1ATLA

Structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (form-d)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
200
structure length
200
Chain Sequence
LPQRYIELVVVADHRVFMKYNSDLNTIRTRVHEIVNFINGFYRSLNIHVSLTDLEIWSNEDQINIQSASSDTLNAFAEWRETDLLNRKSHDNAQLLTAIELDEETLGLAPLGTMCDPKLSIGIVQDHSPINLLMGVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTKGRSYEFSDDSMHYYERFLKQYKPQCILNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATROLYSIN C
publication title Structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin C (form d).
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 76
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 3.4.24.42: Atrolysin C.
pdb deposition date 1995-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1atlA00
4DD8A 1JKYA 2MZEA 1HFSA 3DNGA 1HOVA 1EUBA 1O0QA 1PWWA 2RJPA 3LE9A 4L6TA 5L79A 4WF6A 1OM6A 2V4BA 3Q2HA 3U1RA 3LIKA 2MLSA 1UTZA 3O64A 3L0VA 1CIZA 2WO8A 1R1JA 4GR8A 2JT6A 3HDAP 1ZS0A 1KUIA 3OHOA 3LMCA 2ERPA 1OM7A 3TT4A 1ZP5A 4WZVA 1QJJA 1KAPP 1OMJA 1OM8A 1J7NA 3OHLA 4JPAA 1OS2A 3WV3A 1XURA 2EROA 1IABA 2K2GA 3KHIA 5D1TA 4J4MA 1ROSA 1Y8JA 1IAGA 2D1OA 3UVCA 2DDYA 3F17A 4A3WA 1CGEA 2D1NA 1SMPA 4PKWA 1YP1A 3DWBA 1YOUA 4H30A 3G42A 2DW1A 2J0TA 1R1HA 1ZXCA 4AXQA 5D1UA 4FVLA 1JJ9A 4IN9A 2OVZA 1UMTA 1KUGA 1KUFA 1IADA 3EDGA 3V96B 1ATLA 2OVXA 2X3CA 1Y0VA 1YCMA 3VI1A 5I2ZA 3AYKA 2RJQA 2E2DA 3HB2P 5I3MA 1O0TA 1JAPA 2TCLA 2JSDA 3WV1A 1BKCA 1B3DA 2X3BA 1UMSA 4GUYA 1JANA 4QKZA 1PWUA 3DL1A 1G49A 1R54A 1MMBA 1XFUA 5I43A 2QPJA 5H8XA 3N2VA 4PKQA 2JNPA 3LGPA 1G9KA 1BKCI 1UEAA 2W13A 1OS9A 1I1IP 5I0LA 1BKCE 3ZXHA 1GKDA 5I12A 1KBCA 3LJZA 3HDBA 2XS4A 2AIGP 1ZVXA 4FU4A 2XS3A 3LKAA 2OXUA 3EWJA 3K7NA 1BQOA 1CK7A 1GE5A 1GXDA 3I7IA 3AIGA 4JP4A 2J83A 3K7LA 5B5PA 4DV8A 4H2EA 1QIAA 3I7GA 4DF9A 4AIGA 4JIJA 1JIZA 3P24A 1RM8A 2OW0A 1AF0A 1IAAA 1AKLA 4GR3A 1C8TA 2Z2DA 1KUHA 3F1AA 4WKIA 5B5OA 4FXYP 4H84A 3MA2A 456CA 1ZTQA 3N2UA 1ND1A 1CXVA 3F19A 1JAQA 1FLSA 2I47A 3KWVC 3TS4A 3LJTA 830CA 1B8YA 3EHXA 2CLTA 4PKUA 3G5CA 3CKIA 5I4OA 1BUVM 4G9LA 2POJA 3HY7A 2OW2A 2E3XA 2K9CA 3HBVP 3WV2A 1QUAA 5D7WA 1JH1A 3GBOA 4JA1A 1SLNA 4JQGA 2MLRA 1S4BP 5BPAA 4GR0A 1XFXA 3DPEA 1BIWA 5L7FA 3EDIA 3USNA 1SU3A 3HYGA 3ZVSA 3NX7A 3L0TA 1R1IA 3EHYA 5BOYA 1BQQM 3LJGA 1CGFA 2CKIA 4G0DA 3ZUKA 3LIRA 2DW2A 4XM6A 1D8MA 3DPFA 1D8FA 1PWQA 1XUDA 1MMPA 4PKVA 1MMRA 1EB6A 4L63A 1K7IA 2L0RA 1SRPA 3EDZA 1D5JA 1BZSA 3KEJA 2W14A 4IJOA 3HBUP 1KUKA 4XCTA 4PKTA 5D3CA 2MZIA 3AYUA 3LUNA 1HFCA 1FM1A 1JIWP 3LILA 2X3AA 1GO7P 2KRJA 4R3VA 4XM8A 3HY9A 1HY7A 1XFVA 2WOAA 1QIBA 1YQYA 4GQLA 4PKSA 1G05A 5JMYA 1MMQA 1L6JA 1WNIA 4PKRA 1OO9A 1K7GA 4GWMA 1ASTA 2HU6A 4AYKA 4AUOA 1DTHA 1I76A 3LUMA 3B2ZA 3KEKA 3F18A 4H82A 1GE6A 3E8RA 1Q3AA 1BSWA 1JK3A 2O3EA 2DDFA 1XFWA 1C3IA 2JIHA 4ON1A 1A85A 