1ATLA

Structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (form-d)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
200
structure length
200
Chain Sequence
b'LPQRYIELVVVADHRVFMKYNSDLNTIRTRVHEIVNFINGFYRSLNIHVSLTDLEIWSNEDQINIQSASSDTLNAFAEWRETDLLNRKSHDNAQLLTAIELDEETLGLAPLGTMCDPKLSIGIVQDHSPINLLMGVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTKGRSYEFSDDSMHYYERFLKQYKPQCILNKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATROLYSIN C
publication title Structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin C (form d).
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 76
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 3.4.24.42: Atrolysin C.
pdb deposition date 1995-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1atlA00
4PKQA 2OXUA 2E2DA 1BKCE 1IACA 2XS3A 2OVZA 4AXQA 1IAGA 4XM7A 3G5CA 1ZVXA 3DNGA 1HOVA 3EDZA 1XFZA 1KUFA 1YQYA 3E8RA 1R54A 4ZR5A 2DDYA 1OM7A 1OMJA 3ZUKA 1R1JA 3WV2A 2OW2A 3F18A 3LILA 1L6JA 3I7IA 1Y93A 4Q1LA 1I1IP 2OW0A 2WO9A 3L0VA 1MMQA 3N2VA 4G0DA 1AYKA 2K9CA 1SU3A 2OY2A 1I73A 1UEAA 1MMPA 1J7NA 3ELMA 4ON1A 4WF6A 1XFXA 1IAEA 5D2BA 5BOYA 3B2ZA 2E3XA 1QJIA 1UMSA 3EWJA 3I7GA 3Q2GA 2OW9A 4H2EA 1EB6A 1SLNA 1G12A 1XFUA 1A86A 3DPEA 1YOUA 4IJOA 1UMTA 3KHIA 2X3AA 4IN9A 3U1RA 2RJQA 3KRYA 1ATLA 2K2GA 3KECA 3TVCA 1SLMA 3LIRA 3LKAA 3LQ0A 4JQGA 3WV3A 4H76A 1BQOA 4G9LA 1KUGA 1OS9A 1SRPA 4A3WA 3EDIA 1D8MA 2W14A 1PWPA 1C7KA 2YIGA 4AYKA 1RMZA 1GKDA 1R1HA 3V96B 1YCMA 2FV9A 1ZXVA 3ZVSA 1GE6A 2ERQA 3LGPA 3F17A 5L79A 3L0TA 5D3CA 4I03A 2KRJA 2CLTA 3DL1A 4HX3A 5JMYA 3KEJA 1DTHA 1MNCA 830CA 2JNPA 3NX7A 4FXYP 3P1VA 5I43A 1AF0A 4EFSA 2J0TA 1JJ9A 4DF9A 1PWQA 3HYGA 3DPFA 5I4OA 3LE9A 1IAAA 1XFWA 1SMPA 3TT4A 4GWNA 1UTZA 1JH1A 3GBOA 4PKUA 5CXAA 3B8ZA 1JAQA 1CGLA 1H71P 3USNA 1KUKA 3KMCA 4WKIA 1DMTA 5LABA 2JT6A 4R3VA 3HDAP 3OHLA 1ZS0A 3VTGA 2WO8A 1BKCA 1PWWA 4GR0A 4H30A 1JAOA 3AYKA 3G42A 1BKCI 2DDFA 4JIJA 2WOAA 4GWMA 1S4BP 1ZXCA 3LJGA 4PKTA 3ZXHA 2Y6CA 3HDBA 4H3XA 2ERPA 1JIZA 1XFYA 4GQLA 4I35A 2L0RA 1USNA 4L19A 1JKYA 3LJZA 2CKIA 1CGEA 4AUOA 1CQRA 2JSDA 3LMCA 2OXWA 2W0DA 2O3EA 2W13A 2DW1A 3EHXA 1YP1A 4XCTA 1BUDA 1QICA 1BUVM 1D5JA 3MA2A 4CTHA 3CKIA 4PKWA 3K7NA 2YB9A 1BSWA 1R55A 3DWBA 4HMAA 456CA 2J83A 3F16A 4ILWD 1HTDA 5D7WA 2OI0A 2EROA 1G9KA 1QUAA 1OM8A 2OXZA 2PJTA 5CZMA 5I0LA 4J4MA 5CUHA 3BA0A 3WV1A 1ASTA 1D8FA 4WKEA 1K7GA 3P24A 2JT5A 1GE7A 1Y0VA 3EDGA 1D7XA 5D1SA 1HY7A 1GO7P 1XUCA 3RTSA 2O36A 4GUYA 4GR3A 4A7BA 1OO9A 1IADA 1KUIA 1OS2A 1G49A 1O0QA 5BOTA 1K7QA 3LJTA 2A8HA 2D1NA 4DPEA 1EUBA 5I2ZA 4IUWA 1OM6A 2MZHA 3HBVP 3OHOA 3F1AA 2HU6A 2OW1A 2TCLA 1BZSA 1HV5A 2JIHA 3LEAA 3AYUA 3HBUP 4XBHA 2AYKA 5B5PA 4L6TA 1BM6A 3VI1A 4JA1A 2RJPA 1QJJA 1ND1A 5D1UA 1HFSA 1PWUA 1PWVA 2AIGP 3LK8A 1KBCA 1MMRA 1FM1A 4FXQA 1JAPA 2DW2A 3N2UA 3HB2P 