2JT5A

Solution structure of matrix metalloproteinase 3 (mmp-3) in the presence of n-hydroxy-2-[n-(2-hydroxyethyl)biphenyl-4-sulfonamide] hydroxamic acid (mlc88)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
161
structure length
161
Chain Sequence
GIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Stromelysin-1
publication title Matrix metalloproteinase-inhibitor interaction: the solution structure of the catalytic domain of human matrix metalloproteinase-3 with different inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 161
sequence length 161
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2jt5A00
4PKVA 1XFZA 1ROSA 4GR0A 966CA 2X3BA 1CGFA 1HTDA 1BQQM 3WV3A 2PJTA 4H84A 1ZVXA 5D1TA 5BOYA 1R55A 2W15A 1QICA 3K7LA 4Q1LA 4DPEA 5I12A 1EUBA 2WO9A 4XM6A 5BPAA 2XS4A 1Y0VA 2JSDA 4AYKA 1XFWA 3ZXHA 4GQLA 1I76A 3L0VA 1MMRA 3ZVSA 2OW0A 3KECA 4G9LA 4XM8A 1MMPA 4QKZA 5L7FA 2RJQA 3N2UA 1IADA 4WZVA 2CKIA 4PKTA 1S4BP 2QPJA 2Y6CA 4I03A 1ATLA 3TS4A 1PWQA 1G05A 5I4OA 2OZRA 4A7BA 1BSWA 1AYKA 3G5CA 1PWPA 4JQGA 3U1RA 1OO9A 1JAOA 2MLSA 3LK8A 3HDAP 4FXYP 1D7XA 1RM8A 1SU3A 3USNA 1ND1A 4PKQA 1HV5A 3NX7A 4ON1A 1HOVA 3LIKA 3KEJA 1KUKA 4I35A 1CGLA 1R54A 3EDHA 4H2EA 4JP4A 2J0TA 3Q2GA 3ELMA 3LQ0A 1SMPA 1GXDA 1IACA 2N8RA 3O2XA 2JT5A 830CA 1XFXA 4GF1A 1A86A 5CXAA 4GWMA 4L63A 1JANA 3KMCA 2W14A 3LGPA 2RJPA 2E2DA 2HU6A 1XFVA 3B92A 1I1IP 2OY2A 1SLMA 1GKDA 1KUFA 3P24A 1GE7A 1JKYA 1MMQA 1YQYA 1JAQA 4A3WA 2YB9A 3E8RA 3LQBA 1CQRA 2D1OA 3AIGA 2WO8A 3F15A 3F16A 1AKLA 4R3VA 2DW0A 3EHXA 3DSLA 1KBCA 1USNA 5LABA 2MZHA 3HY7A 1ZTQA 3AYKA 4HMAA 1CAQA 1IAAA 3I7IA 2WOAA 1H71P 4PKWA 1HY7A 3RTSA 3BA0A 2KRJA 2OW1A 2V4BA 1FM1A 3K7NA 3GBOA 1GKCA 1JIWP 2L0RA 2OY4A 5H8XA 2FV9A 4G0DA 2D1NA 1GE5A 3LJTA 2J83A 2I47A 4AUOA 1YOUA 5I0LA 1ZXCA 1XUDA 3LUMA 2CLTA 1OM6A 3L0TA 1XURA 1GE6A 1D8MA 1J7NA 3EDZA 2MZIA 5D1UA 1GO7P 1UTTA 1JIZA 3DWBA 1CK7A 1UEAA 2DW2A 2OXZA 3F18A 1C3IA 2O3EA 4ILWD 1KUHA 3TVCA 3UVCA 1YP1A 4L6TA 2JNPA 1FLSA 2O36A 4CTHA 4H76A 1SLNA 2W0DA 3HDBA 1JJ9A 3HBVP 2ERPA 1BM6A 3RTTA 4FXQA 4L19A 3DL1A 5D1SA 1OS2A 3DPFA 2OXWA 4H49A 3B8ZA 3TT4A 3VTGA 1CIZA 1UTZA 2AIGP 1EB6A 1B3DA 1GO8P 4WK7A 5I2ZA 4GR3A 1BKCE 1KAPP 1OS9A 1AF0A 3VI1A 1K7QA 2SRTA 1ASTA 4H3XA 1R1HA 1BUDA 1L6JA 2OI0A 3HYGA 1EAKA 3ZUKA 2W12A 4EFSA 4HX3A 3TSKA 1R1JA 5CZMA 2AYKA 4GR8A 4PKRA 1XFYA 4IUWA 1QIBA 1JAPA 2X3CA 2OXUA 1O0QA 1Y8JA 2Z2DA 3KRYA 1Z3JA 