4GF1A 2WO9A 2OXZA 3VTGA 2W0DA 3B8ZA 3TSKA 5BOTA 3BA0A 5LABA 3Q2GA 1CQRA 1IACA 1FBLA 4XBHA 4I03A 1C7KA 3LEAA 1JAOA 1GE7A 1SLMA 2USNA 2W15A 4XM7A 2W12A 1GO8P 3B92A 4HMAA 2YB9A 3KECA 2YIGA 1CGLA 2Y6DA 1AYKA 3KMCA 5CUHA 3F15A 2OZRA 4ILWD 1G12A 4Q1LA 1IAEA 2X7MA 2FV5A 2OY2A 2FV9A 1Y93A 3F16A 1CAQA 3KMEA 3LQBA 3ELMA 4WK7A 3P1VA 966CA 1R55A 2O36A 3O2XA 4IUWA 1H71P 1BUDA 5CXAA 2PJTA 3EDHA 1EAKA 5CZMA 2N8RA 1XFYA 3TVCA 1SATA 2OY4A 1PWPA 2AYKA 4EFSA 4I35A 2ERQA 1PWVA 4DPEA 4CTHA 1MNCA 4H3XA 1Z3JA 4FXQA 1QJIA 4GWNA 1BM6A 3SHIA 3RTTA 2Y6CA 5D1SA 1G4KA 2JT5A 3KRYA 1I73A 4A7BA 5D2BA 1RMZA 1USNA 2OW1A 4HX3A 2OI0A 3LK8A 1HTDA 1XUCA 1D7XA 1QICA 2OW9A 3DSLA 3RTSA 1A86A 4WKEA 2DW0A 4H49A 4H76A 1XFZA 1DMTA 1UTTA 2OXWA 4L19A 1K7QA 2SRTA 2MZHA 1GKCA 4ZR5A 1HV5A 1ZXVA 4H1QA 2A8HA 3LQ0A
chains in the Genus database with same CATH superfamily
4DD8A 1JKYA 2MZEA 1HFSA 3DNGA 1HOVA 1EUBA 1O0QA 1PWWA 2RJPA 3LE9A 4L6TA 5L79A 4WF6A 1OM6A 2V4BA 3Q2HA 3U1RA 3LIKA 2MLSA 3DTEA 1UTZA 3DTKA 3O64A 3L0VA 1CIZA 2WO8A 1R1JA 4GR8A 2JT6A 3HDAP 1ZS0A 1KUIA 3OHOA 3LMCA 2ERPA 1OM7A 3TT4A 1ZP5A 4WZVA 1QJJA 1KAPP 1OMJA 1OM8A 1J7NA 3OHLA 4JPAA 1OS2A 3WV3A 1XURA 2EROA 1IABA 2K2GA 3KHIA 5D1TA 4J4MA 1ROSA 1Y8JA 1IAGA 2D1OA 3UVCA 2DDYA 3F17A 4A3WA 1CGEA 2D1NA 1SMPA 4PKWA 1YP1A 3DWBA 1YOUA 4H30A 3G42A 2DW1A 2J0TA 1R1HA 1ZXCA 4AXQA 5D1UA 4FVLA 1JJ9A 4IN9A 2OVZA 1UMTA 1KUGA 1KUFA 1IADA 3EDGA 3V96B 1ATLA 2OVXA 2X3CA 1Y0VA 1YCMA 3VI1A 5I2ZA 3AYKA 2RJQA 2E2DA 3HB2P 5I3MA 1O0TA 1JAPA 2TCLA 2JSDA 3WV1A 1BKCA 1B3DA 2X3BA 1UMSA 4GUYA 1JANA 4QKZA 1PWUA 3DL1A 1G49A 1R54A 1MMBA 1XFUA 5I43A 2QPJA 5H8XA 3N2VA 4PKQA 2JNPA 3LGPA 1G9KA 1BKCI 1UEAA 2W13A 1OS9A 1I1IP 5I0LA 1BKCE 3ZXHA 1GKDA 5I12A 1KBCA 3LJZA 3HDBA 2XS4A 2AIGP 1ZVXA 4FU4A 2XS3A 3LKAA 2OXUA 3EWJA 3K7NA 1BQOA 1CK7A 1GE5A 1GXDA 3DTIA 3AIGA 3I7IA 2J83A 3K7LA 4JP4A 5B5PA 4DV8A 4H2EA 1QIAA 3I7GA 4DF9A 4AIGA 4JIJA 1JIZA 3P24A 1RM8A 2OW0A 1AF0A 1IAAA 1AKLA 4GR3A 1C8TA 2Z2DA 1KUHA 3F1AA 4WKIA 5B5OA 4FXYP 4H84A 3MA2A 456CA 1ZTQA 3N2UA 1ND1A 1CXVA 3F19A 1JAQA 1FLSA 2I47A 3KWVC 3TS4A 3LJTA 830CA 1B8YA 3EHXA 2CLTA 4PKUA 3G5CA 3CKIA 5I4OA 1BUVM 4G9LA 2POJA 3HY7A 2OW2A 2E3XA 2K9CA 3HBVP 3WV2A 1QUAA 5D7WA 1JH1A 3GBOA 4JA1A 1SLNA 4JQGA 2MLRA 1S4BP 5BPAA 4GR0A 1XFXA 3DPEA 1BIWA 5L7FA 3EDIA 3USNA 1SU3A 3HYGA 4L7AA 3NX7A 3ZVSA 3L0TA 1R1IA 3EHYA 5BOYA 1BQQM 3LJGA 1CGFA 2CKIA 4G0DA 3ZUKA 3LIRA 2DW2A 4XM6A 1D8MA 3DPFA 1D8FA 1PWQA 1XUDA 1MMPA 4PKVA 1MMRA 1EB6A 4L63A 1K7IA 2L0RA 1SRPA 3EDZA 1D5JA 1BZSA 3KEJA 2W14A 4IJOA 3HBUP 1KUKA 4XCTA 4PKTA 5D3CA 2MZIA 3AYUA 3LUNA 1HFCA 1FM1A 1JIWP 3LILA 2X3AA 1GO7P 1TVIA 2KRJA 4R3VA 4XM8A 3HY9A 1HY7A 1XFVA 2WOAA 1QIBA 1YQYA 4GQLA 4PKSA 1G05A 5JMYA 1MMQA 1L6JA 1WNIA 1XAXA 4PKRA 1OO9A 1K7GA 4GWMA 1ASTA 2HU6A 4AYKA 4AUOA 1DTHA 1I76A 3LUMA 