2OXZA

Human mmp-12 in complex with two peptides pqg and iag
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Snapshots of the reaction mechanism of matrix metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2oxzA00
1GO8P 4JQGA 3AYUA 2W15A 1D5JA 1FLSA 1HV5A 1ZXCA 2I47A 1JAQA 2D1OA 4CTHA 1Y93A 2JIHA 3TSKA 1IABA 3EDHA 1RMZA 4JA1A 4EFSA 3G42A 3HB2P 1L6JA 4PKQA 3OHOA 4XCTA 4H84A 2DDYA 1BKCE 1KUFA 2X7MA 4XM6A 3NX7A 2Y6DA 1CAQA 1KUKA 2K9CA 3WV2A 2W14A 3KMCA 4WKIA 1C8TA 1C7KA 1USNA 1XFXA 1IAGA 2MZIA 5I43A 3U1RA 1IAEA 3KWVC 3F17A 1KBCA 3KEJA 1SATA 4GQLA 1BKCA 5D1UA 1UMSA 5B5PA 5I2ZA 2QPJA 3L0VA 1EUBA 3LJGA 3KMEA 5I12A 4HMAA 2OW1A 1BQQM 2AIGP 2MZHA 1HTDA 3KEKA 4ILWD 5L7FA 3F19A 4DV8A 1OO9A 4FXQA 1R55A 1JJ9A 3I7GA 3LILA 1C3IA 1QIAA 1H71P 4L19A 1R1HA 1PWWA 2WOAA 3USNA 1A86A 1R1IA 2OVZA 3DSLA 1YQYA 3F18A 4ON1A 4WZVA 5D1SA 2OZRA 3DPFA 1XFVA 3K7LA 4R3VA 1XFUA 5CUHA 2CLTA 2MZEA 1G49A 3EWJA 1ZP5A 1PWVA 1KUIA 2JT6A 4AYKA 1Y8JA 4A7BA 4H2EA 4WF6A 2POJA 4AIGA 2JT5A 2OY4A 1OS2A 2JNPA 1XFWA 3O2XA 2W12A 4FVLA 2USNA 2W0DA 4WK7A 3B8ZA 1OM6A 3RTTA 3LEAA 1ROSA 4GR3A 1QUAA 4I03A 3ZXHA 1A85A 1MMQA 5H8XA 5LABA 5BOTA 1R1JA 3HBVP 1OM8A 1SU3A 5BPAA 1GXDA 2Y6CA 3HY9A 2AYKA 1GKDA 1O0TA 3LMCA 5D1TA 3EDIA 3LJZA 2ERQA 3G5CA 4PKRA 4Q1LA 2WO8A 1XURA 1G12A 1MMRA 1BM6A 4JIJA 2O3EA 2DW2A 2OW2A 1BUDA 3E8RA 3F15A 1AF0A 4IUWA 3AYKA 1D8MA 830CA 1IACA 1K7GA 4ZR5A 5I4OA 4XBHA 1I73A 4GR0A 3N2VA 2OXZA 2D1NA 1SRPA 3P24A 3LKAA 3I7IA 1OMJA 1EAKA 3EDZA 5B5OA 1ASTA 2TCLA 1UEAA 2YB9A 2OVXA 966CA 4DD8A 3TS4A 1BKCI 2OI0A 3P1VA 3UVCA 1SLMA 3EHYA 4IJOA 2KRJA 5I0LA 5CXAA 1GE6A 1JAOA 4QKZA 5CZMA 2A8HA 3DWBA 4L6TA 1KUGA 3ZUKA 2FV9A 2PJTA 3EHXA 4JP4A 5D2BA 2W13A 3Q2GA 2RJPA 4H1QA 3LQBA 3SHIA 1D7XA 4L63A 1YP1A 1FBLA 4FU4A 1QICA 1PWUA 4DPEA 1BSWA 3V96B 2YIGA 5I3MA 3HBUP 1B3DA 3LK8A 5BOYA 4PKSA 3N2UA 1O0QA 3EDGA 2OXUA 2J83A 1Y0VA 1AKLA 1I76A 4XM8A 3LIKA 456CA 1WNIA 1Z3JA 1B8YA 1DMTA 1XFYA 1K7QA 4PKTA 1SLNA 1CXVA 4JPAA 1UMTA 1YOUA 1CGFA 1JK3A 4H82A 2MLSA 1JAPA 1DTHA 1ZTQA 1MNCA 3DPEA 3DL1A 1FM1A 1CK7A 3O64A 4AUOA 3LQ0A 1OM7A 1PWPA 2OW9A 2MLRA 1ZVXA 5D3CA 1JIWP 2V4BA 1CQRA 1HFCA 1OS9A 5D7WA 1XUDA 1CGEA 3HY7A 5JMYA 1GE7A 1I1IP 1CIZA 3B2ZA 3LIRA 1IADA 2FV5A 1BIWA 4GWNA 1EB6A 4I35A 4PKWA 3LUNA 1HFSA 1ND1A 1HOVA 1UTTA 4PKUA 4GF1A 1MMPA 1BUVM 4DF9A 1IAAA 1QIBA 1GO7P 3HYGA 3CKIA 1K7IA 3LGPA 5L79A 1R54A 2K2GA 1ZXVA 4XM7A 1GKCA 3KHIA 2DDFA 3F1AA 4H3XA 3ZVSA 3OHLA 4FXYP 2O36A 1ATLA 1G9KA 2OW0A 3GBOA 2CKIA 1HY7A 3WV1A 3HDAP 2L0RA 1PWQA 1J7NA 1XFZA 4H30A 1YCMA 2RJQA 2OXWA 3TVCA 1KUHA 1JKYA 2XS4A 4WKEA 1QJIA 4HX3A 1UTZA 1S4BP 2ERPA 1GE5A 3LJTA 1RM8A 2WO9A 2EROA 2X3AA 2SRTA 3RTSA 1Q3AA 4G0DA 4AXQA 3VI1A 3B92A 4G9LA 1XUCA 4J4MA 3LE9A 4GWMA 2XS3A 2N8RA 1G05A 3VTGA 1ZS0A 1KAPP 3KECA 3DNGA 3HDBA 2OY2A 3F16A 2DW1A 3L0TA 4IN9A 2E3XA 4PKVA 3K7NA 2X3BA 1JIZA 4H76A 3KRYA 1BQOA 3BA0A 2E2DA 4A3WA 2J0TA 1MMBA 1SMPA 1JH1A 3MA2A 1D8FA 1CGLA 3ELMA 2HU6A 3AIGA 1AYKA 3LUMA 2DW0A 2Z2DA 3Q2HA 1JANA 4H49A 1QJJA 4GUYA 1BZSA 4GR8A 3WV3A 1G4KA 3TT4A 2JSDA 2X3CA