2OVXA 2FV5A 2USNA 3KEKA 2V4BA 3HY7A 3Q2HA 4L63A 1GXDA 3LUMA 1CXVA 2Z2DA 1CGFA 2OZRA 1I76A 1AKLA 1RM8A 2DW0A 1G4KA 3F19A 966CA 4DD8A 2OY4A 1JIWP 1ZTQA 1Z3JA 4PKRA 1UTTA 4XM8A 1JANA 2X3BA 4GR8A 3O64A 1BIWA 1GO8P 3EDHA 1SATA 3TSKA 5D1TA 2I47A 3K7LA 3B92A 1A85A 2X7MA 4FU4A 4DV8A 1Q3AA 2XS4A 1CIZA 2MLSA 2POJA 2QPJA 1MMBA 4H49A 1C3IA 4FVLA 1BQQM 2X3CA 4QKZA 3TS4A 5I3MA 1GKCA 1QIAA 2N8RA 2MZEA 5BPAA 1K7IA 4GF1A 1CK7A 5H8XA 5L7FA 1G05A 3RTTA 1C8TA 5I12A 2SRTA 1ROSA 3HY9A 3O2XA 3DSLA 4AIGA 1JK3A 3KWVC 1R1IA 1FBLA 1IABA 4PKVA 1XURA 2MLRA 5B5OA 1O0TA 3LUNA 4PKSA 3EHYA 3LIKA 4XM6A 1XUDA 1B3DA 1WNIA 4JP4A 4WZVA 2W12A 3AIGA 1KAPP 2D1OA 3F15A 3LQBA 3UVCA 1CAQA 1EAKA 4H84A 4H1QA 2Y6DA 4WK7A 1Y8JA 1QIBA 1FLSA 1HFCA 4JPAA 1XFVA 2MZIA 1GE5A 1KUHA 1ZP5A 2W15A 3SHIA 3KMEA 4H82A 1B8YA
chains in the Genus database with same CATH superfamily
4PKQA 2OXUA 2E2DA 1BKCE 1IACA 2XS3A 2OVZA 4AXQA 1IAGA 4XM7A 3G5CA 1ZVXA 3DNGA 1HOVA 3EDZA 1XFZA 1KUFA 1YQYA 1OZ9A 1XM5A 3E8RA 1R54A 4ZR5A 2DDYA 1OM7A 1OMJA 3ZUKA 1R1JA 3DTEA 3WV2A 2OW2A 3F18A 3LILA 1L6JA 3I7IA 1Y93A 4Q1LA 1I1IP 2OW0A 2WO9A 3L0VA 1MMQA 3N2VA 4G0DA 1AYKA 2K9CA 1SU3A 2OY2A 1I73A 1UEAA 1MMPA 1J7NA 3ELMA 4ON1A 4WF6A 1XFXA 1IAEA 5D2BA 5BOYA 3B2ZA 2E3XA 1QJIA 1UMSA 3EWJA 3I7GA 3Q2GA 2OW9A 4H2EA 1EB6A 1SLNA 1G12A 1XFUA 1A86A 3DPEA 1YOUA 4IJOA 1UMTA 3KHIA 2X3AA 4IN9A 3U1RA 2RJQA 3KRYA 1ATLA 2K2GA 3KECA 3TVCA 1SLMA 3LIRA 3LKAA 3LQ0A 4JQGA 3WV3A 4H76A 1BQOA 4G9LA 1KUGA 1OS9A 1SRPA 4A3WA 3EDIA 1D8MA 2W14A 1PWPA 1C7KA 2YIGA 4AYKA 2YUFA 1RMZA 1GKDA 1R1HA 3V96B 1YCMA 2FV9A 1ZXVA 3ZVSA 1GE6A 2ERQA 3LGPA 3F17A 5L79A 3L0TA 5D3CA 4I03A 2KRJA 2CLTA 3DL1A 4HX3A 5JMYA 3KEJA 1DTHA 1MNCA 830CA 2JNPA 3NX7A 4FXYP 3P1VA 5I43A 1AF0A 4EFSA 2J0TA 1JJ9A 4DF9A 1PWQA 3HYGA 3DPFA 5I4OA 3LE9A 1IAAA 1XFWA 1SMPA 3TT4A 4GWNA 1UTZA 1JH1A 3GBOA 4PKUA 5CXAA 3B8ZA 1JAQA 1CGLA 1H71P 3USNA 1KUKA 3KMCA 4WKIA 1DMTA 5LABA 2JT6A 4R3VA 3HDAP 3OHLA 1ZS0A 3VTGA 2WO8A 1BKCA 1PWWA 4GR0A 4H30A 1JAOA 3AYKA 3G42A 1BKCI 2DDFA 4JIJA 2WOAA 4GWMA 1S4BP 1ZXCA 3LJGA 4PKTA 3ZXHA 2Y6CA 3HDBA 4H3XA 2ERPA 1JIZA 1XFYA 4GQLA 4I35A 2L0RA 1USNA 4L19A 3DTIA 1JKYA 3LJZA 2CKIA 1CGEA 4AUOA 1CQRA 2JSDA 3LMCA 2OXWA 2W0DA 2O3EA 2W13A 2DW1A 3EHXA 1YP1A 4XCTA 1BUDA 1QICA 1BUVM 1D5JA 3MA2A 4CTHA 3CKIA 4PKWA 3K7NA 2YB9A 1BSWA 1R55A 3DWBA 4HMAA 456CA 2J83A 3F16A 4ILWD 1HTDA 5D7WA 2OI0A 2EROA 1G9KA 1QUAA 1OM8A 2OXZA 2PJTA 5CZMA 5I0LA 4J4MA 5CUHA 3BA0A 3WV1A 1ASTA 1D8FA 4WKEA 1K7GA 3P24A 2JT5A 1GE7A 1Y0VA 3EDGA 1TVIA 1D7XA 5D1SA 1HY7A 1GO7P 1XUCA 3RTSA 2O36A 4GUYA 4GR3A 4A7BA 1OO9A 1IADA 1KUIA 1OS2A 1G49A 1O0QA 5BOTA 1K7QA 3LJTA 2A8HA 2D1NA 4DPEA 1EUBA 5I2ZA 4IUWA 1OM6A 2MZHA 3HBVP 3OHOA 3F1AA 2HU6A 2OW1A 2TCLA 1BZSA 1HV5A 2JIHA 3LEAA 3AYUA 3HBUP 4XBHA 2AYKA 5B5PA 4L6TA 1BM6A 3VI1A 4JA1A 