1QJJA 2USNA 4JIJA 3Q2HA 3HB2P 5D7WA 4PKUA 2DDFA 1B8YA 4IJOA 5L79A 1DTHA 1IAEA 1PWVA 3EDIA 3P1VA 4JA1A 1XUCA 4GUYA 1QJIA 3LEAA 4XM7A 5BOTA 1G4KA 4JPAA 2DW1A 1Y93A 1SATA 2OVXA 4DF9A 1CGEA 2X7MA 4AXQA 2MLRA 1QUAA 1WNIA 3KEKA 1PWWA 4FVLA 2XS3A 1OM7A 3I7GA 4XBHA 5I43A 4WKIA 4H1QA 4WKEA 3B2ZA 1K7GA 3LKAA 3SHIA 3EWJA 3KMEA 5D3CA 1UMSA 1FBLA 3OHLA 2Y6DA 1CXVA 1G49A 2JT6A 3LUNA 1BUVM 2OW9A 3WV1A 4DD8A 4FU4A 1D5JA 1QIAA 3G42A 3LILA 4J4MA 1IABA 3LE9A 2K9CA 1UMTA 1OM8A 4GWNA 1HFSA 1BKCI 1ZP5A 3WV2A 2FV5A 3HBUP 3LJGA 1Q3AA 3DNGA 4XCTA 2W13A 1ZS0A 3V96B 2POJA 1OMJA 2E3XA 2MZEA 2DDYA 5D2BA 1IAGA 1K7IA 2YIGA 1JH1A 1RMZA 4WF6A 1HFCA 3F19A 1KUIA 2A8HA 1MNCA 1MMBA 3N2VA 5B5OA 4DV8A 2OW2A 3F1AA 1JK3A 1BKCA 2EROA 1O0TA 3EHYA 1G9KA 2OVZA 2JIHA 4ZR5A 1BZSA 1DMTA 1C7KA 1KUGA 1SRPA 4H30A 3O64A 3DPEA 3MA2A 3KHIA 1ZXVA 3LIRA 4IN9A 3CKIA 1D8FA 2X3AA 5JMYA 1PWUA 3F17A 2TCLA 3LJZA 1BQOA 5CUHA 1YCMA 3KWVC 1G12A 2ERQA 3OHOA 1A85A 1C8TA 4PKSA 3HY9A 2K2GA 5I3MA 3AYUA 1R1IA 3LMCA 5B5PA 1XFUA 4H82A 1BIWA 3EDGA 1I73A 4AIGA 456CA
chains in the Genus database with same CATH superfamily
4PKVA 1XFZA 1ROSA 4GR0A 966CA 2X3BA 1CGFA 1HTDA 1BQQM 3WV3A 2PJTA 4H84A 1ZVXA 5D1TA 5BOYA 1R55A 2W15A 1QICA 3K7LA 4Q1LA 4DPEA 5I12A 1EUBA 2WO9A 4XM6A 5BPAA 2XS4A 1Y0VA 2JSDA 4AYKA 1XFWA 3ZXHA 4GQLA 1I76A 3L0VA 1MMRA 3ZVSA 2OW0A 3KECA 4G9LA 4XM8A 1MMPA 4QKZA 5L7FA 1TVIA 2RJQA 3N2UA 1IADA 4WZVA 2CKIA 4PKTA 1S4BP 2QPJA 2Y6CA 4I03A 1ATLA 3TS4A 1PWQA 1G05A 5I4OA 2OZRA 4A7BA 1BSWA 1AYKA 3G5CA 1PWPA 4JQGA 3U1RA 1OO9A 1JAOA 2MLSA 3LK8A 3HDAP 4FXYP 1D7XA 1RM8A 1SU3A 3USNA 1ND1A 4PKQA 1HV5A 3NX7A 4ON1A 1HOVA 3LIKA 3KEJA 1KUKA 4I35A 1CGLA 1R54A 3EDHA 4H2EA 4JP4A 2J0TA 3Q2GA 3ELMA 3LQ0A 1SMPA 1GXDA 1IACA 2N8RA 3O2XA 2JT5A 830CA 1XFXA 4GF1A 1A86A 5CXAA 4GWMA 4L63A 1JANA 3KMCA 2W14A 3LGPA 2RJPA 2E2DA 2HU6A 1XFVA 3B92A 1I1IP 2OY2A 1SLMA 1GKDA 1KUFA 3P24A 1GE7A 1JKYA 1MMQA 1YQYA 1JAQA 4A3WA 2YB9A 3E8RA 3LQBA 1CQRA 2D1OA 3AIGA 2WO8A 3F15A 3F16A 4L7AA 1AKLA 4R3VA 2DW0A 3EHXA 3DSLA 1KBCA 1USNA 1XM5A 5LABA 2MZHA 3HY7A 1ZTQA 3AYKA 4HMAA 1CAQA 1IAAA 3I7IA 2WOAA 1H71P 4PKWA 1HY7A 3RTSA 3BA0A 2KRJA 2OW1A 2V4BA 1FM1A 3K7NA 3GBOA 1GKCA 1JIWP 2L0RA 2OY4A 5H8XA 2FV9A 4G0DA 2D1NA 1GE5A 3LJTA 2J83A 2I47A 4AUOA 1YOUA 5I0LA 1ZXCA 1XUDA 3LUMA 2CLTA 1OM6A 3L0TA 2YUFA 1XURA 1GE6A 1D8MA 1J7NA 3EDZA 2MZIA 5D1UA 1GO7P 1UTTA 1JIZA 3DWBA 1CK7A 1UEAA 2DW2A 2OXZA 3F18A 1C3IA 