chains in the Genus database with same CATH superfamily
1GO8P 4JQGA 3AYUA 2W15A 1D5JA 1FLSA 1HV5A 1ZXCA 2I47A 1JAQA 2D1OA 4CTHA 1Y93A 2JIHA 3TSKA 1IABA 3EDHA 1RMZA 4JA1A 4EFSA 3G42A 3HB2P 1L6JA 4PKQA 3OHOA 4XCTA 4H84A 2DDYA 1BKCE 1KUFA 2X7MA 4XM6A 3NX7A 2Y6DA 1CAQA 1KUKA 2K9CA 3WV2A 2W14A 3KMCA 4WKIA 1C8TA 1C7KA 1USNA 1XFXA 1IAGA 2MZIA 5I43A 3U1RA 1IAEA 3KWVC 3F17A 1KBCA 3KEJA 1SATA 4GQLA 1BKCA 5D1UA 1UMSA 5B5PA 1OZ9A 5I2ZA 2QPJA 3L0VA 1EUBA 3LJGA 3KMEA 5I12A 4HMAA 2OW1A 1BQQM 2AIGP 2MZHA 1HTDA 3KEKA 4ILWD 5L7FA 3F19A 4DV8A 1OO9A 4FXQA 1R55A 1JJ9A 3I7GA 3LILA 1C3IA 1QIAA 1H71P 4L19A 1R1HA 1PWWA 2WOAA 3USNA 1A86A 1R1IA 2OVZA 3DSLA 1YQYA 3F18A 4ON1A 4WZVA 5D1SA 2OZRA 3DPFA 1XFVA 3K7LA 4R3VA 1XFUA 5CUHA 3DTKA 2CLTA 2MZEA 1G49A 3EWJA 1ZP5A 1PWVA 1KUIA 2JT6A 4AYKA 1Y8JA 4A7BA 4H2EA 4WF6A 2POJA 4AIGA 2JT5A 2OY4A 1OS2A 2JNPA 1XFWA 3O2XA 2W12A 4FVLA 2USNA 2W0DA 4WK7A 3B8ZA 1OM6A 3RTTA 3LEAA 1ROSA 4GR3A 1QUAA 4I03A 3ZXHA 1A85A 1MMQA 5H8XA 5LABA 5BOTA 1R1JA 3HBVP 1OM8A 1SU3A 5BPAA 1GXDA 2Y6CA 3HY9A 2AYKA 1GKDA 1O0TA 3LMCA 5D1TA 1TVIA 3EDIA 3LJZA 2ERQA 3G5CA 4PKRA 4Q1LA 4L7AA 2WO8A 1XURA 1G12A 1MMRA 1BM6A 4JIJA 2O3EA 2DW2A 2OW2A 1BUDA 3E8RA 3F15A 1AF0A 4IUWA 3AYKA 2YUFA 1D8MA 830CA 1IACA 1K7GA 4ZR5A 5I4OA 4XBHA 1I73A 4GR0A 3N2VA 2OXZA 2D1NA 1SRPA 3P24A 3LKAA 3I7IA 1OMJA 1EAKA 3EDZA 5B5OA 1ASTA 2TCLA 1UEAA 2YB9A 1XAXA 2OVXA 966CA 4DD8A 3TS4A 1BKCI 2OI0A 3P1VA 3UVCA 1SLMA 3EHYA 4IJOA 2KRJA 5I0LA 5CXAA 1GE6A 1JAOA 4QKZA 5CZMA 2A8HA 3DWBA 4L6TA 1KUGA 3ZUKA 2FV9A 2PJTA 3EHXA 4JP4A 5D2BA 2W13A 3Q2GA 2RJPA 4H1QA 3LQBA 3SHIA 1D7XA 4L63A 1YP1A 1FBLA 4FU4A 1QICA 1PWUA 4DPEA 1BSWA 3V96B 2YIGA 5I3MA 3HBUP 1B3DA 3LK8A 5BOYA 4PKSA 3N2UA 1O0QA 3EDGA 2OXUA 2J83A 1Y0VA 1AKLA 1I76A 4XM8A 3LIKA 456CA 1WNIA 1Z3JA 1B8YA 1DMTA 1XFYA 1K7QA 4PKTA 1SLNA 1CXVA 4JPAA 1UMTA 1YOUA 1CGFA 1JK3A 4H82A 2MLSA 1JAPA 1DTHA 1ZTQA 1MNCA 3DPEA 3DL1A 1FM1A 1CK7A 3O64A 4AUOA 3LQ0A 1OM7A 1PWPA 2OW9A 2MLRA 1ZVXA 5D3CA 1JIWP 2V4BA 1CQRA 1HFCA 1OS9A 5D7WA 1XUDA 3DTEA 1CGEA 3HY7A 5JMYA 1GE7A 1I1IP 1CIZA 3B2ZA 3LIRA 1IADA 2FV5A 1BIWA 4GWNA 1EB6A 4I35A 4PKWA 3LUNA 1HFSA 1ND1A 1HOVA 1UTTA 4PKUA 4GF1A 1MMPA 1BUVM 4DF9A 1IAAA 1QIBA 1GO7P 3HYGA 3CKIA 1K7IA 3LGPA 5L79A 1R54A 2K2GA 1ZXVA 4XM7A 1GKCA 3KHIA 2DDFA 3F1AA 4H3XA 3ZVSA 3OHLA 4FXYP 2O36A 1ATLA 1G9KA 2OW0A 3GBOA 2CKIA 1HY7A 3WV1A 3HDAP 2L0RA 1PWQA 1J7NA 1XFZA 4H30A 1YCMA 2RJQA 2OXWA 