2RJPA 1QJJA 1ND1A 5D1UA 1HFSA 1PWUA 1PWVA 2AIGP 3LK8A 1KBCA 1MMRA 1FM1A 4FXQA 1JAPA 2DW2A 3N2UA 3HB2P 2OVXA 2FV5A 2USNA 3KEKA 2V4BA 3HY7A 3Q2HA 4L63A 1GXDA 3LUMA 1CXVA 2Z2DA 1CGFA 2OZRA 1I76A 1AKLA 1RM8A 2DW0A 1G4KA 3F19A 966CA 4DD8A 2OY4A 1JIWP 1ZTQA 1Z3JA 4PKRA 1UTTA 4XM8A 1JANA 2X3BA 4GR8A 3O64A 1BIWA 1GO8P 3EDHA 1SATA 3TSKA 5D1TA 2I47A 3K7LA 3B92A 1A85A 2X7MA 4FU4A 4DV8A 1Q3AA 2XS4A 1CIZA 2MLSA 2POJA 2QPJA 1MMBA 4H49A 1C3IA 4FVLA 1BQQM 2X3CA 4QKZA 3TS4A 5I3MA 1GKCA 1QIAA 2N8RA 2MZEA 5BPAA 1K7IA 4GF1A 1CK7A 5H8XA 5L7FA 1G05A 3RTTA 1C8TA 5I12A 2SRTA 1XAXA 1ROSA 3HY9A 3O2XA 3DSLA 4AIGA 1JK3A 3KWVC 1R1IA 1FBLA 1IABA 4PKVA 1XURA 2MLRA 5B5OA 1O0TA 3LUNA 4PKSA 3EHYA 3LIKA 4XM6A 3DTKA 1XUDA 1B3DA 1WNIA 4JP4A 4WZVA 2W12A 3AIGA 1KAPP 2D1OA 3F15A 3LQBA 3UVCA 1CAQA 1EAKA 4H84A 4H1QA 2Y6DA 4WK7A 1Y8JA 1QIBA 1FLSA 1HFCA 4JPAA 1XFVA 2MZIA 1GE5A 1KUHA 4L7AA 1ZP5A 2W15A 3SHIA 3KMEA 4H82A 1B8YA
chains in the Genus database with same CATH topology
4PKQA 2OXUA 2E2DA 1BKCE 1IACA 2XS3A 2OVZA 4AXQA 1IAGA 4XM7A 3G5CA 1ZVXA 3DNGA 1HOVA 3EDZA 1XFZA 1KUFA 1YQYA 3E8RA 1R54A 4ZR5A 2DDYA 1OM7A 1OMJA 3ZUKA 1R1JA 3DTEA 3WV2A 2OW2A 3F18A 3LILA 1L6JA 3I7IA 1Y93A 4Q1LA 1I1IP 2OW0A 2WO9A 3L0VA 1MMQA 3N2VA 4G0DA 1AYKA 2K9CA 1SU3A 2OY2A 1I73A 1UEAA 1MMPA 1J7NA 3ELMA 4ON1A 4WF6A 1XFXA 1IAEA 5D2BA 5BOYA 3B2ZA 2E3XA 1QJIA 1UMSA 3EWJA 3I7GA 3Q2GA 2OW9A 4H2EA 1EB6A 1SLNA 1G12A 1XFUA 1A86A 3DPEA 1YOUA 4IJOA 1UMTA 3KHIA 2X3AA 4IN9A 3U1RA 2RJQA 3KRYA 1ATLA 2K2GA 3KECA 3TVCA 1SLMA 3LIRA 3LKAA 3LQ0A 4JQGA 3WV3A 4H76A 1BQOA 4G9LA 1KUGA 1OS9A 1SRPA 4A3WA 3EDIA 1D8MA 2W14A 1PWPA 1C7KA 2YIGA 4AYKA 2YUFA 1RMZA 1GKDA 1R1HA 3V96B 1YCMA 2FV9A 1ZXVA 3ZVSA 1GE6A 2ERQA 3LGPA 3F17A 5L79A 3L0TA 5D3CA 4I03A 2KRJA 2CLTA 3DL1A 4HX3A 5JMYA 3KEJA 1DTHA 1MNCA 830CA 2JNPA 3NX7A 4FXYP 3P1VA 5I43A 1AF0A 4EFSA 2J0TA 1JJ9A 4DF9A 1PWQA 3HYGA 3DPFA 5I4OA 3LE9A 1IAAA 1XFWA 1SMPA 3TT4A 4GWNA 1UTZA 1JH1A 3GBOA 4PKUA 5CXAA 3B8ZA 1JAQA 1CGLA 1H71P 3USNA 1KUKA 3KMCA 4WKIA 1DMTA 5LABA 2JT6A 4R3VA 3HDAP 3OHLA 1ZS0A 3VTGA 2WO8A 1BKCA 1PWWA 4GR0A 4H30A 1JAOA 3AYKA 3G42A 1BKCI 2DDFA 4JIJA 2WOAA 4GWMA 1S4BP 1ZXCA 3LJGA 4PKTA 3ZXHA 2Y6CA 3HDBA 4H3XA 2ERPA 1JIZA 1XFYA 4GQLA 4I35A 2L0RA 1USNA 4L19A 3DTIA 1JKYA 3LJZA 2CKIA 1CGEA 4AUOA 1CQRA 2JSDA 3LMCA 2OXWA 2W0DA 2O3EA 2W13A 2DW1A 3EHXA 1YP1A 4XCTA 1BUDA 1QICA 1BUVM 1D5JA 3MA2A 4CTHA 3CKIA 4PKWA 3K7NA 2YB9A 1BSWA 1R55A 3DWBA 4HMAA 456CA 2J83A 3F16A 4ILWD 1HTDA 5D7WA 2OI0A 2EROA 1G9KA 1QUAA 1OM8A 2OXZA 2PJTA 5CZMA 5I0LA 4J4MA 5CUHA 3BA0A 3WV1A 1ASTA 1D8FA 4WKEA 1K7GA 3P24A 2JT5A 1GE7A 1Y0VA 3EDGA 1D7XA 5D1SA 1HY7A 1GO7P 1XUCA 3RTSA 2O36A 4GUYA 4GR3A 4A7BA 1OO9A 1IADA 1KUIA 1OS2A 1G49A 1O0QA 5BOTA 1K7QA 3LJTA 2A8HA 2D1NA 4DPEA 1EUBA 5I2ZA 4IUWA 1OM6A 2MZHA 3HBVP 3OHOA 3F1AA 2HU6A 