9 A;  1XFY A;  4GWM A;  5JMY A;  4H82 A;  3LJT A;  4ON1 A;  1YCM A;  1R1H A;  3SHI A;  3WV2 A;  1JAQ A;  4G0D A;  4IUW A;  1HOV A;  1I1I P;  1Q3A A;  3RTT A;  1GO7 P;  2AIG P;  1GE7 A;  2Y6C A;  1YP1 A;  3DPF A;  1MMR A;  4JA1 A;  3F16 A;  3WV1 A;  2O3E A;  4GQL A;  5D1T A;  5B5O A;  3UVC A;  3I7I A;  2YB9 A;  3GBO A;  5I43 A;  1RMZ A;  3MA2 A;  1DMT A;  1XUC A;  1D5J A;  5BOY A;  2WO9 A;  3AYU A;  1C7K A;  4JIJ A;  2QPJ A;  1ZS0 A;  1Y0V A;  4PKW A;  1GE5 A;  2SRT A;  3RTS A;  1S4B P;  1ROS A;  1RM8 A;  1SU3 A;  1Y8J A;  2CKI A;  1BQO A;  4GUY A;  4WKE A;  3ZVS A;  1OM6 A;  3AYK A;  2O36 A;  5I3M A;  3DTK A;  3HYG A;  2DW0 A;  2K9C A;  1OM7 A;  3VI1 A;  3F19 A;  3G42 A;  4PKT A;  3KEJ A;  4GWN A;  1B8Y A;  2Z2D A;  2RJQ A;  3F17 A;  3DWB A;  4I35 A;  5BPA A;  1CXV A;  3TS4 A;  3DTE A;  3O64 A;  1BQQ M;  4JQG A;  5L79 A;  1UMT A;  1SRP A;  1XUR A;  3TT4 A;  2I47 A;  1ZTQ A;  1BSW A;  2RJP A;  5D1S A;  3HY9 A;  2OXZ A;  3LJZ A;  4JP4 A;  1GKC A;  3HDB A;  4XM8 A;  3LE9 A;  1O0Q A;  2KRJ A;  4ILW D;  4DD8 A;  3LKA A;  1KUI A;  1QIC A;  4EFS A;  1Y93 A;  1USN A;  3HBU P;  1OM8 A;  1J7N A;  3KHI A;  3TSK A;  4PKQ A;  1PWQ A;  1KUK A;  4AYK A;  1XFX A;  4H3X A;  1BIW A;  1PWW A;  3E8R A;  4FXQ A;  3VTG A;  5LAB A;  1KAP P;  3AIG A;  3U1R A;  2HU6 A;  2ERQ A;  1B3D A;  3K7L A;  1JAO A;  4A3W A;  2J83 A;  1GKD A;  1AST A;  3V96 B;  2AYK A;  3F15 A;  5H8X A;  4GR3 A;  1XUD A;  3F18 A;  1TVI A;  2D1O A;  1IAD A;  1IAC A;  1CIZ A;  1QUA A;  3G5C A;  2DDY A;  1XM5 A;  5B5P A;  3I7G A;  2E2D A;  3KEC A;  2JIH A;  1I73 A;  2OW2 A;  1BKC A;  1GE6 A;  1BUV M;  2X3B A;  4GR0 A;  1AKL A;  3Q2H A;  5D2B A;  1MMP A;  3EDG A;  3P24 A;  4XM6 A;  3Q2G A;  2OVZ A;  3LEA A;  2JT5 A;  4L63 A;  1PWU A;  1AF0 A;  1FM1 A;  2L0R A;  2J0T A;  3HDA P;  2CLT A;  1R1J A;  2FV5 A;  3B2Z A;  1I76 A;  1C8T A;  3DTI A;  4DF9 A;  1JAN A;  1O0T A;  3KEK A;  2JNP A;  2W0D A;  5I0L A;  3O2X A;  4H1Q A;  3ZXH A;  2X7M A;  3WV3 A;  1IAG A;  1SLM A;  2OZR A;  830C A;  1EUB A;  3HBV P;  1GO8 P;  1QIB A;  2V4B A;  2WO8 A;  4CTH A;  4L7A A;  4L19 A;  5D7W A;  3B92 A;  1KUG A;  1XFU A;  1BKC I;  4IN9 A;  1JKY A;  2MZI A;  1G4K A;  1CGL A;  1HFC A;  1G05 A;  1UEA A;  2E3X A;  2OXW A;  1JAP A;  3KWV C;  5D1U A;  4GR8 A;  1OS9 A;  2MZE A;  2W13 A;  1A86 A;  2MZH A;  2JT6 A;  3KMC A;  1JH1 A;  1SLN A;  3OHO A;  1ATL A;  1KBC A;  1R55 A;  2OXU A; 