3TVCA 1KUHA 1JKYA 2XS4A 4WKEA 1QJIA 4HX3A 1UTZA 1S4BP 1XM5A 2ERPA 1GE5A 3LJTA 1RM8A 2WO9A 2EROA 2X3AA 3DTIA 2SRTA 3RTSA 1Q3AA 4G0DA 4AXQA 3VI1A 3B92A 4G9LA 1XUCA 4J4MA 3LE9A 4GWMA 2XS3A 2N8RA 1G05A 3VTGA 1ZS0A 1KAPP 3KECA 3DNGA 3HDBA 2OY2A 3F16A 2DW1A 3L0TA 4IN9A 2E3XA 4PKVA 3K7NA 2X3BA 1JIZA 4H76A 3KRYA 1BQOA 3BA0A 2E2DA 4A3WA 2J0TA 1MMBA 1SMPA 1JH1A 3MA2A 1D8FA 1CGLA 3ELMA 2HU6A 3AIGA 1AYKA 3LUMA 2DW0A 2Z2DA 3Q2HA 1JANA 4H49A 1QJJA 4GUYA 1BZSA 4GR8A 3WV3A 1G4KA 3TT4A 2JSDA 2X3CA
chains in the Genus database with same CATH topology
1GO8P 4JQGA 3AYUA 2W15A 1D5JA 1FLSA 1HV5A 1ZXCA 2I47A 1JAQA 2D1OA 4CTHA 1Y93A 2JIHA 3TSKA 1IABA 3EDHA 1RMZA 4JA1A 4EFSA 3G42A 3HB2P 1L6JA 4PKQA 3OHOA 4XCTA 4H84A 2DDYA 1BKCE 1KUFA 2X7MA 4XM6A 3NX7A 2Y6DA 1CAQA 1KUKA 2K9CA 3WV2A 2W14A 3KMCA 4WKIA 1C8TA 1C7KA 1USNA 1XFXA 1IAGA 2MZIA 5I43A 3U1RA 1IAEA 3KWVC 3F17A 1KBCA 3KEJA 1SATA 4GQLA 1BKCA 5D1UA 1UMSA 5B5PA 5I2ZA 2QPJA 3L0VA 1EUBA 3LJGA 3KMEA 5I12A 4HMAA 2OW1A 1BQQM 2AIGP 2MZHA 1HTDA 3KEKA 4ILWD 5L7FA 3F19A 4DV8A 1OO9A 4FXQA 1R55A 1JJ9A 3I7GA 3LILA 1C3IA 1QIAA 1H71P 4L19A 1R1HA 1PWWA 2WOAA 3USNA 1A86A 1R1IA 2OVZA 3DSLA 1YQYA 3F18A 4ON1A 4WZVA 5D1SA 2OZRA 3DPFA 1XFVA 3K7LA 4R3VA 1XFUA 5CUHA 3DTKA 2CLTA 2MZEA 1G49A 3EWJA 1ZP5A 1PWVA 1KUIA 2JT6A 4AYKA 1Y8JA 4A7BA 4H2EA 4WF6A 2POJA 4AIGA 2JT5A 2OY4A 1OS2A 2JNPA 1XFWA 3O2XA 2W12A 4FVLA 2USNA 2W0DA 4WK7A 3B8ZA 1OM6A 3RTTA 3LEAA 1ROSA 4GR3A 1QUAA 4I03A 3ZXHA 1A85A 1MMQA 5H8XA 5LABA 5BOTA 1R1JA 3HBVP 1OM8A 1SU3A 5BPAA 1GXDA 2Y6CA 3HY9A 2AYKA 1GKDA 1O0TA 3LMCA 5D1TA 3EDIA 3LJZA 2ERQA 3G5CA 4PKRA 4Q1LA 4L7AA 2WO8A 1XURA 1G12A 1MMRA 1BM6A 4JIJA 2O3EA 2DW2A 2OW2A 1BUDA 3E8RA 3F15A 1AF0A 4IUWA 3AYKA 2YUFA 1D8MA 830CA 1IACA 1K7GA 4ZR5A 5I4OA 4XBHA 1I73A 4GR0A 3N2VA 2OXZA 2D1NA 1SRPA 3P24A 3LKAA 3I7IA 1OMJA 1EAKA 3EDZA 5B5OA 1ASTA 2TCLA 1UEAA 2YB9A 2OVXA 966CA 4DD8A 3TS4A 1BKCI 2OI0A 3P1VA 3UVCA 1SLMA 3EHYA 4IJOA 2KRJA 5I0LA 5CXAA 1GE6A 1JAOA 4QKZA 5CZMA 2A8HA 3DWBA 4L6TA 1KUGA 3ZUKA 2FV9A 2PJTA 3EHXA 4JP4A 5D2BA 2W13A 3Q2GA 2RJPA 4H1QA 3LQBA 3SHIA 1D7XA 4L63A 1YP1A 1FBLA 4FU4A 1QICA 1PWUA 4DPEA 1BSWA 3V96B 2YIGA 5I3MA 3HBUP 1B3DA 3LK8A 5BOYA 4PKSA 3N2UA 1O0QA 3EDGA 2OXUA 2J83A 1Y0VA 1AKLA 1I76A 4XM8A 3LIKA 456CA 1WNIA 1Z3JA 1B8YA 1DMTA 1XFYA 1K7QA 4PKTA 1SLNA 1CXVA 4JPAA 1UMTA 1YOUA 1CGFA 1JK3A 4H82A 2MLSA 1JAPA 1DTHA 1ZTQA 1MNCA 3DPEA 3DL1A 1FM1A 1CK7A 3O64A 4AUOA 3LQ0A 1OM7A 1PWPA 2OW9A 2MLRA 1ZVXA 5D3CA 1JIWP 2V4BA 1CQRA 1HFCA 1OS9A 5D7WA 1XUDA 3DTEA 1CGEA 3HY7A 5JMYA 1GE7A 1I1IP 1CIZA 3B2ZA 3LIRA 1IADA 2FV5A 1BIWA 4GWNA 1EB6A 4I35A 4PKWA 3LUNA 1HFSA 1ND1A 1HOVA 1UTTA 4PKUA 4GF1A 1MMPA 1BUVM 4DF9A 1IAAA 1QIBA 1GO7P 3HYGA 3CKIA 1K7IA 3LGPA 5L79A 1R54A 2K2GA 