2O3EA 1XAXA 4ILWD 1KUHA 3TVCA 3UVCA 1YP1A 4L6TA 2JNPA 1FLSA 2O36A 4CTHA 4H76A 1SLNA 2W0DA 3HDBA 1JJ9A 3HBVP 2ERPA 1BM6A 3RTTA 4FXQA 4L19A 3DL1A 5D1SA 1OS2A 3DPFA 2OXWA 4H49A 3B8ZA 3TT4A 3VTGA 1CIZA 1UTZA 2AIGP 1EB6A 1B3DA 1GO8P 4WK7A 5I2ZA 4GR3A 1BKCE 1KAPP 1OS9A 1AF0A 3VI1A 1K7QA 2SRTA 1ASTA 4H3XA 1R1HA 1BUDA 1L6JA 2OI0A 3HYGA 1EAKA 3ZUKA 2W12A 4EFSA 4HX3A 3TSKA 1R1JA 5CZMA 2AYKA 4GR8A 4PKRA 1XFYA 4IUWA 1QIBA 1JAPA 2X3CA 2OXUA 1O0QA 1Y8JA 2Z2DA 3KRYA 1Z3JA 1QJJA 2USNA 4JIJA 3Q2HA 3HB2P 5D7WA 4PKUA 2DDFA 1B8YA 4IJOA 5L79A 1DTHA 1IAEA 1PWVA 3EDIA 3P1VA 4JA1A 1XUCA 4GUYA 1QJIA 3LEAA 4XM7A 5BOTA 1G4KA 1OZ9A 4JPAA 2DW1A 1Y93A 1SATA 2OVXA 4DF9A 1CGEA 2X7MA 4AXQA 2MLRA 1QUAA 1WNIA 3KEKA 1PWWA 4FVLA 2XS3A 1OM7A 3I7GA 4XBHA 5I43A 4WKIA 4H1QA 4WKEA 3B2ZA 1K7GA 3LKAA 3SHIA 3EWJA 3KMEA 5D3CA 1UMSA 1FBLA 3OHLA 2Y6DA 1CXVA 1G49A 2JT6A 3LUNA 1BUVM 2OW9A 3WV1A 4DD8A 4FU4A 1D5JA 1QIAA 3DTKA 3G42A 3LILA 4J4MA 1IABA 3LE9A 2K9CA 1UMTA 1OM8A 4GWNA 1HFSA 1BKCI 1ZP5A 3WV2A 2FV5A 3HBUP 3LJGA 1Q3AA 3DNGA 4XCTA 3DTEA 2W13A 1ZS0A 3V96B 2POJA 1OMJA 2E3XA 2MZEA 2DDYA 5D2BA 1IAGA 1K7IA 2YIGA 1JH1A 1RMZA 4WF6A 1HFCA 3F19A 1KUIA 2A8HA 1MNCA 1MMBA 3N2VA 5B5OA 4DV8A 2OW2A 3F1AA 1JK3A 1BKCA 2EROA 1O0TA 3EHYA 1G9KA 2OVZA 2JIHA 4ZR5A 1BZSA 1DMTA 1C7KA 1KUGA 1SRPA 4H30A 3O64A 3DPEA 3MA2A 3KHIA 1ZXVA 3LIRA 4IN9A 3CKIA 1D8FA 2X3AA 5JMYA 1PWUA 3DTIA 3F17A 2TCLA 3LJZA 1BQOA 5CUHA 1YCMA 3KWVC 1G12A 2ERQA 3OHOA 1A85A 1C8TA 4PKSA 3HY9A 2K2GA 5I3MA 3AYUA 1R1IA 3LMCA 5B5PA 1XFUA 4H82A 1BIWA 3EDGA 1I73A 4AIGA 456CA
chains in the Genus database with same CATH topology
4PKVA 1XFZA 1ROSA 4GR0A 966CA 2X3BA 1CGFA 1HTDA 1BQQM 3WV3A 2PJTA 4H84A 1ZVXA 5D1TA 5BOYA 1R55A 2W15A 1QICA 3K7LA 4Q1LA 4DPEA 5I12A 1EUBA 2WO9A 4XM6A 5BPAA 2XS4A 1Y0VA 2JSDA 4AYKA 1XFWA 3ZXHA 4GQLA 1I76A 3L0VA 1MMRA 3ZVSA 2OW0A 3KECA 4G9LA 4XM8A 1MMPA 4QKZA 5L7FA 2RJQA 3N2UA 1IADA 4WZVA 2CKIA 4PKTA 1S4BP 2QPJA 2Y6CA 4I03A 1ATLA 3TS4A 1PWQA 1G05A 5I4OA 2OZRA 4A7BA 1BSWA 1AYKA 3G5CA 1PWPA 4JQGA 3U1RA 1OO9A 1JAOA 2MLSA 3LK8A 3HDAP 4FXYP 1D7XA 1RM8A 1SU3A 3USNA 1ND1A 4PKQA 1HV5A 3NX7A 4ON1A 1HOVA 3LIKA 3KEJA 1KUKA 4I35A 1CGLA 1R54A 3EDHA 4H2EA 4JP4A 2J0TA 3Q2GA 3ELMA 3LQ0A 1SMPA 1GXDA 1IACA 2N8RA 3O2XA 2JT5A 830CA 1XFXA 4GF1A 1A86A 5CXAA 4GWMA 4L63A 1JANA 3KMCA 2W14A 3LGPA 2RJPA 2E2DA 2HU6A 1XFVA 3B92A 1I1IP 2OY2A 1SLMA 1GKDA 1KUFA 3P24A 1GE7A 1JKYA 1MMQA 1YQYA 