3B2ZA 3KEKA 3F18A 4H82A 1GE6A 3E8RA 1Q3AA 1BSWA 1JK3A 2O3EA 2DDFA 1XFWA 1C3IA 2JIHA 4ON1A 1A85A 4GF1A 2WO9A 2OXZA 3VTGA 2W0DA 3B8ZA 3TSKA 5BOTA 3BA0A 5LABA 3Q2GA 1CQRA 1IACA 1FBLA 4XBHA 4I03A 1C7KA 3LEAA 1JAOA 1GE7A 1SLMA 1OZ9A 2USNA 2W15A 4XM7A 2W12A 1GO8P 3B92A 4HMAA 2YB9A 3KECA 2YIGA 1CGLA 2Y6DA 1AYKA 3KMCA 5CUHA 3F15A 2OZRA 4ILWD 1G12A 4Q1LA 1IAEA 2X7MA 2FV5A 2OY2A 2FV9A 1Y93A 3F16A 1CAQA 3KMEA 3LQBA 3ELMA 4WK7A 3P1VA 966CA 1R55A 2O36A 3O2XA 4IUWA 1H71P 1BUDA 5CXAA 2PJTA 3EDHA 1EAKA 5CZMA 2N8RA 1XFYA 3TVCA 1SATA 2OY4A 1PWPA 2AYKA 4EFSA 4I35A 2ERQA 1PWVA 4DPEA 4CTHA 1MNCA 4H3XA 1Z3JA 4FXQA 1QJIA 4GWNA 1BM6A 3SHIA 3RTTA 2Y6CA 5D1SA 1G4KA 2JT5A 3KRYA 1I73A 4A7BA 5D2BA 1RMZA 1USNA 2OW1A 4HX3A 2OI0A 3LK8A 1HTDA 1XUCA 1D7XA 1QICA 2OW9A 3DSLA 3RTSA 1A86A 4WKEA 2DW0A 4H49A 4H76A 1XFZA 1DMTA 1UTTA 2OXWA 2YUFA 4L19A 1XM5A 1K7QA 2SRTA 2MZHA 1GKCA 4ZR5A 1HV5A 1ZXVA 4H1QA 2A8HA 3LQ0A
chains in the Genus database with same CATH topology
4DD8A 1JKYA 2MZEA 1HFSA 3DNGA 1HOVA 1EUBA 1O0QA 1PWWA 2RJPA 3LE9A 4L6TA 5L79A 4WF6A 1OM6A 2V4BA 3Q2HA 3U1RA 3LIKA 2MLSA 3DTEA 1UTZA 3DTKA 3O64A 3L0VA 1CIZA 2WO8A 1R1JA 4GR8A 2JT6A 3HDAP 1ZS0A 1KUIA 3OHOA 3LMCA 2ERPA 1OM7A 3TT4A 1ZP5A 4WZVA 1QJJA 1KAPP 1OMJA 1OM8A 1J7NA 3OHLA 4JPAA 1OS2A 3WV3A 1XURA 2EROA 1IABA 2K2GA 3KHIA 5D1TA 4J4MA 1ROSA 1Y8JA 1IAGA 2D1OA 3UVCA 2DDYA 3F17A 4A3WA 1CGEA 2D1NA 1SMPA 4PKWA 1YP1A 3DWBA 1YOUA 4H30A 3G42A 2DW1A 2J0TA 1R1HA 1ZXCA 4AXQA 5D1UA 4FVLA 1JJ9A 4IN9A 2OVZA 1UMTA 1KUGA 1KUFA 1IADA 3EDGA 3V96B 1ATLA 2OVXA 2X3CA 1Y0VA 1YCMA 3VI1A 5I2ZA 3AYKA 2RJQA 2E2DA 3HB2P 5I3MA 1O0TA 1JAPA 2TCLA 2JSDA 3WV1A 1BKCA 1B3DA 2X3BA 1UMSA 4GUYA 1JANA 4QKZA 1PWUA 3DL1A 1G49A 1R54A 1MMBA 1XFUA 5I43A 2QPJA 5H8XA 3N2VA 4PKQA 2JNPA 3LGPA 1G9KA 1BKCI 1UEAA 2W13A 1OS9A 1I1IP 5I0LA 1BKCE 3ZXHA 1GKDA 5I12A 1KBCA 3LJZA 3HDBA 2XS4A 2AIGP 1ZVXA 4FU4A 2XS3A 3LKAA 2OXUA 3EWJA 3K7NA 1BQOA 1CK7A 1GE5A 1GXDA 3DTIA 3AIGA 3I7IA 2J83A 3K7LA 4JP4A 5B5PA 4DV8A 4H2EA 1QIAA 3I7GA 4DF9A 4AIGA 4JIJA 1JIZA 3P24A 1RM8A 2OW0A 1AF0A 1IAAA 1AKLA 4GR3A 1C8TA 2Z2DA 1KUHA 3F1AA 4WKIA 5B5OA 4FXYP 4H84A 3MA2A 456CA 1ZTQA 3N2UA 1ND1A 1CXVA 3F19A 1JAQA 1FLSA 2I47A 3KWVC 3TS4A 3LJTA 830CA 1B8YA 3EHXA 2CLTA 4PKUA 3G5CA 3CKIA 5I4OA 1BUVM 4G9LA 2POJA 3HY7A 2OW2A 2E3XA 2K9CA 3HBVP 3WV2A 1QUAA 5D7WA 1JH1A 3GBOA 4JA1A 1SLNA 4JQGA 2MLRA 1S4BP 5BPAA 4GR0A 1XFXA 3DPEA 1BIWA 5L7FA 3EDIA 3USNA 1SU3A 3HYGA 4L7AA 3NX7A 3ZVSA 3L0TA 1R1IA 3EHYA 5BOYA 1BQQM 3LJGA 1CGFA 2CKIA 4G0DA 3ZUKA 3LIRA 2DW2A 4XM6A 1D8MA 3DPFA 1D8FA 1PWQA 1XUDA 1MMPA 4PKVA 1MMRA 1EB6A 4L63A 1K7IA 2L0RA 1SRPA 3EDZA 1D5JA 1BZSA 3KEJA 2W14A 4IJOA 3HBUP 1KUKA 4XCTA 4PKTA 5D3CA 2MZIA 3AYUA 3LUNA 1HFCA 1FM1A 1JIWP 3LILA 2X3AA 1GO7P 2KRJA 4R3VA 4XM8A 3HY9A 1HY7A 1XFVA 2WOAA 1QIBA 1YQYA 4GQLA 