1ZXVA 4XM7A 1GKCA 3KHIA 2DDFA 3F1AA 4H3XA 3ZVSA 3OHLA 4FXYP 2O36A 1ATLA 1G9KA 2OW0A 3GBOA 2CKIA 1HY7A 3WV1A 3HDAP 2L0RA 1PWQA 1J7NA 1XFZA 4H30A 1YCMA 2RJQA 2OXWA 3TVCA 1KUHA 1JKYA 2XS4A 4WKEA 1QJIA 4HX3A 1UTZA 1S4BP 2ERPA 1GE5A 3LJTA 1RM8A 2WO9A 2EROA 2X3AA 3DTIA 2SRTA 3RTSA 1Q3AA 4G0DA 4AXQA 3VI1A 3B92A 4G9LA 1XUCA 4J4MA 3LE9A 4GWMA 2XS3A 2N8RA 1G05A 3VTGA 1ZS0A 1KAPP 3KECA 3DNGA 3HDBA 2OY2A 3F16A 2DW1A 3L0TA 4IN9A 2E3XA 4PKVA 3K7NA 2X3BA 1JIZA 4H76A 3KRYA 1BQOA 3BA0A 2E2DA 4A3WA 2J0TA 1MMBA 1SMPA 1JH1A 3MA2A 1D8FA 1CGLA 3ELMA 2HU6A 3AIGA 1AYKA 3LUMA 2DW0A 2Z2DA 3Q2HA 1JANA 4H49A 1QJJA 4GUYA 1BZSA 4GR8A 3WV3A 1G4KA 3TT4A 2JSDA 2X3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO8 P;  4JQG A;  3AYU A;  2W15 A;  1D5J A;  1FLS A;  1HV5 A;  1ZXC A;  2I47 A;  1JAQ A;  2D1O A;  4CTH A;  1Y93 A;  2JIH A;  3TSK A;  1IAB A;  3EDH A;  1RMZ A;  4JA1 A;  4EFS A;  3G42 A;  3HB2 P;  1L6J A;  4PKQ A;  3OHO A;  4XCT A;  4H84 A;  2DDY A;  1BKC E;  1KUF A;  2X7M A;  4XM6 A;  3NX7 A;  2Y6D A;  1CAQ A;  1KUK A;  2K9C A;  3WV2 A;  2W14 A;  3KMC A;  4WKI A;  1C8T A;  1C7K A;  1USN A;  1XFX A;  1IAG A;  2MZI A;  5I43 A;  3U1R A;  1IAE A;  3KWV C;  3F17 A;  1KBC A;  3KEJ A;  1SAT A;  4GQL A;  1BKC A;  5D1U A;  1UMS A;  5B5P A;  5I2Z A;  2QPJ A;  3L0V A;  1EUB A;  3LJG A;  3KME A;  5I12 A;  4HMA A;  2OW1 A;  1BQQ M;  2AIG P;  2MZH A;  1HTD A;  3KEK A;  4ILW D;  5L7F A;  3F19 A;  4DV8 A;  1OO9 A;  4FXQ A;  1R55 A;  1JJ9 A;  3I7G A;  3LIL A;  1C3I A;  1QIA A;  1H71 P;  4L19 A;  1R1H A;  1PWW A;  2WOA A;  3USN A;  1A86 A;  1R1I A;  2OVZ A;  3DSL A;  1YQY A;  3F18 A;  4ON1 A;  4WZV A;  5D1S A;  2OZR A;  3DPF A;  1XFV A;  3K7L A;  4R3V A;  1XFU A;  5CUH A;  2CLT A;  2MZE A;  1G49 A;  3EWJ A;  1ZP5 A;  1PWV A;  1KUI A;  2JT6 A;  4AYK A;  1Y8J A;  4A7B A;  4H2E A;  4WF6 A;  2POJ A;  4AIG A;  2JT5 A;  2OY4 A;  1OS2 A;  2JNP A;  1XFW A;  3O2X A;  2W12 A;  4FVL A;  2USN A;  2W0D A;  4WK7 A;  3B8Z A;  1OM6 A;  3RTT A;  3LEA A;  1ROS A;  4GR3 A;  1QUA A;  4I03 A;  3ZXH A;  1A85 A;  1MMQ A;  5H8X A;  5LAB A;  5BOT A;  1R1J A;  3HBV P;  1OM8 A;  1SU3 A;  5BPA A;  1GXD A;  2Y6C A;  3HY9 A;  2AYK A;  1GKD A;  1O0T A;  3LMC A;  5D1T A;  3EDI A;  3LJZ A;  2ERQ A;  3G5C A;  4PKR A;  4Q1L A;  2WO8 A;  1XUR A;  1G12 A;  1MMR A;  1BM6 A;  4JIJ A;  2O3E A;  2DW2 A;  2OW2 A;  1BUD A;  3E8R A;  3F15 A;  1AF0 A;  4IUW A;  3AYK A;  1D8M A;  830C A;  1IAC A;  1K7G A;  4ZR5 A;  5I4O A;  4XBH A;  1I73 A;  4GR0 A;  3N2V A;  2OXZ A;  2D1N A;  1SRP A;  3P24 A;  3LKA A;  3I7I A;  1OMJ A;  1EAK A;  3EDZ A;  5B5O A;  1AST A;  2TCL A;  1UEA A;  2YB9 A;  2OVX A;  966C A;  4DD8 A;  3TS4 A;  1BKC I;  2OI0 A;  3P1V A;  3UVC A;  1SLM