1JAQA 4A3WA 2YB9A 3E8RA 3LQBA 1CQRA 2D1OA 3AIGA 2WO8A 3F15A 3F16A 4L7AA 1AKLA 4R3VA 2DW0A 3EHXA 3DSLA 1KBCA 1USNA 5LABA 2MZHA 3HY7A 1ZTQA 3AYKA 4HMAA 1CAQA 1IAAA 3I7IA 2WOAA 1H71P 4PKWA 1HY7A 3RTSA 3BA0A 2KRJA 2OW1A 2V4BA 1FM1A 3K7NA 3GBOA 1GKCA 1JIWP 2L0RA 2OY4A 5H8XA 2FV9A 4G0DA 2D1NA 1GE5A 3LJTA 2J83A 2I47A 4AUOA 1YOUA 5I0LA 1ZXCA 1XUDA 3LUMA 2CLTA 1OM6A 3L0TA 2YUFA 1XURA 1GE6A 1D8MA 1J7NA 3EDZA 2MZIA 5D1UA 1GO7P 1UTTA 1JIZA 3DWBA 1CK7A 1UEAA 2DW2A 2OXZA 3F18A 1C3IA 2O3EA 4ILWD 1KUHA 3TVCA 3UVCA 1YP1A 4L6TA 2JNPA 1FLSA 2O36A 4CTHA 4H76A 1SLNA 2W0DA 3HDBA 1JJ9A 3HBVP 2ERPA 1BM6A 3RTTA 4FXQA 4L19A 3DL1A 5D1SA 1OS2A 3DPFA 2OXWA 4H49A 3B8ZA 3TT4A 3VTGA 1CIZA 1UTZA 2AIGP 1EB6A 1B3DA 1GO8P 4WK7A 5I2ZA 4GR3A 1BKCE 1KAPP 1OS9A 1AF0A 3VI1A 1K7QA 2SRTA 1ASTA 4H3XA 1R1HA 1BUDA 1L6JA 2OI0A 3HYGA 1EAKA 3ZUKA 2W12A 4EFSA 4HX3A 3TSKA 1R1JA 5CZMA 2AYKA 4GR8A 4PKRA 1XFYA 4IUWA 1QIBA 1JAPA 2X3CA 2OXUA 1O0QA 1Y8JA 2Z2DA 3KRYA 1Z3JA 1QJJA 2USNA 4JIJA 3Q2HA 3HB2P 5D7WA 4PKUA 2DDFA 1B8YA 4IJOA 5L79A 1DTHA 1IAEA 1PWVA 3EDIA 3P1VA 4JA1A 1XUCA 4GUYA 1QJIA 3LEAA 4XM7A 5BOTA 1G4KA 4JPAA 2DW1A 1Y93A 1SATA 2OVXA 4DF9A 1CGEA 2X7MA 4AXQA 2MLRA 1QUAA 1WNIA 3KEKA 1PWWA 4FVLA 2XS3A 1OM7A 3I7GA 4XBHA 5I43A 4WKIA 4H1QA 4WKEA 3B2ZA 1K7GA 3LKAA 3SHIA 3EWJA 3KMEA 5D3CA 1UMSA 1FBLA 3OHLA 2Y6DA 1CXVA 1G49A 2JT6A 3LUNA 1BUVM 2OW9A 3WV1A 4DD8A 4FU4A 1D5JA 1QIAA 3DTKA 3G42A 3LILA 4J4MA 1IABA 3LE9A 2K9CA 1UMTA 1OM8A 4GWNA 1HFSA 1BKCI 1ZP5A 3WV2A 2FV5A 3HBUP 3LJGA 1Q3AA 3DNGA 4XCTA 3DTEA 2W13A 1ZS0A 3V96B 2POJA 1OMJA 2E3XA 2MZEA 2DDYA 5D2BA 1IAGA 1K7IA 2YIGA 1JH1A 1RMZA 4WF6A 1HFCA 3F19A 1KUIA 2A8HA 1MNCA 1MMBA 3N2VA 5B5OA 4DV8A 2OW2A 3F1AA 1JK3A 1BKCA 2EROA 1O0TA 3EHYA 1G9KA 2OVZA 2JIHA 4ZR5A 1BZSA 1DMTA 1C7KA 1KUGA 1SRPA 4H30A 3O64A 3DPEA 3MA2A 3KHIA 1ZXVA 3LIRA 4IN9A 3CKIA 1D8FA 2X3AA 5JMYA 1PWUA 3DTIA 3F17A 2TCLA 3LJZA 1BQOA 5CUHA 1YCMA 3KWVC 1G12A 2ERQA 3OHOA 1A85A 1C8TA 4PKSA 3HY9A 2K2GA 5I3MA 3AYUA 1R1IA 3LMCA 5B5PA 1XFUA 4H82A 1BIWA 3EDGA 1I73A 4AIGA 456CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKV A;  1XFZ A;  1ROS A;  4GR0 A;  966C A;  2X3B A;  1CGF A;  1HTD A;  1BQQ M;  3WV3 A;  2PJT A;  4H84 A;  1ZVX A;  5D1T A;  5BOY A;  1R55 A;  2W15 A;  1QIC A;  3K7L A;  4Q1L A;  4DPE A;  5I12 A;  1EUB A;  2WO9 A;  4XM6 A;  5BPA A;  2XS4 A;  1Y0V A;  2JSD A;  4AYK A;  1XFW A;  3ZXH A;  4GQL A;  1I76 A;  3L0V