4PKSA 1G05A 5JMYA 1MMQA 1L6JA 1WNIA 4PKRA 1OO9A 1K7GA 4GWMA 1ASTA 2HU6A 4AYKA 4AUOA 1DTHA 1I76A 3LUMA 3B2ZA 3KEKA 3F18A 4H82A 1GE6A 3E8RA 1Q3AA 1BSWA 1JK3A 2O3EA 2DDFA 1XFWA 1C3IA 2JIHA 4ON1A 1A85A 4GF1A 2WO9A 2OXZA 3VTGA 2W0DA 3B8ZA 3TSKA 5BOTA 3BA0A 5LABA 3Q2GA 1CQRA 1IACA 1FBLA 4XBHA 4I03A 1C7KA 3LEAA 1JAOA 1GE7A 1SLMA 2USNA 2W15A 4XM7A 2W12A 1GO8P 3B92A 4HMAA 2YB9A 3KECA 2YIGA 1CGLA 2Y6DA 1AYKA 3KMCA 5CUHA 3F15A 2OZRA 4ILWD 1G12A 4Q1LA 1IAEA 2X7MA 2FV5A 2OY2A 2FV9A 1Y93A 3F16A 1CAQA 3KMEA 3LQBA 3ELMA 4WK7A 3P1VA 966CA 1R55A 2O36A 3O2XA 4IUWA 1H71P 1BUDA 5CXAA 2PJTA 3EDHA 1EAKA 5CZMA 2N8RA 1XFYA 3TVCA 1SATA 2OY4A 1PWPA 2AYKA 4EFSA 4I35A 2ERQA 1PWVA 4DPEA 4CTHA 1MNCA 4H3XA 1Z3JA 4FXQA 1QJIA 4GWNA 1BM6A 3SHIA 3RTTA 2Y6CA 5D1SA 1G4KA 2JT5A 3KRYA 1I73A 4A7BA 5D2BA 1RMZA 1USNA 2OW1A 4HX3A 2OI0A 3LK8A 1HTDA 1XUCA 1D7XA 1QICA 2OW9A 3DSLA 3RTSA 1A86A 4WKEA 2DW0A 4H49A 4H76A 1XFZA 1DMTA 1UTTA 2OXWA 2YUFA 4L19A 1K7QA 2SRTA 2MZHA 1GKCA 4ZR5A 1HV5A 1ZXVA 4H1QA 2A8HA 3LQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DD8 A;  1JKY A;  2MZE A;  1HFS A;  3DNG A;  1HOV A;  1EUB A;  1O0Q A;  1PWW A;  2RJP A;  3LE9 A;  4L6T A;  5L79 A;  4WF6 A;  1OM6 A;  2V4B A;  3Q2H A;  3U1R A;  3LIK A;  2MLS A;  1UTZ A;  3O64 A;  3L0V A;  1CIZ A;  2WO8 A;  1R1J A;  4GR8 A;  2JT6 A;  3HDA P;  1ZS0 A;  1KUI A;  3OHO A;  3LMC A;  2ERP A;  1OM7 A;  3TT4 A;  1ZP5 A;  4WZV A;  1QJJ A;  1KAP P;  1OMJ A;  1OM8 A;  1J7N A;  3OHL A;  4JPA A;  1OS2 A;  3WV3 A;  1XUR A;  2ERO A;  1IAB A;  2K2G A;  3KHI A;  5D1T A;  4J4M A;  1ROS A;  1Y8J A;  1IAG A;  2D1O A;  3UVC A;  2DDY A;  3F17 A;  4A3W A;  1CGE A;  2D1N A;  1SMP A;  4PKW A;  1YP1 A;  3DWB A;  1YOU A;  4H30 A;  3G42 A;  2DW1 A;  2J0T A;  1R1H A;  1ZXC A;  4AXQ A;  5D1U A;  4FVL A;  1JJ9 A;  4IN9 A;  2OVZ A;  1UMT A;  1KUG A;  1KUF A;  1IAD A;  3EDG A;  3V96 B;  1ATL A;  2OVX A;  2X3C A;  1Y0V A;  1YCM A;  3VI1 A;  5I2Z A;  3AYK A;  2RJQ A;  2E2D A;  3HB2 P;  5I3M A;  1O0T A;  1JAP A;  2TCL A;  2JSD A;  3WV1 A;  1BKC A;  1B3D A;  2X3B A;  1UMS A;  4GUY A;  1JAN A;  4QKZ A;  1PWU A;  3DL1 A;  1G49 A;  1R54 A;  1MMB A;  1XFU A;  5I43 A;  2QPJ A;  5H8X A;  3N2V A;  4PKQ A;  2JNP A;  3LGP A;  1G9K A;  1BKC I;  1UEA A;  2W13 A;  1OS9 A;  1I1I P;  5I0L A;  1BKC E;  3ZXH A;  1GKD A;  5I12 A;  1KBC A;  3LJZ A;  3HDB A;  2XS4 A;  2AIG P;  1ZVX A;  4FU4 A;  2XS3 A;  3LKA A;  2OXU A;  3EWJ A;  3K7N A;  1BQO A;  1CK7 A;  1GE5 A;  1GXD A;  3I7I A;  3AIG A;  4JP4 A;  2J83 A;  3K7L A;  5B5P A;  4DV8 A;  4H2E A;  1QIA A;  3I7G A;  4DF9 A;  4AIG A;  4JIJ A;  1JIZ A;  3P24 A;  1RM8 A;  2OW0 A;  1AF0 A;  1IAA A;  1AKL A;  4GR3 A;  1C8T A;  2Z2D A;  1KUH A;  3F1A A;  4WKI A;  5B5O A;  4FXY P;  4H84 A;  3MA2 A;  456C A;  1ZTQ A;  3N2U A;  1ND1 