A;  3EHY A;  4IJO A;  2KRJ A;  5I0L A;  5CXA A;  1GE6 A;  1JAO A;  4QKZ A;  5CZM A;  2A8H A;  3DWB A;  4L6T A;  1KUG A;  3ZUK A;  2FV9 A;  2PJT A;  3EHX A;  4JP4 A;  5D2B A;  2W13 A;  3Q2G A;  2RJP A;  4H1Q A;  3LQB A;  3SHI A;  1D7X A;  4L63 A;  1YP1 A;  1FBL A;  4FU4 A;  1QIC A;  1PWU A;  4DPE A;  1BSW A;  3V96 B;  2YIG A;  5I3M A;  3HBU P;  1B3D A;  3LK8 A;  5BOY A;  4PKS A;  3N2U A;  1O0Q A;  3EDG A;  2OXU A;  2J83 A;  1Y0V A;  1AKL A;  1I76 A;  4XM8 A;  3LIK A;  456C A;  1WNI A;  1Z3J A;  1B8Y A;  1DMT A;  1XFY A;  1K7Q A;  4PKT A;  1SLN A;  1CXV A;  4JPA A;  1UMT A;  1YOU A;  1CGF A;  1JK3 A;  4H82 A;  2MLS A;  1JAP A;  1DTH A;  1ZTQ A;  1MNC A;  3DPE A;  3DL1 A;  1FM1 A;  1CK7 A;  3O64 A;  4AUO A;  3LQ0 A;  1OM7 A;  1PWP A;  2OW9 A;  2MLR A;  1ZVX A;  5D3C A;  1JIW P;  2V4B A;  1CQR A;  1HFC A;  1OS9 A;  5D7W A;  1XUD A;  1CGE A;  3HY7 A;  5JMY A;  1GE7 A;  1I1I P;  1CIZ A;  3B2Z A;  3LIR A;  1IAD A;  2FV5 A;  1BIW A;  4GWN A;  1EB6 A;  4I35 A;  4PKW A;  3LUN A;  1HFS A;  1ND1 A;  1HOV A;  1UTT A;  4PKU A;  4GF1 A;  1MMP A;  1BUV M;  4DF9 A;  1IAA A;  1QIB A;  1GO7 P;  3HYG A;  3CKI A;  1K7I A;  3LGP A;  5L79 A;  1R54 A;  2K2G A;  1ZXV A;  4XM7 A;  1GKC A;  3KHI A;  2DDF A;  3F1A A;  4H3X A;  3ZVS A;  3OHL A;  4FXY P;  2O36 A;  1ATL A;  1G9K A;  2OW0 A;  3GBO A;  2CKI A;  1HY7 A;  3WV1 A;  3HDA P;  2L0R A;  1PWQ A;  1J7N A;  1XFZ A;  4H30 A;  1YCM A;  2RJQ A;  2OXW A;  3TVC A;  1KUH A;  1JKY A;  2XS4 A;  4WKE A;  1QJI A;  4HX3 A;  1UTZ A;  1S4B P;  2ERP A;  1GE5 A;  3LJT A;  1RM8 A;  2WO9 A;  2ERO A;  2X3A A;  2SRT A;  3RTS A;  1Q3A A;  4G0D A;  4AXQ A;  3VI1 A;  3B92 A;  4G9L A;  1XUC A;  4J4M A;  3LE9 A;  4GWM A;  2XS3 A;  2N8R A;  1G05 A;  3VTG A;  1ZS0 A;  1KAP P;  3KEC A;  3DNG A;  3HDB A;  2OY2 A;  3F16 A;  2DW1 A;  3L0T A;  4IN9 A;  2E3X A;  4PKV A;  3K7N A;  2X3B A;  1JIZ A;  4H76 A;  3KRY A;  1BQO A;  3BA0 A;  2E2D A;  4A3W A;  2J0T A;  1MMB A;  1SMP A;  1JH1 A;  3MA2 A;  1D8F A;  1CGL A;  3ELM A;  2HU6 A;  3AIG A;  1AYK A;  3LUM A;  2DW0 A;  2Z2D A;  3Q2H A;  1JAN A;  4H49 A;  1QJJ A;  4GUY A;  1BZS A;  4GR8 A;  3WV3 A;  1G4K A;  3TT4 A;  2JSD A;  2X3C A; 
#chains in the Genus database with same CATH topology
 1GO8 P;  4JQG A;  3AYU A;  2W15 A;  1D5J A;  1FLS A;  1HV5 A;  1ZXC A;  2I47 A;  1JAQ A;  2D1O A;  4CTH A;  1Y93 A;  2JIH A;  3TSK A;  1IAB A;  3EDH A;  1RMZ A;  4JA1 A;  4EFS A;  3G42 A;  3HB2 P;  1L6J A;  4PKQ A;  3OHO A;  4XCT A;  4H84 A;  2DDY A;  1BKC E;  1KUF A;  2X7M A;  4XM6 A;  3NX7 A;  2Y6D A;  1CAQ A;  1KUK A;  2K9C A;  3WV2 A;  2W14 A;  3KMC A;  4WKI A;  1C8T A;  1C7K A;  1USN A;  1XFX A;  1IAG A;  2MZI A;  5I43 A;  3U1R A;  1IAE A;  3KWV