A;  1MMR A;  3ZVS A;  2OW0 A;  3KEC A;  4G9L A;  4XM8 A;  1MMP A;  4QKZ A;  5L7F A;  2RJQ A;  3N2U A;  1IAD A;  4WZV A;  2CKI A;  4PKT A;  1S4B P;  2QPJ A;  2Y6C A;  4I03 A;  1ATL A;  3TS4 A;  1PWQ A;  1G05 A;  5I4O A;  2OZR A;  4A7B A;  1BSW A;  1AYK A;  3G5C A;  1PWP A;  4JQG A;  3U1R A;  1OO9 A;  1JAO A;  2MLS A;  3LK8 A;  3HDA P;  4FXY P;  1D7X A;  1RM8 A;  1SU3 A;  3USN A;  1ND1 A;  4PKQ A;  1HV5 A;  3NX7 A;  4ON1 A;  1HOV A;  3LIK A;  3KEJ A;  1KUK A;  4I35 A;  1CGL A;  1R54 A;  3EDH A;  4H2E A;  4JP4 A;  2J0T A;  3Q2G A;  3ELM A;  3LQ0 A;  1SMP A;  1GXD A;  1IAC A;  2N8R A;  3O2X A;  2JT5 A;  830C A;  1XFX A;  4GF1 A;  1A86 A;  5CXA A;  4GWM A;  4L63 A;  1JAN A;  3KMC A;  2W14 A;  3LGP A;  2RJP A;  2E2D A;  2HU6 A;  1XFV A;  3B92 A;  1I1I P;  2OY2 A;  1SLM A;  1GKD A;  1KUF A;  3P24 A;  1GE7 A;  1JKY A;  1MMQ A;  1YQY A;  1JAQ A;  4A3W A;  2YB9 A;  3E8R A;  3LQB A;  1CQR A;  2D1O A;  3AIG A;  2WO8 A;  3F15 A;  3F16 A;  1AKL A;  4R3V A;  2DW0 A;  3EHX A;  3DSL A;  1KBC A;  1USN A;  5LAB A;  2MZH A;  3HY7 A;  1ZTQ A;  3AYK A;  4HMA A;  1CAQ A;  1IAA A;  3I7I A;  2WOA A;  1H71 P;  4PKW A;  1HY7 A;  3RTS A;  3BA0 A;  2KRJ A;  2OW1 A;  2V4B A;  1FM1 A;  3K7N A;  3GBO A;  1GKC A;  1JIW P;  2L0R A;  2OY4 A;  5H8X A;  2FV9 A;  4G0D A;  2D1N A;  1GE5 A;  3LJT A;  2J83 A;  2I47 A;  4AUO A;  1YOU A;  5I0L A;  1ZXC A;  1XUD A;  3LUM A;  2CLT A;  1OM6 A;  3L0T A;  1XUR A;  1GE6 A;  1D8M A;  1J7N A;  3EDZ A;  2MZI A;  5D1U A;  1GO7 P;  1UTT A;  1JIZ A;  3DWB A;  1CK7 A;  1UEA A;  2DW2 A;  2OXZ A;  3F18 A;  1C3I A;  2O3E A;  4ILW D;  1KUH A;  3TVC A;  3UVC A;  1YP1 A;  4L6T A;  2JNP A;  1FLS A;  2O36 A;  4CTH A;  4H76 A;  1SLN A;  2W0D A;  3HDB A;  1JJ9 A;  3HBV P;  2ERP A;  1BM6 A;  3RTT A;  4FXQ A;  4L19 A;  3DL1 A;  5D1S A;  1OS2 A;  3DPF A;  2OXW A;  4H49 A;  3B8Z A;  3TT4 A;  3VTG A;  1CIZ A;  1UTZ A;  2AIG P;  1EB6 A;  1B3D A;  1GO8 P;  4WK7 A;  5I2Z A;  4GR3 A;  1BKC E;  1KAP P;  1OS9 A;  1AF0 A;  3VI1 A;  1K7Q A;  2SRT A;  1AST A;  4H3X A;  1R1H A;  1BUD A;  1L6J A;  2OI0 A;  3HYG A;  1EAK A;  3ZUK A;  2W12 A;  4EFS A;  4HX3 A;  3TSK A;  1R1J A;  5CZM A;  2AYK A;  4GR8 A;  4PKR A;  1XFY A;  4IUW A;  1QIB A;  1JAP A;  2X3C A;  2OXU A;  1O0Q A;  1Y8J A;  2Z2D A;  3KRY A;  1Z3J A;  1QJJ A;  2USN A;  4JIJ A;  3Q2H A;  3HB2 P;  5D7W A;  4PKU A;  2DDF A;  1B8Y A;  4IJO A;  5L79 A;  