#chains in the Genus database with same CATH homology
 3L0V A;  2DW2 A;  4I03 A;  5I12 A;  4IJO A;  2USN A;  2W15 A;  1Z3J A;  2JSD A;  1BZS A;  4WK7 A;  1PWP A;  4AUO A;  3EDI A;  2YUF A;  2Y6D A;  4ZR5 A;  1CQR A;  4Q1L A;  1YQY A;  4H49 A;  4FXY P;  1IAE A;  1SMP A;  4AIG A;  4XCT A;  456C A;  1HFS A;  1SAT A;  5BOT A;  966C A;  1EB6 A;  2OI0 A;  1D7X A;  1OO9 A;  5CZM A;  3DL1 A;  2K2G A;  1OS2 A;  3L0T A;  2OW9 A;  1KUH A;  1IAB A;  1GXD A;  3LK8 A;  4DPE A;  4PKV A;  1ZVX A;  2XS3 A;  3HB2 P;  3LQ0 A;  5L7F A;  3EDZ A;  1G12 A;  3DNG A;  1MNC A;  3N2V A;  1H71 P;  4AXQ A;  4G9L A;  1XFW A;  2MLR A;  3EHY A;  2X3C A;  2W14 A;  2OW1 A;  3B8Z A;  5I4O A;  3KRY A;  1JK3 A;  1ZP5 A;  2DW1 A;  1XFV A;  1QIA A;  1JIZ A;  3LGP A;  3ELM A;  5I2Z A;  1FLS A;  5D3C A;  1DTH A;  2XS4 A;  3BA0 A;  4PKR A;  2OY2 A;  3TVC A;  4WF6 A;  1CK7 A;  1MMQ A;  1PWV A;  5CUH A;  1CGE A;  2POJ A;  1HV5 A;  1JIW P;  1CAQ A;  2N8R A;  3KME A;  1UMS A;  3LIR A;  3DSL A;  2OVX A;  1C3I A;  4JPA A;  1MMB A;  3LMC A;  3ZUK A;  4HMA A;  1D8F A;  1K7Q A;  1K7I A;  2OW0 A;  4J4M A;  3EDH A;  2A8H A;  1BKC E;  4PKU A;  1IAA A;  3DPE A;  1HY7 A;  1K7G A;  2PJT A;  1D8M A;  2D1N A;  4FVL A;  3LJG A;  3EWJ A;  2TCL A;  2W12 A;  1EAK A;  1BUD A;  4XM7 A;  2YIG A;  4H30 A;  4QKZ A;  1L6J A;  3LUM A;  4H2E A;  3LQB A;  4L6T A;  3CKI A;  1CGF A;  1KUF A;  1G49 A;  1A85 A;  1QJI A;  1ZXV A;  4WZV A;  2DDF A;  1ND1 A;  2ERO A;  1QJJ A;  1OMJ A;  4GF1 A;  3OHL A;  2OY4 A;  4H84 A;  1FBL A;  1XFZ A;  3N2U A;  5CXA A;  2X3A A;  4H76 A;  3HY7 A;  4R3V A;  1BM6 A;  2MLS A;  1WNI A;  4DV8 A;  3LUN A;  1HTD A;  3P1V A;  1AYK A;  1R1I A;  3NX7 A;  4XBH A;  1R54 A;  4FU4 A;  4WKI A;  4A7B A;  1UTZ A;  3USN A;  2WOA A;  4HX3 A;  2ERP A;  1ZXC A;  4PKS A;  3F1A A;  1G9K A;  3EHX A;  1YOU A;  1JJ9 A;  3K7N A;  3LIK A;  3LIL A;  1UTT A;  2FV9 A;  1XFY A;  4GWM A;  5JMY A;  4H82 A;  3LJT A;  4ON1 A;  1YCM A;  1R1H A;  3SHI A;  3WV2 A;  1JAQ A;  4G0D A;  4IUW A;  1HOV A;  1I1I P;  1Q3A A;  3RTT A;  1GO7 P;  2AIG P;  1GE7 A;  2Y6C