C;  3F17 A;  1KBC A;  3KEJ A;  1SAT A;  4GQL A;  1BKC A;  5D1U A;  1UMS A;  5B5P A;  1OZ9 A;  5I2Z A;  2QPJ A;  3L0V A;  1EUB A;  3LJG A;  3KME A;  5I12 A;  4HMA A;  2OW1 A;  1BQQ M;  2AIG P;  2MZH A;  1HTD A;  3KEK A;  4ILW D;  5L7F A;  3F19 A;  4DV8 A;  1OO9 A;  4FXQ A;  1R55 A;  1JJ9 A;  3I7G A;  3LIL A;  1C3I A;  1QIA A;  1H71 P;  4L19 A;  1R1H A;  1PWW A;  2WOA A;  3USN A;  1A86 A;  1R1I A;  2OVZ A;  3DSL A;  1YQY A;  3F18 A;  4ON1 A;  4WZV A;  5D1S A;  2OZR A;  3DPF A;  1XFV A;  3K7L A;  4R3V A;  1XFU A;  5CUH A;  3DTK A;  2CLT A;  2MZE A;  1G49 A;  3EWJ A;  1ZP5 A;  1PWV A;  1KUI A;  2JT6 A;  4AYK A;  1Y8J A;  4A7B A;  4H2E A;  4WF6 A;  2POJ A;  4AIG A;  2JT5 A;  2OY4 A;  1OS2 A;  2JNP A;  1XFW A;  3O2X A;  2W12 A;  4FVL A;  2USN A;  2W0D A;  4WK7 A;  3B8Z A;  1OM6 A;  3RTT A;  3LEA A;  1ROS A;  4GR3 A;  1QUA A;  4I03 A;  3ZXH A;  1A85 A;  1MMQ A;  5H8X A;  5LAB A;  5BOT A;  1R1J A;  3HBV P;  1OM8 A;  1SU3 A;  5BPA A;  1GXD A;  2Y6C A;  3HY9 A;  2AYK A;  1GKD A;  1O0T A;  3LMC A;  5D1T A;  1TVI A;  3EDI A;  3LJZ A;  2ERQ A;  3G5C A;  4PKR A;  4Q1L A;  4L7A A;  2WO8 A;  1XUR A;  1G12 A;  1MMR A;  1BM6 A;  4JIJ A;  2O3E A;  2DW2 A;  2OW2 A;  1BUD A;  3E8R A;  3F15 A;  1AF0 A;  4IUW A;  3AYK A;  2YUF A;  1D8M A;  830C A;  1IAC A;  1K7G A;  4ZR5 A;  5I4O A;  4XBH A;  1I73 A;  4GR0 A;  3N2V A;  2OXZ A;  2D1N A;  1SRP A;  3P24 A;  3LKA A;  3I7I A;  1OMJ A;  1EAK A;  3EDZ A;  5B5O A;  1AST A;  2TCL A;  1UEA A;  2YB9 A;  1XAX A;  2OVX A;  966C A;  4DD8 A;  3TS4 A;  1BKC I;  2OI0 A;  3P1V A;  3UVC A;  1SLM A;  3EHY A;  4IJO A;  2KRJ A;  5I0L A;  5CXA A;  1GE6 A;  1JAO A;  4QKZ A;  5CZM A;  2A8H A;  3DWB A;  4L6T A;  1KUG A;  3ZUK A;  2FV9 A;  2PJT A;  3EHX A;  4JP4 A;  5D2B A;  2W13 A;  3Q2G A;  2RJP A;  4H1Q A;  3LQB A;  3SHI A;  1D7X A;  4L63 A;  1YP1 A;  1FBL A;  4FU4 A;  1QIC A;  1PWU A;  4DPE A;  1BSW A;  3V96 B;  2YIG A;  5I3M A;  3HBU P;  1B3D A;  3LK8 A;  5BOY A;  4PKS A;  3N2U A;  1O0Q A;  3EDG A;  2OXU A;  2J83 A;  1Y0V A;  1AKL A;  1I76 A;  4XM8 A;  3LIK A;  456C A;  1WNI A;  1Z3J A;  1B8Y A;  1DMT A;  1XFY A;  1K7Q A;  4PKT A;  1SLN A;  1CXV A;  4JPA A;  1UMT A;  1YOU A;  1CGF A;  1JK3 A;  4H82 A;  2MLS A;  1JAP A;  1DTH A;  1ZTQ A;  1MNC A;  3DPE A;  3DL1 A;  1FM1 A;  1CK7 A;  3O64 A;  4AUO A;  3LQ0 A;  1OM7 A;  1PWP A;  2OW9 A;  2MLR A;  1ZVX A;  5D3C A;  1JIW P;  2V4B A;  1CQR A;  1HFC A;  1OS9 A;  5D7W A;  1XUD A;  3DTE A;  1CGE A;  3HY7 A;  5JMY A;  1GE7 A;  1I1I P;  1CIZ A;  3B2Z A;  3LIR A;  1IAD A;  2FV5 A;  1BIW A;  4GWN A;  1EB6 A;  4I35 A;  4PKW A;  3LUN A;  1HFS A;  1ND1 A;  1HOV A;  1UTT A;  4PKU A;  4GF1 A;  1MMP A;  1BUV M;  4DF9 A;  1IAA A;  1QIB