1DTH A;  1IAE A;  1PWV A;  3EDI A;  3P1V A;  4JA1 A;  1XUC A;  4GUY A;  1QJI A;  3LEA A;  4XM7 A;  5BOT A;  1G4K A;  4JPA A;  2DW1 A;  1Y93 A;  1SAT A;  2OVX A;  4DF9 A;  1CGE A;  2X7M A;  4AXQ A;  2MLR A;  1QUA A;  1WNI A;  3KEK A;  1PWW A;  4FVL A;  2XS3 A;  1OM7 A;  3I7G A;  4XBH A;  5I43 A;  4WKI A;  4H1Q A;  4WKE A;  3B2Z A;  1K7G A;  3LKA A;  3SHI A;  3EWJ A;  3KME A;  5D3C A;  1UMS A;  1FBL A;  3OHL A;  2Y6D A;  1CXV A;  1G49 A;  2JT6 A;  3LUN A;  1BUV M;  2OW9 A;  3WV1 A;  4DD8 A;  4FU4 A;  1D5J A;  1QIA A;  3G42 A;  3LIL A;  4J4M A;  1IAB A;  3LE9 A;  2K9C A;  1UMT A;  1OM8 A;  4GWN A;  1HFS A;  1BKC I;  1ZP5 A;  3WV2 A;  2FV5 A;  3HBU P;  3LJG A;  1Q3A A;  3DNG A;  4XCT A;  2W13 A;  1ZS0 A;  3V96 B;  2POJ A;  1OMJ A;  2E3X A;  2MZE A;  2DDY A;  5D2B A;  1IAG A;  1K7I A;  2YIG A;  1JH1 A;  1RMZ A;  4WF6 A;  1HFC A;  3F19 A;  1KUI A;  2A8H A;  1MNC A;  1MMB A;  3N2V A;  5B5O A;  4DV8 A;  2OW2 A;  3F1A A;  1JK3 A;  1BKC A;  2ERO A;  1O0T A;  3EHY A;  1G9K A;  2OVZ A;  2JIH A;  4ZR5 A;  1BZS A;  1DMT A;  1C7K A;  1KUG A;  1SRP A;  4H30 A;  3O64 A;  3DPE A;  3MA2 A;  3KHI A;  1ZXV A;  3LIR A;  4IN9 A;  3CKI A;  1D8F A;  2X3A A;  5JMY A;  1PWU A;  3F17 A;  2TCL A;  3LJZ A;  1BQO A;  5CUH A;  1YCM A;  3KWV C;  1G12 A;  2ERQ A;  3OHO A;  1A85 A;  1C8T A;  4PKS A;  3HY9 A;  2K2G A;  5I3M A;  3AYU A;  1R1I A;  3LMC A;  5B5P A;  1XFU A;  4H82 A;  1BIW A;  3EDG A;  1I73 A;  4AIG A;  456C A; 
#chains in the Genus database with same CATH topology
 4PKV A;  1XFZ A;  1ROS A;  4GR0 A;  966C A;  2X3B A;  1CGF A;  1HTD A;  1BQQ M;  3WV3 A;  2PJT A;  4H84 A;  1ZVX A;  5D1T A;  5BOY A;  1R55 A;  2W15 A;  1QIC A;  3K7L A;  4Q1L A;  4DPE A;  5I12 A;  1EUB A;  2WO9 A;  4XM6 A;  5BPA A;  2XS4 A;  1Y0V A;  2JSD A;  4AYK A;  1XFW A;  3ZXH A;  4GQL A;  1I76 A;  3L0V A;  1MMR A;  3ZVS A;  2OW0 A;  3KEC A;  4G9L A;  4XM8 A;  1MMP A;  4QKZ A;  5L7F A;  1TVI A;  2RJQ A;  3N2U A;  1IAD A;  4WZV A;  2CKI A;  4PKT A;  1S4B P;  2QPJ A;  2Y6C A;  4I03 A;  1ATL A;  3TS4 A;  1PWQ A;  1G05 A;  5I4O A;  2OZR A;  4A7B A;  1BSW A;  1AYK A;  3G5C A;  1PWP A;  4JQG A;  3U1R A;  1OO9 A;  1JAO A;  2MLS A;  3LK8 A;  3HDA P;  4FXY P;  1D7X A;  1RM8 A;  1SU3 A;  3USN A;  1ND1 A;  4PKQ A;  1HV5 A;  3NX7 A;  4ON1 A;  1HOV A;  3LIK A;  3KEJ A;  1KUK A;  4I35 A;  1CGL A;  1R54 A;  3EDH A;  4H2E A;  4JP4 A;  2J0T A;  