A;  1CXV A;  3F19 A;  1JAQ A;  1FLS A;  2I47 A;  3KWV C;  3TS4 A;  3LJT A;  830C A;  1B8Y A;  3EHX A;  2CLT A;  4PKU A;  3G5C A;  3CKI A;  5I4O A;  1BUV M;  4G9L A;  2POJ A;  3HY7 A;  2OW2 A;  2E3X A;  2K9C A;  3HBV P;  3WV2 A;  1QUA A;  5D7W A;  1JH1 A;  3GBO A;  4JA1 A;  1SLN A;  4JQG A;  2MLR A;  1S4B P;  5BPA A;  4GR0 A;  1XFX A;  3DPE A;  1BIW A;  5L7F A;  3EDI A;  3USN A;  1SU3 A;  3HYG A;  3ZVS A;  3NX7 A;  3L0T A;  1R1I A;  3EHY A;  5BOY A;  1BQQ M;  3LJG A;  1CGF A;  2CKI A;  4G0D A;  3ZUK A;  3LIR A;  2DW2 A;  4XM6 A;  1D8M A;  3DPF A;  1D8F A;  1PWQ A;  1XUD A;  1MMP A;  4PKV A;  1MMR A;  1EB6 A;  4L63 A;  1K7I A;  2L0R A;  1SRP A;  3EDZ A;  1D5J A;  1BZS A;  3KEJ A;  2W14 A;  4IJO A;  3HBU P;  1KUK A;  4XCT A;  4PKT A;  5D3C A;  2MZI A;  3AYU A;  3LUN A;  1HFC A;  1FM1 A;  1JIW P;  3LIL A;  2X3A A;  1GO7 P;  2KRJ A;  4R3V A;  4XM8 A;  3HY9 A;  1HY7 A;  1XFV A;  2WOA A;  1QIB A;  1YQY A;  4GQL A;  4PKS A;  1G05 A;  5JMY A;  1MMQ A;  1L6J A;  1WNI A;  4PKR A;  1OO9 A;  1K7G A;  4GWM A;  1AST A;  2HU6 A;  4AYK A;  4AUO A;  1DTH A;  1I76 A;  3LUM A;  3B2Z A;  3KEK A;  3F18 A;  4H82 A;  1GE6 A;  3E8R A;  1Q3A A;  1BSW A;  1JK3 A;  2O3E A;  2DDF A;  1XFW A;  1C3I A;  2JIH A;  4ON1 A;  1A85 A;  4GF1 A;  2WO9 A;  2OXZ A;  3VTG A;  2W0D A;  3B8Z A;  3TSK A;  5BOT A;  3BA0 A;  5LAB A;  3Q2G A;  1CQR A;  1IAC A;  1FBL A;  4XBH A;  4I03 A;  1C7K A;  3LEA A;  1JAO A;  1GE7 A;  1SLM A;  2USN A;  2W15 A;  4XM7 A;  2W12 A;  1GO8 P;  3B92 A;  4HMA A;  2YB9 A;  3KEC A;  2YIG A;  1CGL A;  2Y6D A;  1AYK A;  3KMC A;  5CUH A;  3F15 A;  2OZR A;  4ILW D;  1G12 A;  4Q1L A;  1IAE A;  2X7M A;  2FV5 A;  2OY2 A;  2FV9 A;  1Y93 A;  3F16 A;  1CAQ A;  3KME A;  3LQB A;  3ELM A;  4WK7 A;  3P1V A;  966C A;  1R55 A;  2O36 A;  3O2X A;  4IUW A;  1H71 P;  1BUD A;  5CXA A;  2PJT A;  3EDH A;  1EAK A;  5CZM A;  2N8R A;  1XFY A;  3TVC A;  1SAT A;  2OY4 A;  1PWP A;  2AYK A;  4EFS A;  4I35 A;  2ERQ A;  1PWV A;  4DPE A;  4CTH A;  1MNC A;  4H3X A;  1Z3J A;  4FXQ A;  1QJI A;  4GWN A;  1BM6 A;  3SHI A;  3RTT A;  2Y6C A;  5D1S A;  1G4K A;  2JT5 A;  3KRY A;  1I73 A;  4A7B A;  5D2B A;  1RMZ A;  1USN A;  2OW1 A;  4HX3 A;  2OI0 A;  3LK8 A;  1HTD A;  1XUC A;  1D7X A;  1QIC A;  2OW9 A;  3DSL A;  3RTS A;  1A86 A;  4WKE A;  2DW0 A;  4H49 A;  4H76 A;  1XFZ A;  1DMT A;  1UTT A;  2OXW A;  4L19 A;  1K7Q A;  2SRT A;  2MZH A;  1GKC A;  4ZR5 A;  1HV5 A;  1ZXV A;  4H1Q A;  2A8H A;  3LQ0 A; 
#chains in the Genus database with same CATH topology