2OW1A 2TCLA 1BZSA 1HV5A 2JIHA 3LEAA 3AYUA 3HBUP 4XBHA 2AYKA 5B5PA 4L6TA 1BM6A 3VI1A 4JA1A 2RJPA 1QJJA 1ND1A 5D1UA 1HFSA 1PWUA 1PWVA 2AIGP 3LK8A 1KBCA 1MMRA 1FM1A 4FXQA 1JAPA 2DW2A 3N2UA 3HB2P 2OVXA 2FV5A 2USNA 3KEKA 2V4BA 3HY7A 3Q2HA 4L63A 1GXDA 3LUMA 1CXVA 2Z2DA 1CGFA 2OZRA 1I76A 1AKLA 1RM8A 2DW0A 1G4KA 3F19A 966CA 4DD8A 2OY4A 1JIWP 1ZTQA 1Z3JA 4PKRA 1UTTA 4XM8A 1JANA 2X3BA 4GR8A 3O64A 1BIWA 1GO8P 3EDHA 1SATA 3TSKA 5D1TA 2I47A 3K7LA 3B92A 1A85A 2X7MA 4FU4A 4DV8A 1Q3AA 2XS4A 1CIZA 2MLSA 2POJA 2QPJA 1MMBA 4H49A 1C3IA 4FVLA 1BQQM 2X3CA 4QKZA 3TS4A 5I3MA 1GKCA 1QIAA 2N8RA 2MZEA 5BPAA 1K7IA 4GF1A 1CK7A 5H8XA 5L7FA 1G05A 3RTTA 1C8TA 5I12A 2SRTA 1ROSA 3HY9A 3O2XA 3DSLA 4AIGA 1JK3A 3KWVC 1R1IA 1FBLA 1IABA 4PKVA 1XURA 2MLRA 5B5OA 1O0TA 3LUNA 4PKSA 3EHYA 3LIKA 4XM6A 3DTKA 1XUDA 1B3DA 1WNIA 4JP4A 4WZVA 2W12A 3AIGA 1KAPP 2D1OA 3F15A 3LQBA 3UVCA 1CAQA 1EAKA 4H84A 4H1QA 2Y6DA 4WK7A 1Y8JA 1QIBA 1FLSA 1HFCA 4JPAA 1XFVA 2MZIA 1GE5A 1KUHA 4L7AA 1ZP5A 2W15A 3SHIA 3KMEA 4H82A 1B8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKQ A;  2OXU A;  2E2D A;  1BKC E;  1IAC A;  2XS3 A;  2OVZ A;  4AXQ A;  1IAG A;  4XM7 A;  3G5C A;  1ZVX A;  3DNG A;  1HOV A;  3EDZ A;  1XFZ A;  1KUF A;  1YQY A;  3E8R A;  1R54 A;  4ZR5 A;  2DDY A;  1OM7 A;  1OMJ A;  3ZUK A;  1R1J A;  3WV2 A;  2OW2 A;  3F18 A;  3LIL A;  1L6J A;  3I7I A;  1Y93 A;  4Q1L A;  1I1I P;  2OW0 A;  2WO9 A;  3L0V A;  1MMQ A;  3N2V A;  4G0D A;  1AYK A;  2K9C A;  1SU3 A;  2OY2 A;  1I73 A;  1UEA A;  1MMP A;  1J7N A;  3ELM A;  4ON1 A;  4WF6 A;  1XFX A;  1IAE A;  5D2B A;  5BOY A;  3B2Z A;  2E3X A;  1QJI A;  1UMS A;  3EWJ A;  3I7G A;  3Q2G A;  2OW9 A;  4H2E A;  1EB6 A;  1SLN A;  1G12 A;  1XFU A;  1A86 A;  3DPE A;  1YOU A;  4IJO A;  1UMT A;  3KHI A;  2X3A A;  4IN9 A;  3U1R A;  2RJQ A;  3KRY A;  1ATL A;  2K2G A;  3KEC A;  3TVC A;  1SLM A;  3LIR A;  3LKA A;  3LQ0 A;  4JQG A;  3WV3 A;  4H76 A;  1BQO A;  4G9L A;  1KUG A;  1OS9 A;  1SRP A;  4A3W A;  3EDI A;  1D8M A;  2W14 A;  1PWP A;  1C7K A;  2YIG A;  4AYK A;  1RMZ A;  1GKD A;  1R1H A;  3V96 B;  1YCM A;  2FV9 A;  1ZXV A;  3ZVS A;  1GE6 A;  2ERQ A;  3LGP A;  3F17 A;  5L79 A;  3L0T A;  5D3C A;  4I03 A;  2KRJ A;  2CLT A;  3DL1 A;  4HX3 A;  5JMY A;  3KEJ A;  1DTH A;  1MNC A;  830C A;  2JNP A;  3NX7 A;  4FXY P;  3P1V A;  5I43 A;  1AF0 A;  4EFS A;  2J0T A;  1JJ9 A;  4DF9 A;  1PWQ A;  3HYG A;  3DPF A;  5I4O A;  3LE9 A;  1IAA A;  1XFW A;  1SMP A;  3TT4 A;  4GWN A;  1UTZ A;  1JH1 A;  3GBO A;  4PKU A;  5CXA A;  3B8Z A;  1JAQ A;  1CGL A;  1H71 P;  3USN A;  1KUK A;  3KMC A;  4WKI A;  1DMT A;  5LAB A;  2JT6 A;  4R3V A;  3HDA P;  3OHL A;  1ZS0 A;  3VTG A;  2WO8 A;  1BKC A;  1PWW A;  4GR0 A;  4H30 A;  1JAO A;  3AYK A;  3G42 A;  1BKC I;  2DDF A;  4JIJ A;  2WOA A;  4GWM A;  1S4B P;  1ZXC