3Q2G A;  3ELM A;  3LQ0 A;  1SMP A;  1GXD A;  1IAC A;  2N8R A;  3O2X A;  2JT5 A;  830C A;  1XFX A;  4GF1 A;  1A86 A;  5CXA A;  4GWM A;  4L63 A;  1JAN A;  3KMC A;  2W14 A;  3LGP A;  2RJP A;  2E2D A;  2HU6 A;  1XFV A;  3B92 A;  1I1I P;  2OY2 A;  1SLM A;  1GKD A;  1KUF A;  3P24 A;  1GE7 A;  1JKY A;  1MMQ A;  1YQY A;  1JAQ A;  4A3W A;  2YB9 A;  3E8R A;  3LQB A;  1CQR A;  2D1O A;  3AIG A;  2WO8 A;  3F15 A;  3F16 A;  4L7A A;  1AKL A;  4R3V A;  2DW0 A;  3EHX A;  3DSL A;  1KBC A;  1USN A;  1XM5 A;  5LAB A;  2MZH A;  3HY7 A;  1ZTQ A;  3AYK A;  4HMA A;  1CAQ A;  1IAA A;  3I7I A;  2WOA A;  1H71 P;  4PKW A;  1HY7 A;  3RTS A;  3BA0 A;  2KRJ A;  2OW1 A;  2V4B A;  1FM1 A;  3K7N A;  3GBO A;  1GKC A;  1JIW P;  2L0R A;  2OY4 A;  5H8X A;  2FV9 A;  4G0D A;  2D1N A;  1GE5 A;  3LJT A;  2J83 A;  2I47 A;  4AUO A;  1YOU A;  5I0L A;  1ZXC A;  1XUD A;  3LUM A;  2CLT A;  1OM6 A;  3L0T A;  2YUF A;  1XUR A;  1GE6 A;  1D8M A;  1J7N A;  3EDZ A;  2MZI A;  5D1U A;  1GO7 P;  1UTT A;  1JIZ A;  3DWB A;  1CK7 A;  1UEA A;  2DW2 A;  2OXZ A;  3F18 A;  1C3I A;  2O3E A;  1XAX A;  4ILW D;  1KUH A;  3TVC A;  3UVC A;  1YP1 A;  4L6T A;  2JNP A;  1FLS A;  2O36 A;  4CTH A;  4H76 A;  1SLN A;  2W0D A;  3HDB A;  1JJ9 A;  3HBV P;  2ERP A;  1BM6 A;  3RTT A;  4FXQ A;  4L19 A;  3DL1 A;  5D1S A;  1OS2 A;  3DPF A;  2OXW A;  4H49 A;  3B8Z A;  3TT4 A;  3VTG A;  1CIZ A;  1UTZ A;  2AIG P;  1EB6 A;  1B3D A;  1GO8 P;  4WK7 A;  5I2Z A;  4GR3 A;  1BKC E;  1KAP P;  1OS9 A;  1AF0 A;  3VI1 A;  1K7Q A;  2SRT A;  1AST A;  4H3X A;  1R1H A;  1BUD A;  1L6J A;  2OI0 A;  3HYG A;  1EAK A;  3ZUK A;  2W12 A;  4EFS A;  4HX3 A;  3TSK A;  1R1J A;  5CZM A;  2AYK A;  4GR8 A;  4PKR A;  1XFY A;  4IUW A;  1QIB A;  1JAP A;  2X3C A;  2OXU A;  1O0Q A;  1Y8J A;  2Z2D A;  3KRY A;  1Z3J A;  1QJJ A;  2USN A;  4JIJ A;  3Q2H A;  3HB2 P;  5D7W A;  4PKU A;  2DDF A;  1B8Y A;  4IJO A;  5L79 A;  1DTH A;  1IAE A;  1PWV A;  3EDI A;  3P1V A;  4JA1 A;  1XUC A;  4GUY A;  1QJI A;  3LEA A;  4XM7 A;  5BOT A;  1G4K A;  1OZ9 A;  4JPA A;  2DW1 A;  1Y93 A;  1SAT A;  2OVX A;  4DF9 A;  1CGE A;  2X7M A;  4AXQ A;  2MLR A;  1QUA A;  1WNI A;  3KEK A;  1PWW A;  4FVL A;  2XS3 A;  1OM7 A;  3I7G A;  4XBH A;  5I43 A;  4WKI A;  4H1Q A;  4WKE A;  3B2Z A;  1K7G A;  3LKA A;  3SHI A;  3EWJ A;  3KME A;  5D3C A;  1UMS A;  1FBL A;  3OHL A;  2Y6D A;  1CXV A;  1G49 A;  2JT6 A;  3LUN A;  1BUV M;  2OW9 A;  3WV1 