 4DD8 A;  1JKY A;  2MZE A;  1HFS A;  3DNG A;  1HOV A;  1EUB A;  1O0Q A;  1PWW A;  2RJP A;  3LE9 A;  4L6T A;  5L79 A;  4WF6 A;  1OM6 A;  2V4B A;  3Q2H A;  3U1R A;  3LIK A;  2MLS A;  3DTE A;  1UTZ A;  3DTK A;  3O64 A;  3L0V A;  1CIZ A;  2WO8 A;  1R1J A;  4GR8 A;  2JT6 A;  3HDA P;  1ZS0 A;  1KUI A;  3OHO A;  3LMC A;  2ERP A;  1OM7 A;  3TT4 A;  1ZP5 A;  4WZV A;  1QJJ A;  1KAP P;  1OMJ A;  1OM8 A;  1J7N A;  3OHL A;  4JPA A;  1OS2 A;  3WV3 A;  1XUR A;  2ERO A;  1IAB A;  2K2G A;  3KHI A;  5D1T A;  4J4M A;  1ROS A;  1Y8J A;  1IAG A;  2D1O A;  3UVC A;  2DDY A;  3F17 A;  4A3W A;  1CGE A;  2D1N A;  1SMP A;  4PKW A;  1YP1 A;  3DWB A;  1YOU A;  4H30 A;  3G42 A;  2DW1 A;  2J0T A;  1R1H A;  1ZXC A;  4AXQ A;  5D1U A;  4FVL A;  1JJ9 A;  4IN9 A;  2OVZ A;  1UMT A;  1KUG A;  1KUF A;  1IAD A;  3EDG A;  3V96 B;  1ATL A;  2OVX A;  2X3C A;  1Y0V A;  1YCM A;  3VI1 A;  5I2Z A;  3AYK A;  2RJQ A;  2E2D A;  3HB2 P;  5I3M A;  1O0T A;  1JAP A;  2TCL A;  2JSD A;  3WV1 A;  1BKC A;  1B3D A;  2X3B A;  1UMS A;  4GUY A;  1JAN A;  4QKZ A;  1PWU A;  3DL1 A;  1G49 A;  1R54 A;  1MMB A;  1XFU A;  5I43 A;  2QPJ A;  5H8X A;  3N2V A;  4PKQ A;  2JNP A;  3LGP A;  1G9K A;  1BKC I;  1UEA A;  2W13 A;  1OS9 A;  1I1I P;  5I0L A;  1BKC E;  3ZXH A;  1GKD A;  5I12 A;  1KBC A;  3LJZ A;  3HDB A;  2XS4 A;  2AIG P;  1ZVX A;  4FU4 A;  2XS3 A;  3LKA A;  2OXU A;  3EWJ A;  3K7N A;  1BQO A;  1CK7 A;  1GE5 A;  1GXD A;  3DTI A;  3AIG A;  3I7I A;  2J83 A;  3K7L A;  4JP4 A;  5B5P A;  4DV8 A;  4H2E A;  1QIA A;  3I7G A;  4DF9 A;  4AIG A;  4JIJ A;  1JIZ A;  3P24 A;  1RM8 A;  2OW0 A;  1AF0 A;  1IAA A;  1AKL A;  4GR3 A;  1C8T A;  2Z2D A;  1KUH A;  3F1A A;  4WKI A;  5B5O A;  4FXY P;  4H84 A;  3MA2 A;  456C A;  1ZTQ A;  3N2U A;  1ND1 A;  1CXV A;  3F19 A;  1JAQ A;  1FLS A;  2I47 A;  3KWV C;  3TS4 A;  3LJT A;  830C A;  1B8Y A;  3EHX A;  2CLT A;  4PKU A;  3G5C A;  3CKI A;  5I4O A;  1BUV M;  4G9L A;  2POJ A;  3HY7 A;  2OW2 A;  2E3X A;  2K9C A;  3HBV P;  3WV2 A;  1QUA A;  5D7W A;  1JH1 A;  3GBO A;  4JA1 A;  1SLN A;  4JQG A;  2MLR A;  1S4B P;  5BPA A;  4GR0 A;  1XFX A;  3DPE A;  1BIW A;  5L7F A;  3EDI A;  3USN A;  1SU3 A;  3HYG A;  4L7A A;  3NX7 A;  3ZVS A;  3L0T A;  1R1I A;  3EHY A;  5BOY A;  1BQQ M;  3LJG A;  1CGF A;  2CKI A;  4G0D A;  3ZUK A;  3LIR A;  2DW2 A;  4XM6 A;  1D8M A;  3DPF A;  1D8F A;  1PWQ A;  1XUD A;  1MMP A;  4PKV A;  1MMR A;  1EB6 A;  4L63 A;  1K7I A;  2L0R A;  1SRP A;  3EDZ A;  1D5J A;  1BZS A;  3KEJ A;  2W14 A;  4IJO A;  3HBU P;  1KUK A;  4XCT A;  4PKT A;  5D3C A;  2MZI A;  3AYU A;  3LUN A;  1HFC A;  1FM1 A;  1JIW P;  3LIL A;  2X3A A;  1GO7 P;  1TVI A;  2KRJ A;  4R3V A;  4XM8 A;  3HY9 A;  1HY7 A;  1XFV A;  2WOA A;  1QIB A;  1YQY A;  4GQL A;  4PKS A;  1G05 A;  5JMY A;  1MMQ A;  1L6J A;  1WNI A;  1XAX A;  4PKR A;  1OO9 A;  1K7G A;  4GWM A;  1AST A;  2HU6 A;  4AYK A;  4AUO A;  1DTH A;  1I76 A;  3LUM A;  3B2Z A;  3KEK A;  3F18 A;  4H82 A;  1GE6 A;  3E8R A;  1Q3A A;  1BSW A;  1JK3 A;  2O3E A;  2DDF A;  1XFW A;  1C3I A;  2JIH A;  4ON1 A;  1A85 A;  4GF1 