A;  3LJG A;  4PKT A;  3ZXH A;  2Y6C A;  3HDB A;  4H3X A;  2ERP A;  1JIZ A;  1XFY A;  4GQL A;  4I35 A;  2L0R A;  1USN A;  4L19 A;  1JKY A;  3LJZ A;  2CKI A;  1CGE A;  4AUO A;  1CQR A;  2JSD A;  3LMC A;  2OXW A;  2W0D A;  2O3E A;  2W13 A;  2DW1 A;  3EHX A;  1YP1 A;  4XCT A;  1BUD A;  1QIC A;  1BUV M;  1D5J A;  3MA2 A;  4CTH A;  3CKI A;  4PKW A;  3K7N A;  2YB9 A;  1BSW A;  1R55 A;  3DWB A;  4HMA A;  456C A;  2J83 A;  3F16 A;  4ILW D;  1HTD A;  5D7W A;  2OI0 A;  2ERO A;  1G9K A;  1QUA A;  1OM8 A;  2OXZ A;  2PJT A;  5CZM A;  5I0L A;  4J4M A;  5CUH A;  3BA0 A;  3WV1 A;  1AST A;  1D8F A;  4WKE A;  1K7G A;  3P24 A;  2JT5 A;  1GE7 A;  1Y0V A;  3EDG A;  1D7X A;  5D1S A;  1HY7 A;  1GO7 P;  1XUC A;  3RTS A;  2O36 A;  4GUY A;  4GR3 A;  4A7B A;  1OO9 A;  1IAD A;  1KUI A;  1OS2 A;  1G49 A;  1O0Q A;  5BOT A;  1K7Q A;  3LJT A;  2A8H A;  2D1N A;  4DPE A;  1EUB A;  5I2Z A;  4IUW A;  1OM6 A;  2MZH A;  3HBV P;  3OHO A;  3F1A A;  2HU6 A;  2OW1 A;  2TCL A;  1BZS A;  1HV5 A;  2JIH A;  3LEA A;  3AYU A;  3HBU P;  4XBH A;  2AYK A;  5B5P A;  4L6T A;  1BM6 A;  3VI1 A;  4JA1 A;  2RJP A;  1QJJ A;  1ND1 A;  5D1U A;  1HFS A;  1PWU A;  1PWV A;  2AIG P;  3LK8 A;  1KBC A;  1MMR A;  1FM1 A;  4FXQ A;  1JAP A;  2DW2 A;  3N2U A;  3HB2 P;  2OVX A;  2FV5 A;  2USN A;  3KEK A;  2V4B A;  3HY7 A;  3Q2H A;  4L63 A;  1GXD A;  3LUM A;  1CXV A;  2Z2D A;  1CGF A;  2OZR A;  1I76 A;  1AKL A;  1RM8 A;  2DW0 A;  1G4K A;  3F19 A;  966C A;  4DD8 A;  2OY4 A;  1JIW P;  1ZTQ A;  1Z3J A;  4PKR A;  1UTT A;  4XM8 A;  1JAN A;  2X3B A;  4GR8 A;  3O64 A;  1BIW A;  1GO8 P;  3EDH A;  1SAT A;  3TSK A;  5D1T A;  2I47 A;  3K7L A;  3B92 A;  1A85 A;  2X7M A;  4FU4 A;  4DV8 A;  1Q3A A;  2XS4 A;  1CIZ A;  2MLS A;  2POJ A;  2QPJ A;  1MMB A;  4H49 A;  1C3I A;  4FVL A;  1BQQ M;  2X3C A;  4QKZ A;  3TS4 A;  5I3M A;  1GKC A;  1QIA A;  2N8R A;  2MZE A;  5BPA A;  1K7I A;  4GF1 A;  1CK7 A;  5H8X A;  5L7F A;  1G05 A;  3RTT A;  1C8T A;  5I12 A;  2SRT A;  1ROS A;  3HY9 A;  3O2X A;  3DSL A;  4AIG A;  1JK3 A;  3KWV C;  1R1I A;  1FBL A;  1IAB A;  4PKV A;  1XUR A;  2MLR A;  5B5O A;  1O0T A;  3LUN A;  4PKS A;  3EHY A;  3LIK A;  4XM6 A;  1XUD A;  1B3D A;  1WNI A;  4JP4 A;  4WZV A;  2W12 A;  3AIG A;  1KAP P;  2D1O A;  3F15 A;  3LQB A;  3UVC A;  1CAQ A;  1EAK A;  4H84 A;  4H1Q A;  2Y6D A;  4WK7 A;  1Y8J A;  1QIB A;  1FLS A;  1HFC A;  4JPA A;  1XFV A;  2MZI A;  1GE5 A;  1KUH A;  1ZP5 A;  2W15 A;  3SHI A;  3KME A;  4H82 A;  1B8Y A; 
#chains in the Genus database with same CATH topology