A;  1YP1 A;  3DPF A;  1MMR A;  4JA1 A;  3F16 A;  3WV1 A;  2O3E A;  4GQL A;  5D1T A;  5B5O A;  3UVC A;  3I7I A;  2YB9 A;  3GBO A;  5I43 A;  1RMZ A;  3MA2 A;  1DMT A;  1XUC A;  1D5J A;  5BOY A;  2WO9 A;  3AYU A;  1C7K A;  4JIJ A;  2QPJ A;  1ZS0 A;  1Y0V A;  4PKW A;  1GE5 A;  2SRT A;  3RTS A;  1S4B P;  1ROS A;  1RM8 A;  1SU3 A;  1Y8J A;  2CKI A;  1BQO A;  4GUY A;  4WKE A;  3ZVS A;  1OM6 A;  3AYK A;  2O36 A;  5I3M A;  3DTK A;  3HYG A;  2DW0 A;  2K9C A;  1OM7 A;  3VI1 A;  3F19 A;  3G42 A;  4PKT A;  3KEJ A;  4GWN A;  1B8Y A;  2Z2D A;  2RJQ A;  3F17 A;  3DWB A;  4I35 A;  5BPA A;  1CXV A;  3TS4 A;  3DTE A;  3O64 A;  1BQQ M;  4JQG A;  5L79 A;  1UMT A;  1SRP A;  1XUR A;  3TT4 A;  2I47 A;  1ZTQ A;  1BSW A;  2RJP A;  5D1S A;  3HY9 A;  2OXZ A;  3LJZ A;  4JP4 A;  1GKC A;  3HDB A;  4XM8 A;  3LE9 A;  1O0Q A;  2KRJ A;  4ILW D;  4DD8 A;  3LKA A;  1KUI A;  1QIC A;  4EFS A;  1Y93 A;  1USN A;  3HBU P;  1OM8 A;  1J7N A;  3KHI A;  3TSK A;  4PKQ A;  1PWQ A;  1KUK A;  4AYK A;  1XFX A;  4H3X A;  1BIW A;  1PWW A;  3E8R A;  4FXQ A;  3VTG A;  5LAB A;  1KAP P;  3AIG A;  3U1R A;  2HU6 A;  2ERQ A;  1B3D A;  3K7L A;  1JAO A;  4A3W A;  2J83 A;  1GKD A;  1AST A;  3V96 B;  2AYK A;  3F15 A;  5H8X A;  4GR3 A;  1XUD A;  3F18 A;  2D1O A;  1IAD A;  1IAC A;  1CIZ A;  1QUA A;  3G5C A;  2DDY A;  5B5P A;  3I7G A;  2E2D A;  3KEC A;  2JIH A;  1I73 A;  2OW2 A;  1BKC A;  1GE6 A;  1BUV M;  2X3B A;  4GR0 A;  1AKL A;  3Q2H A;  5D2B A;  1MMP A;  3EDG A;  3P24 A;  4XM6 A;  3Q2G A;  2OVZ A;  3LEA A;  2JT5 A;  4L63 A;  1PWU A;  1AF0 A;  1FM1 A;  2L0R A;  2J0T A;  3HDA P;  2CLT A;  1R1J A;  2FV5 A;  3B2Z A;  1I76 A;  1C8T A;  3DTI A;  4DF9 A;  1JAN A;  1O0T A;  3KEK A;  2JNP A;  2W0D A;  5I0L A;  3O2X A;  4H1Q A;  3ZXH A;  2X7M A;  3WV3 A;  1IAG A;  1SLM A;  2OZR A;  830C A;  1EUB A;  3HBV P;  1GO8 P;  1QIB A;  2V4B A;  2WO8 A;  4CTH A;  4L7A A;  4L19 A;  5D7W A;  3B92 A;  1KUG A;  1XFU A;  1BKC I;  4IN9 A;  1JKY A;  2MZI A;  1G4K A;  1CGL A;  1HFC A;  1G05 A;  1UEA A;  2E3X A;  2OXW A;  1JAP A;  3KWV C;  5D1U A;  4GR8 A;  1OS9 A;  2MZE A;  2W13 A;  1A86 A;  2MZH A;  2JT6 A;  3KMC A;  1JH1 A;  1SLN A;  3OHO A;  1ATL A;  1KBC A;  1R55 A;  2OXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...