A;  1GO7 P;  3HYG A;  3CKI A;  1K7I A;  3LGP A;  5L79 A;  1R54 A;  2K2G A;  1ZXV A;  4XM7 A;  1GKC A;  3KHI A;  2DDF A;  3F1A A;  4H3X A;  3ZVS A;  3OHL A;  4FXY P;  2O36 A;  1ATL A;  1G9K A;  2OW0 A;  3GBO A;  2CKI A;  1HY7 A;  3WV1 A;  3HDA P;  2L0R A;  1PWQ A;  1J7N A;  1XFZ A;  4H30 A;  1YCM A;  2RJQ A;  2OXW A;  3TVC A;  1KUH A;  1JKY A;  2XS4 A;  4WKE A;  1QJI A;  4HX3 A;  1UTZ A;  1S4B P;  1XM5 A;  2ERP A;  1GE5 A;  3LJT A;  1RM8 A;  2WO9 A;  2ERO A;  2X3A A;  3DTI A;  2SRT A;  3RTS A;  1Q3A A;  4G0D A;  4AXQ A;  3VI1 A;  3B92 A;  4G9L A;  1XUC A;  4J4M A;  3LE9 A;  4GWM A;  2XS3 A;  2N8R A;  1G05 A;  3VTG A;  1ZS0 A;  1KAP P;  3KEC A;  3DNG A;  3HDB A;  2OY2 A;  3F16 A;  2DW1 A;  3L0T A;  4IN9 A;  2E3X A;  4PKV A;  3K7N A;  2X3B A;  1JIZ A;  4H76 A;  3KRY A;  1BQO A;  3BA0 A;  2E2D A;  4A3W A;  2J0T A;  1MMB A;  1SMP A;  1JH1 A;  3MA2 A;  1D8F A;  1CGL A;  3ELM A;  2HU6 A;  3AIG A;  1AYK A;  3LUM A;  2DW0 A;  2Z2D A;  3Q2H A;  1JAN A;  4H49 A;  1QJJ A;  4GUY A;  1BZS A;  4GR8 A;  3WV3 A;  1G4K A;  3TT4 A;  2JSD A;  2X3C A; 
#chains in the Genus database with same CATH homology
 1GO8 P;  4JQG A;  3AYU A;  2W15 A;  1D5J A;  1FLS A;  1HV5 A;  1ZXC A;  2I47 A;  1JAQ A;  2D1O A;  4CTH A;  1Y93 A;  2JIH A;  3TSK A;  1IAB A;  3EDH A;  1RMZ A;  4JA1 A;  4EFS A;  3G42 A;  3HB2 P;  1L6J A;  4PKQ A;  3OHO A;  4XCT A;  4H84 A;  2DDY A;  1BKC E;  1KUF A;  2X7M A;  4XM6 A;  3NX7 A;  2Y6D A;  1CAQ A;  1KUK A;  2K9C A;  3WV2 A;  2W14 A;  3KMC A;  4WKI A;  1C8T A;  1C7K A;  1USN A;  1XFX A;  1IAG A;  2MZI A;  5I43 A;  3U1R A;  1IAE A;  3KWV C;  3F17 A;  1KBC A;  3KEJ A;  1SAT A;  4GQL A;  1BKC A;  5D1U A;  1UMS A;  5B5P A;  5I2Z A;  2QPJ A;  3L0V A;  1EUB A;  3LJG A;  3KME A;  5I12 A;  4HMA A;  2OW1 A;  1BQQ M;  2AIG P;  2MZH A;  1HTD A;  3KEK A;  4ILW D;  5L7F A;  3F19 A;  4DV8 A;  1OO9 A;  4FXQ A;  1R55 A;  1JJ9 A;  3I7G A;  3LIL A;  1C3I A;  1QIA A;  1H71 P;  4L19 A;  1R1H A;  1PWW A;  2WOA A;  3USN A;  1A86 A;  1R1I A;  2OVZ A;  3DSL A;  1YQY A;  3F18 A;  4ON1 A;  4WZV A;  5D1S A;  2OZR A;  3DPF A;  1XFV A;  3K7L A;  4R3V A;  1XFU A;  5CUH A;  3DTK A;  2CLT A;  2MZE A;  1G49 A;  3EWJ A;  1ZP5 A;  1PWV A;  1KUI A;  2JT6 A;  4AYK A;  1Y8J A;  4A7B A;  4H2E A;  4WF6 A;  2POJ A;  4AIG A;  2JT5 A;  2OY4 A;  1OS2 A;  2JNP A;  1XFW A;  3O2X A;  2W12 A;  4FVL A;  2USN A;  2W0D A;  4WK7 A;  3B8Z A;  1OM6 A;  3RTT A;  3LEA A;  1ROS A;  4GR3 A;  1QUA A;  4I03 A;  3ZXH A;  1A85 A;  1MMQ A;  5H8X A;  5LAB A;  5BOT A;  1R1J A;  3HBV P;  1OM8 A;  1SU3 A;  5BPA A;  1GXD A;  2Y6C A;  3HY9 A;  2AYK A;  1GKD A;  1O0T A;  3LMC A;  5D1T A;  3EDI A;  3LJZ A;  2ERQ A;  3G5C A;  4PKR A;  4Q1L A;  4L7A