 4PKQ A;  2OXU A;  2E2D A;  1BKC E;  1IAC A;  2XS3 A;  2OVZ A;  4AXQ A;  1IAG A;  4XM7 A;  3G5C A;  1ZVX A;  3DNG A;  1HOV A;  3EDZ A;  1XFZ A;  1KUF A;  1YQY A;  1OZ9 A;  1XM5 A;  3E8R A;  1R54 A;  4ZR5 A;  2DDY A;  1OM7 A;  1OMJ A;  3ZUK A;  1R1J A;  3DTE A;  3WV2 A;  2OW2 A;  3F18 A;  3LIL A;  1L6J A;  3I7I A;  1Y93 A;  4Q1L A;  1I1I P;  2OW0 A;  2WO9 A;  3L0V A;  1MMQ A;  3N2V A;  4G0D A;  1AYK A;  2K9C A;  1SU3 A;  2OY2 A;  1I73 A;  1UEA A;  1MMP A;  1J7N A;  3ELM A;  4ON1 A;  4WF6 A;  1XFX A;  1IAE A;  5D2B A;  5BOY A;  3B2Z A;  2E3X A;  1QJI A;  1UMS A;  3EWJ A;  3I7G A;  3Q2G A;  2OW9 A;  4H2E A;  1EB6 A;  1SLN A;  1G12 A;  1XFU A;  1A86 A;  3DPE A;  1YOU A;  4IJO A;  1UMT A;  3KHI A;  2X3A A;  4IN9 A;  3U1R A;  2RJQ A;  3KRY A;  1ATL A;  2K2G A;  3KEC A;  3TVC A;  1SLM A;  3LIR A;  3LKA A;  3LQ0 A;  4JQG A;  3WV3 A;  4H76 A;  1BQO A;  4G9L A;  1KUG A;  1OS9 A;  1SRP A;  4A3W A;  3EDI A;  1D8M A;  2W14 A;  1PWP A;  1C7K A;  2YIG A;  4AYK A;  2YUF A;  1RMZ A;  1GKD A;  1R1H A;  3V96 B;  1YCM A;  2FV9 A;  1ZXV A;  3ZVS A;  1GE6 A;  2ERQ A;  3LGP A;  3F17 A;  5L79 A;  3L0T A;  5D3C A;  4I03 A;  2KRJ A;  2CLT A;  3DL1 A;  4HX3 A;  5JMY A;  3KEJ A;  1DTH A;  1MNC A;  830C A;  2JNP A;  3NX7 A;  4FXY P;  3P1V A;  5I43 A;  1AF0 A;  4EFS A;  2J0T A;  1JJ9 A;  4DF9 A;  1PWQ A;  3HYG A;  3DPF A;  5I4O A;  3LE9 A;  1IAA A;  1XFW A;  1SMP A;  3TT4 A;  4GWN A;  1UTZ A;  1JH1 A;  3GBO A;  4PKU A;  5CXA A;  3B8Z A;  1JAQ A;  1CGL A;  1H71 P;  3USN A;  1KUK A;  3KMC A;  4WKI A;  1DMT A;  5LAB A;  2JT6 A;  4R3V A;  3HDA P;  3OHL A;  1ZS0 A;  3VTG A;  2WO8 A;  1BKC A;  1PWW A;  4GR0 A;  4H30 A;  1JAO A;  3AYK A;  3G42 A;  1BKC I;  2DDF A;  4JIJ A;  2WOA A;  4GWM A;  1S4B P;  1ZXC A;  3LJG A;  4PKT A;  3ZXH A;  2Y6C A;  3HDB A;  4H3X A;  2ERP A;  1JIZ A;  1XFY A;  4GQL A;  4I35 A;  2L0R A;  1USN A;  4L19 A;  3DTI A;  1JKY A;  3LJZ A;  2CKI A;  1CGE A;  4AUO A;  1CQR A;  2JSD A;  3LMC A;  2OXW A;  2W0D A;  2O3E A;  2W13 A;  2DW1 A;  3EHX A;  1YP1 A;  4XCT A;  1BUD A;  1QIC A;  1BUV M;  1D5J A;  3MA2 A;  4CTH A;  3CKI A;  4PKW A;  3K7N A;  2YB9 A;  1BSW A;  1R55 A;  3DWB A;  4HMA A;  456C A;  2J83 A;  3F16 A;  4ILW D;  1HTD A;  5D7W A;  2OI0 A;  2ERO A;  1G9K A;  1QUA A;  1OM8 A;  2OXZ A;  2PJT A;  5CZM A;  5I0L A;  4J4M A;  5CUH A;  3BA0 A;  3WV1 A;  1AST A;  1D8F A;  4WKE A;  1K7G A;  3P24 A;  2JT5 A;  1GE7 A;  1Y0V A;  3EDG A;  1TVI A;  1D7X A;  5D1S A;  1HY7 A;  1GO7 P;  1XUC A;  3RTS A;  2O36 A;  4GUY A;  4GR3 A;  4A7B A;  1OO9 A;  1IAD A;  1KUI A;  1OS2 A;  1G49 A;  1O0Q A;  5BOT A;  1K7Q A;  3LJT A;  2A8H A;  2D1N A;  4DPE A;  1EUB A;  5I2Z A;  4IUW A;  1OM6 A;  2MZH A;  3HBV P;  3OHO A;  3F1A A;  2HU6 A;  2OW1 A;  2TCL A;  1BZS A;  1HV5 A;  2JIH A;  3LEA A;  3AYU A;  3HBU P;  4XBH A;  2AYK A;  5B5P A;  4L6T A;  1BM6 A;  3VI1 A;  4JA1 A;  2RJP A;  1QJJ A;  1ND1 A;  5D1U A;  1HFS A;  1PWU A;  1PWV A;  2AIG P;  3LK8 A;  1KBC A;  1MMR A;  1FM1 A;  4FXQ A;  1JAP A;  2DW2 A;  3N2U A;  3HB2 P;  2OVX