A;  2WO9 A;  2OXZ A;  3VTG A;  2W0D A;  3B8Z A;  3TSK A;  5BOT A;  3BA0 A;  5LAB A;  3Q2G A;  1CQR A;  1IAC A;  1FBL A;  4XBH A;  4I03 A;  1C7K A;  3LEA A;  1JAO A;  1GE7 A;  1SLM A;  1OZ9 A;  2USN A;  2W15 A;  4XM7 A;  2W12 A;  1GO8 P;  3B92 A;  4HMA A;  2YB9 A;  3KEC A;  2YIG A;  1CGL A;  2Y6D A;  1AYK A;  3KMC A;  5CUH A;  3F15 A;  2OZR A;  4ILW D;  1G12 A;  4Q1L A;  1IAE A;  2X7M A;  2FV5 A;  2OY2 A;  2FV9 A;  1Y93 A;  3F16 A;  1CAQ A;  3KME A;  3LQB A;  3ELM A;  4WK7 A;  3P1V A;  966C A;  1R55 A;  2O36 A;  3O2X A;  4IUW A;  1H71 P;  1BUD A;  5CXA A;  2PJT A;  3EDH A;  1EAK A;  5CZM A;  2N8R A;  1XFY A;  3TVC A;  1SAT A;  2OY4 A;  1PWP A;  2AYK A;  4EFS A;  4I35 A;  2ERQ A;  1PWV A;  4DPE A;  4CTH A;  1MNC A;  4H3X A;  1Z3J A;  4FXQ A;  1QJI A;  4GWN A;  1BM6 A;  3SHI A;  3RTT A;  2Y6C A;  5D1S A;  1G4K A;  2JT5 A;  3KRY A;  1I73 A;  4A7B A;  5D2B A;  1RMZ A;  1USN A;  2OW1 A;  4HX3 A;  2OI0 A;  3LK8 A;  1HTD A;  1XUC A;  1D7X A;  1QIC A;  2OW9 A;  3DSL A;  3RTS A;  1A86 A;  4WKE A;  2DW0 A;  4H49 A;  4H76 A;  1XFZ A;  1DMT A;  1UTT A;  2OXW A;  2YUF A;  4L19 A;  1XM5 A;  1K7Q A;  2SRT A;  2MZH A;  1GKC A;  4ZR5 A;  1HV5 A;  1ZXV A;  4H1Q A;  2A8H A;  3LQ0 A; 
#chains in the Genus database with same CATH homology
 4DD8 A;  1JKY A;  2MZE A;  1HFS A;  3DNG A;  1HOV A;  1EUB A;  1O0Q A;  1PWW A;  2RJP A;  3LE9 A;  4L6T A;  5L79 A;  4WF6 A;  1OM6 A;  2V4B A;  3Q2H A;  3U1R A;  3LIK A;  2MLS A;  3DTE A;  1UTZ A;  3DTK A;  3O64 A;  3L0V A;  1CIZ A;  2WO8 A;  1R1J A;  4GR8 A;  2JT6 A;  3HDA P;  1ZS0 A;  1KUI A;  3OHO A;  3LMC A;  2ERP A;  1OM7 A;  3TT4 A;  1ZP5 A;  4WZV A;  1QJJ A;  1KAP P;  1OMJ A;  1OM8 A;  1J7N A;  3OHL A;  4JPA A;  1OS2 A;  3WV3 A;  1XUR A;  2ERO A;  1IAB A;  2K2G A;  3KHI A;  5D1T A;  4J4M A;  1ROS A;  1Y8J A;  1IAG A;  2D1O A;  3UVC A;  2DDY A;  3F17 A;  4A3W A;  1CGE A;  2D1N A;  1SMP A;  4PKW A;  1YP1 A;  3DWB A;  1YOU A;  4H30 A;  3G42 A;  2DW1 A;  2J0T A;  1R1H A;  1ZXC A;  4AXQ A;  5D1U A;  4FVL A;  1JJ9 A;  4IN9 A;  2OVZ A;  1UMT A;  1KUG A;  1KUF A;  1IAD A;  3EDG A;  3V96 B;  1ATL A;  2OVX A;  2X3C A;  1Y0V A;  1YCM A;  3VI1 A;  5I2Z A;  3AYK A;  2RJQ A;  2E2D A;  3HB2 P;  5I3M A;  1O0T A;  1JAP A;  2TCL A;  2JSD A;  3WV1 A;  1BKC A;  1B3D A;  2X3B A;  1UMS A;  4GUY A;  1JAN A;  4QKZ A;  1PWU A;  3DL1 A;  1G49 A;  1R54 A;  1MMB A;  1XFU A;  5I43 A;  2QPJ A;  5H8X A;  3N2V A;  4PKQ A;  2JNP A;  3LGP A;  1G9K A;  1BKC I;  1UEA A;  2W13 A;  1OS9 A;  1I1I P;  5I0L A;  1BKC E;  3ZXH A;  1GKD A;  5I12 A;  1KBC A;  3LJZ A;  3HDB A;  2XS4 A;  2AIG P;  1ZVX A;  4FU4 A;  2XS3 A;  3LKA A;  2OXU A;  3EWJ A;  3K7N A;  1BQO A;  1CK7 A;  1GE5 A;  1GXD A;  3DTI A;  3AIG A;  3I7I A;  2J83 A;  3K7L A;  4JP4 A;  5B5P A;  4DV8 A;  