A;  2WO8 A;  1XUR A;  1G12 A;  1MMR A;  1BM6 A;  4JIJ A;  2O3E A;  2DW2 A;  2OW2 A;  1BUD A;  3E8R A;  3F15 A;  1AF0 A;  4IUW A;  3AYK A;  2YUF A;  1D8M A;  830C A;  1IAC A;  1K7G A;  4ZR5 A;  5I4O A;  4XBH A;  1I73 A;  4GR0 A;  3N2V A;  2OXZ A;  2D1N A;  1SRP A;  3P24 A;  3LKA A;  3I7I A;  1OMJ A;  1EAK A;  3EDZ A;  5B5O A;  1AST A;  2TCL A;  1UEA A;  2YB9 A;  2OVX A;  966C A;  4DD8 A;  3TS4 A;  1BKC I;  2OI0 A;  3P1V A;  3UVC A;  1SLM A;  3EHY A;  4IJO A;  2KRJ A;  5I0L A;  5CXA A;  1GE6 A;  1JAO A;  4QKZ A;  5CZM A;  2A8H A;  3DWB A;  4L6T A;  1KUG A;  3ZUK A;  2FV9 A;  2PJT A;  3EHX A;  4JP4 A;  5D2B A;  2W13 A;  3Q2G A;  2RJP A;  4H1Q A;  3LQB A;  3SHI A;  1D7X A;  4L63 A;  1YP1 A;  1FBL A;  4FU4 A;  1QIC A;  1PWU A;  4DPE A;  1BSW A;  3V96 B;  2YIG A;  5I3M A;  3HBU P;  1B3D A;  3LK8 A;  5BOY A;  4PKS A;  3N2U A;  1O0Q A;  3EDG A;  2OXU A;  2J83 A;  1Y0V A;  1AKL A;  1I76 A;  4XM8 A;  3LIK A;  456C A;  1WNI A;  1Z3J A;  1B8Y A;  1DMT A;  1XFY A;  1K7Q A;  4PKT A;  1SLN A;  1CXV A;  4JPA A;  1UMT A;  1YOU A;  1CGF A;  1JK3 A;  4H82 A;  2MLS A;  1JAP A;  1DTH A;  1ZTQ A;  1MNC A;  3DPE A;  3DL1 A;  1FM1 A;  1CK7 A;  3O64 A;  4AUO A;  3LQ0 A;  1OM7 A;  1PWP A;  2OW9 A;  2MLR A;  1ZVX A;  5D3C A;  1JIW P;  2V4B A;  1CQR A;  1HFC A;  1OS9 A;  5D7W A;  1XUD A;  3DTE A;  1CGE A;  3HY7 A;  5JMY A;  1GE7 A;  1I1I P;  1CIZ A;  3B2Z A;  3LIR A;  1IAD A;  2FV5 A;  1BIW A;  4GWN A;  1EB6 A;  4I35 A;  4PKW A;  3LUN A;  1HFS A;  1ND1 A;  1HOV A;  1UTT A;  4PKU A;  4GF1 A;  1MMP A;  1BUV M;  4DF9 A;  1IAA A;  1QIB A;  1GO7 P;  3HYG A;  3CKI A;  1K7I A;  3LGP A;  5L79 A;  1R54 A;  2K2G A;  1ZXV A;  4XM7 A;  1GKC A;  3KHI A;  2DDF A;  3F1A A;  4H3X A;  3ZVS A;  3OHL A;  4FXY P;  2O36 A;  1ATL A;  1G9K A;  2OW0 A;  3GBO A;  2CKI A;  1HY7 A;  3WV1 A;  3HDA P;  2L0R A;  1PWQ A;  1J7N A;  1XFZ A;  4H30 A;  1YCM A;  2RJQ A;  2OXW A;  3TVC A;  1KUH A;  1JKY A;  2XS4 A;  4WKE A;  1QJI A;  4HX3 A;  1UTZ A;  1S4B P;  2ERP A;  1GE5 A;  3LJT A;  1RM8 A;  2WO9 A;  2ERO A;  2X3A A;  3DTI A;  2SRT A;  3RTS A;  1Q3A A;  4G0D A;  4AXQ A;  3VI1 A;  3B92 A;  4G9L A;  1XUC A;  4J4M A;  3LE9 A;  4GWM A;  2XS3 A;  2N8R A;  1G05 A;  3VTG A;  1ZS0 A;  1KAP P;  3KEC A;  3DNG A;  3HDB A;  2OY2 A;  3F16 A;  2DW1 A;  3L0T A;  4IN9 A;  2E3X A;  4PKV A;  3K7N A;  2X3B A;  1JIZ A;  4H76 A;  3KRY A;  1BQO A;  3BA0 A;  2E2D A;  4A3W A;  2J0T A;  1MMB A;  1SMP A;  1JH1 A;  3MA2 A;  1D8F A;  1CGL A;  3ELM A;  2HU6 A;  3AIG A;  1AYK A;  3LUM A;  2DW0 A;  2Z2D A;  3Q2H A;  1JAN A;  4H49 A;  1QJJ A;  4GUY A;  1BZS A;  4GR8 A;  3WV3 A;  1G4K A;  3TT4 A;  2JSD A;  2X3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...