A;  2FV5 A;  2USN A;  3KEK A;  2V4B A;  3HY7 A;  3Q2H A;  4L63 A;  1GXD A;  3LUM A;  1CXV A;  2Z2D A;  1CGF A;  2OZR A;  1I76 A;  1AKL A;  1RM8 A;  2DW0 A;  1G4K A;  3F19 A;  966C A;  4DD8 A;  2OY4 A;  1JIW P;  1ZTQ A;  1Z3J A;  4PKR A;  1UTT A;  4XM8 A;  1JAN A;  2X3B A;  4GR8 A;  3O64 A;  1BIW A;  1GO8 P;  3EDH A;  1SAT A;  3TSK A;  5D1T A;  2I47 A;  3K7L A;  3B92 A;  1A85 A;  2X7M A;  4FU4 A;  4DV8 A;  1Q3A A;  2XS4 A;  1CIZ A;  2MLS A;  2POJ A;  2QPJ A;  1MMB A;  4H49 A;  1C3I A;  4FVL A;  1BQQ M;  2X3C A;  4QKZ A;  3TS4 A;  5I3M A;  1GKC A;  1QIA A;  2N8R A;  2MZE A;  5BPA A;  1K7I A;  4GF1 A;  1CK7 A;  5H8X A;  5L7F A;  1G05 A;  3RTT A;  1C8T A;  5I12 A;  2SRT A;  1XAX A;  1ROS A;  3HY9 A;  3O2X A;  3DSL A;  4AIG A;  1JK3 A;  3KWV C;  1R1I A;  1FBL A;  1IAB A;  4PKV A;  1XUR A;  2MLR A;  5B5O A;  1O0T A;  3LUN A;  4PKS A;  3EHY A;  3LIK A;  4XM6 A;  3DTK A;  1XUD A;  1B3D A;  1WNI A;  4JP4 A;  4WZV A;  2W12 A;  3AIG A;  1KAP P;  2D1O A;  3F15 A;  3LQB A;  3UVC A;  1CAQ A;  1EAK A;  4H84 A;  4H1Q A;  2Y6D A;  4WK7 A;  1Y8J A;  1QIB A;  1FLS A;  1HFC A;  4JPA A;  1XFV A;  2MZI A;  1GE5 A;  1KUH A;  4L7A A;  1ZP5 A;  2W15 A;  3SHI A;  3KME A;  4H82 A;  1B8Y A; 
#chains in the Genus database with same CATH homology
 4PKQ A;  2OXU A;  2E2D A;  1BKC E;  1IAC A;  2XS3 A;  2OVZ A;  4AXQ A;  1IAG A;  4XM7 A;  3G5C A;  1ZVX A;  3DNG A;  1HOV A;  3EDZ A;  1XFZ A;  1KUF A;  1YQY A;  3E8R A;  1R54 A;  4ZR5 A;  2DDY A;  1OM7 A;  1OMJ A;  3ZUK A;  1R1J A;  3DTE A;  3WV2 A;  2OW2 A;  3F18 A;  3LIL A;  1L6J A;  3I7I A;  1Y93 A;  4Q1L A;  1I1I P;  2OW0 A;  2WO9 A;  3L0V A;  1MMQ A;  3N2V A;  4G0D A;  1AYK A;  2K9C A;  1SU3 A;  2OY2 A;  1I73 A;  1UEA A;  1MMP A;  1J7N A;  3ELM A;  4ON1 A;  4WF6 A;  1XFX A;  1IAE A;  5D2B A;  5BOY A;  3B2Z A;  2E3X A;  1QJI A;  1UMS A;  3EWJ A;  3I7G A;  3Q2G A;  2OW9 A;  4H2E A;  1EB6 A;  1SLN A;  1G12 A;  1XFU A;  1A86 A;  3DPE A;  1YOU A;  4IJO A;  1UMT A;  3KHI A;  2X3A A;  4IN9 A;  3U1R A;  2RJQ A;  3KRY A;  1ATL A;  2K2G A;  3KEC A;  3TVC A;  1SLM A;  3LIR A;  3LKA A;  3LQ0 A;  4JQG A;  3WV3 A;  4H76 A;  1BQO A;  4G9L A;  1KUG A;  1OS9 A;  1SRP A;  4A3W A;  3EDI A;  1D8M A;  2W14 A;  1PWP A;  1C7K A;  2YIG A;  4AYK A;  2YUF A;  1RMZ A;  1GKD A;  1R1H A;  3V96 B;  1YCM A;  2FV9 A;  1ZXV A;  3ZVS A;  1GE6 A;  2ERQ A;  3LGP A;  3F17 A;  5L79 A;  3L0T A;  5D3C A;  4I03 A;  2KRJ A;  2CLT A;  3DL1 A;  4HX3 A;  5JMY A;  3KEJ A;  1DTH A;  1MNC A;  830C A;  2JNP A;  3NX7 A;  4FXY P;  3P1V A;  5I43 A;  1AF0 A;  4EFS A;  2J0T A;  1JJ9 A;  4DF9 A;  1PWQ A;  3HYG A;  3DPF A;  5I4O A;  3LE9 A;  1IAA A;  1XFW A;  1SMP A;  3TT4 A;  4GWN A;  1UTZ A;  1JH1 A;  3GBO A;  4PKU A;  5CXA A;  3B8Z A;  1JAQ A;  1CGL A;  1H71 P;  3USN A;  