4H2E A;  1QIA A;  3I7G A;  4DF9 A;  4AIG A;  4JIJ A;  1JIZ A;  3P24 A;  1RM8 A;  2OW0 A;  1AF0 A;  1IAA A;  1AKL A;  4GR3 A;  1C8T A;  2Z2D A;  1KUH A;  3F1A A;  4WKI A;  5B5O A;  4FXY P;  4H84 A;  3MA2 A;  456C A;  1ZTQ A;  3N2U A;  1ND1 A;  1CXV A;  3F19 A;  1JAQ A;  1FLS A;  2I47 A;  3KWV C;  3TS4 A;  3LJT A;  830C A;  1B8Y A;  3EHX A;  2CLT A;  4PKU A;  3G5C A;  3CKI A;  5I4O A;  1BUV M;  4G9L A;  2POJ A;  3HY7 A;  2OW2 A;  2E3X A;  2K9C A;  3HBV P;  3WV2 A;  1QUA A;  5D7W A;  1JH1 A;  3GBO A;  4JA1 A;  1SLN A;  4JQG A;  2MLR A;  1S4B P;  5BPA A;  4GR0 A;  1XFX A;  3DPE A;  1BIW A;  5L7F A;  3EDI A;  3USN A;  1SU3 A;  3HYG A;  4L7A A;  3NX7 A;  3ZVS A;  3L0T A;  1R1I A;  3EHY A;  5BOY A;  1BQQ M;  3LJG A;  1CGF A;  2CKI A;  4G0D A;  3ZUK A;  3LIR A;  2DW2 A;  4XM6 A;  1D8M A;  3DPF A;  1D8F A;  1PWQ A;  1XUD A;  1MMP A;  4PKV A;  1MMR A;  1EB6 A;  4L63 A;  1K7I A;  2L0R A;  1SRP A;  3EDZ A;  1D5J A;  1BZS A;  3KEJ A;  2W14 A;  4IJO A;  3HBU P;  1KUK A;  4XCT A;  4PKT A;  5D3C A;  2MZI A;  3AYU A;  3LUN A;  1HFC A;  1FM1 A;  1JIW P;  3LIL A;  2X3A A;  1GO7 P;  2KRJ A;  4R3V A;  4XM8 A;  3HY9 A;  1HY7 A;  1XFV A;  2WOA A;  1QIB A;  1YQY A;  4GQL A;  4PKS A;  1G05 A;  5JMY A;  1MMQ A;  1L6J A;  1WNI A;  4PKR A;  1OO9 A;  1K7G A;  4GWM A;  1AST A;  2HU6 A;  4AYK A;  4AUO A;  1DTH A;  1I76 A;  3LUM A;  3B2Z A;  3KEK A;  3F18 A;  4H82 A;  1GE6 A;  3E8R A;  1Q3A A;  1BSW A;  1JK3 A;  2O3E A;  2DDF A;  1XFW A;  1C3I A;  2JIH A;  4ON1 A;  1A85 A;  4GF1 A;  2WO9 A;  2OXZ A;  3VTG A;  2W0D A;  3B8Z A;  3TSK A;  5BOT A;  3BA0 A;  5LAB A;  3Q2G A;  1CQR A;  1IAC A;  1FBL A;  4XBH A;  4I03 A;  1C7K A;  3LEA A;  1JAO A;  1GE7 A;  1SLM A;  2USN A;  2W15 A;  4XM7 A;  2W12 A;  1GO8 P;  3B92 A;  4HMA A;  2YB9 A;  3KEC A;  2YIG A;  1CGL A;  2Y6D A;  1AYK A;  3KMC A;  5CUH A;  3F15 A;  2OZR A;  4ILW D;  1G12 A;  4Q1L A;  1IAE A;  2X7M A;  2FV5 A;  2OY2 A;  2FV9 A;  1Y93 A;  3F16 A;  1CAQ A;  3KME A;  3LQB A;  3ELM A;  4WK7 A;  3P1V A;  966C A;  1R55 A;  2O36 A;  3O2X A;  4IUW A;  1H71 P;  1BUD A;  5CXA A;  2PJT A;  3EDH A;  1EAK A;  5CZM A;  2N8R A;  1XFY A;  3TVC A;  1SAT A;  2OY4 A;  1PWP A;  2AYK A;  4EFS A;  4I35 A;  2ERQ A;  1PWV A;  4DPE A;  4CTH A;  1MNC A;  4H3X A;  1Z3J A;  4FXQ A;  1QJI A;  4GWN A;  1BM6 A;  3SHI A;  3RTT A;  2Y6C A;  5D1S A;  1G4K A;  2JT5 A;  3KRY A;  1I73 A;  4A7B A;  5D2B A;  1RMZ A;  1USN A;  2OW1 A;  4HX3 A;  2OI0 A;  3LK8 A;  1HTD A;  1XUC A;  1D7X A;  1QIC A;  2OW9 A;  3DSL A;  3RTS A;  1A86 A;  4WKE A;  2DW0 A;  4H49 A;  4H76 A;  1XFZ A;  1DMT A;  1UTT A;  2OXW A;  2YUF A;  4L19 A;  1K7Q A;  2SRT A;  2MZH A;  1GKC A;  4ZR5 A;  1HV5 A;  1ZXV A;  4H1Q A;  2A8H A;  3LQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...