1KUK A;  3KMC A;  4WKI A;  1DMT A;  5LAB A;  2JT6 A;  4R3V A;  3HDA P;  3OHL A;  1ZS0 A;  3VTG A;  2WO8 A;  1BKC A;  1PWW A;  4GR0 A;  4H30 A;  1JAO A;  3AYK A;  3G42 A;  1BKC I;  2DDF A;  4JIJ A;  2WOA A;  4GWM A;  1S4B P;  1ZXC A;  3LJG A;  4PKT A;  3ZXH A;  2Y6C A;  3HDB A;  4H3X A;  2ERP A;  1JIZ A;  1XFY A;  4GQL A;  4I35 A;  2L0R A;  1USN A;  4L19 A;  3DTI A;  1JKY A;  3LJZ A;  2CKI A;  1CGE A;  4AUO A;  1CQR A;  2JSD A;  3LMC A;  2OXW A;  2W0D A;  2O3E A;  2W13 A;  2DW1 A;  3EHX A;  1YP1 A;  4XCT A;  1BUD A;  1QIC A;  1BUV M;  1D5J A;  3MA2 A;  4CTH A;  3CKI A;  4PKW A;  3K7N A;  2YB9 A;  1BSW A;  1R55 A;  3DWB A;  4HMA A;  456C A;  2J83 A;  3F16 A;  4ILW D;  1HTD A;  5D7W A;  2OI0 A;  2ERO A;  1G9K A;  1QUA A;  1OM8 A;  2OXZ A;  2PJT A;  5CZM A;  5I0L A;  4J4M A;  5CUH A;  3BA0 A;  3WV1 A;  1AST A;  1D8F A;  4WKE A;  1K7G A;  3P24 A;  2JT5 A;  1GE7 A;  1Y0V A;  3EDG A;  1D7X A;  5D1S A;  1HY7 A;  1GO7 P;  1XUC A;  3RTS A;  2O36 A;  4GUY A;  4GR3 A;  4A7B A;  1OO9 A;  1IAD A;  1KUI A;  1OS2 A;  1G49 A;  1O0Q A;  5BOT A;  1K7Q A;  3LJT A;  2A8H A;  2D1N A;  4DPE A;  1EUB A;  5I2Z A;  4IUW A;  1OM6 A;  2MZH A;  3HBV P;  3OHO A;  3F1A A;  2HU6 A;  2OW1 A;  2TCL A;  1BZS A;  1HV5 A;  2JIH A;  3LEA A;  3AYU A;  3HBU P;  4XBH A;  2AYK A;  5B5P A;  4L6T A;  1BM6 A;  3VI1 A;  4JA1 A;  2RJP A;  1QJJ A;  1ND1 A;  5D1U A;  1HFS A;  1PWU A;  1PWV A;  2AIG P;  3LK8 A;  1KBC A;  1MMR A;  1FM1 A;  4FXQ A;  1JAP A;  2DW2 A;  3N2U A;  3HB2 P;  2OVX A;  2FV5 A;  2USN A;  3KEK A;  2V4B A;  3HY7 A;  3Q2H A;  4L63 A;  1GXD A;  3LUM A;  1CXV A;  2Z2D A;  1CGF A;  2OZR A;  1I76 A;  1AKL A;  1RM8 A;  2DW0 A;  1G4K A;  3F19 A;  966C A;  4DD8 A;  2OY4 A;  1JIW P;  1ZTQ A;  1Z3J A;  4PKR A;  1UTT A;  4XM8 A;  1JAN A;  2X3B A;  4GR8 A;  3O64 A;  1BIW A;  1GO8 P;  3EDH A;  1SAT A;  3TSK A;  5D1T A;  2I47 A;  3K7L A;  3B92 A;  1A85 A;  2X7M A;  4FU4 A;  4DV8 A;  1Q3A A;  2XS4 A;  1CIZ A;  2MLS A;  2POJ A;  2QPJ A;  1MMB A;  4H49 A;  1C3I A;  4FVL A;  1BQQ M;  2X3C A;  4QKZ A;  3TS4 A;  5I3M A;  1GKC A;  1QIA A;  2N8R A;  2MZE A;  5BPA A;  1K7I A;  4GF1 A;  1CK7 A;  5H8X A;  5L7F A;  1G05 A;  3RTT A;  1C8T A;  5I12 A;  2SRT A;  1ROS A;  3HY9 A;  3O2X A;  3DSL A;  4AIG A;  1JK3 A;  3KWV C;  1R1I A;  1FBL A;  1IAB A;  4PKV A;  1XUR A;  2MLR A;  5B5O A;  1O0T A;  3LUN A;  4PKS A;  3EHY A;  3LIK A;  4XM6 A;  3DTK A;  1XUD A;  1B3D A;  1WNI A;  4JP4 A;  4WZV A;  2W12 A;  3AIG A;  1KAP P;  2D1O A;  3F15 A;  3LQB A;  3UVC A;  1CAQ A;  1EAK A;  4H84 A;  4H1Q A;  2Y6D A;  4WK7 A;  1Y8J A;  1QIB A;  1FLS A;  1HFC A;  4JPA A;  1XFV A;  2MZI A;  1GE5 A;  1KUH A;  4L7A A;  1ZP5 A;  2W15 A;  3SHI A;  3KME A;  4H82 A;  1B8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...