A;  4DD8 A;  4FU4 A;  1D5J A;  1QIA A;  3DTK A;  3G42 A;  3LIL A;  4J4M A;  1IAB A;  3LE9 A;  2K9C A;  1UMT A;  1OM8 A;  4GWN A;  1HFS A;  1BKC I;  1ZP5 A;  3WV2 A;  2FV5 A;  3HBU P;  3LJG A;  1Q3A A;  3DNG A;  4XCT A;  3DTE A;  2W13 A;  1ZS0 A;  3V96 B;  2POJ A;  1OMJ A;  2E3X A;  2MZE A;  2DDY A;  5D2B A;  1IAG A;  1K7I A;  2YIG A;  1JH1 A;  1RMZ A;  4WF6 A;  1HFC A;  3F19 A;  1KUI A;  2A8H A;  1MNC A;  1MMB A;  3N2V A;  5B5O A;  4DV8 A;  2OW2 A;  3F1A A;  1JK3 A;  1BKC A;  2ERO A;  1O0T A;  3EHY A;  1G9K A;  2OVZ A;  2JIH A;  4ZR5 A;  1BZS A;  1DMT A;  1C7K A;  1KUG A;  1SRP A;  4H30 A;  3O64 A;  3DPE A;  3MA2 A;  3KHI A;  1ZXV A;  3LIR A;  4IN9 A;  3CKI A;  1D8F A;  2X3A A;  5JMY A;  1PWU A;  3DTI A;  3F17 A;  2TCL A;  3LJZ A;  1BQO A;  5CUH A;  1YCM A;  3KWV C;  1G12 A;  2ERQ A;  3OHO A;  1A85 A;  1C8T A;  4PKS A;  3HY9 A;  2K2G A;  5I3M A;  3AYU A;  1R1I A;  3LMC A;  5B5P A;  1XFU A;  4H82 A;  1BIW A;  3EDG A;  1I73 A;  4AIG A;  456C A; 
#chains in the Genus database with same CATH homology
 4PKV A;  1XFZ A;  1ROS A;  4GR0 A;  966C A;  2X3B A;  1CGF A;  1HTD A;  1BQQ M;  3WV3 A;  2PJT A;  4H84 A;  1ZVX A;  5D1T A;  5BOY A;  1R55 A;  2W15 A;  1QIC A;  3K7L A;  4Q1L A;  4DPE A;  5I12 A;  1EUB A;  2WO9 A;  4XM6 A;  5BPA A;  2XS4 A;  1Y0V A;  2JSD A;  4AYK A;  1XFW A;  3ZXH A;  4GQL A;  1I76 A;  3L0V A;  1MMR A;  3ZVS A;  2OW0 A;  3KEC A;  4G9L A;  4XM8 A;  1MMP A;  4QKZ A;  5L7F A;  2RJQ A;  3N2U A;  1IAD A;  4WZV A;  2CKI A;  4PKT A;  1S4B P;  2QPJ A;  2Y6C A;  4I03 A;  1ATL A;  3TS4 A;  1PWQ A;  1G05 A;  5I4O A;  2OZR A;  4A7B A;  1BSW A;  1AYK A;  3G5C A;  1PWP A;  4JQG A;  3U1R A;  1OO9 A;  1JAO A;  2MLS A;  3LK8 A;  3HDA P;  4FXY P;  1D7X A;  1RM8 A;  1SU3 A;  3USN A;  1ND1 A;  4PKQ A;  1HV5 A;  3NX7 A;  4ON1 A;  1HOV A;  3LIK A;  3KEJ A;  1KUK A;  4I35 A;  1CGL A;  1R54 A;  3EDH A;  4H2E A;  4JP4 A;  2J0T A;  3Q2G A;  3ELM A;  3LQ0 A;  1SMP A;  1GXD A;  1IAC A;  2N8R A;  3O2X A;  2JT5 A;  830C A;  1XFX A;  4GF1 A;  1A86 A;  5CXA A;  4GWM A;  4L63 A;  1JAN A;  3KMC A;  2W14 A;  3LGP A;  2RJP A;  2E2D A;  2HU6 A;  1XFV A;  3B92 A;  1I1I P;  2OY2 A;  1SLM A;  1GKD A;  1KUF A;  3P24 A;  1GE7 A;  1JKY A;  1MMQ A;  1YQY A;  1JAQ A;  4A3W A;  2YB9 A;  3E8R A;  3LQB A;  1CQR A;  2D1O A;  3AIG A;  2WO8 A;  3F15 A;  3F16 A;  4L7A A;  1AKL A;  4R3V A;  2DW0 A;  3EHX A;  3DSL A;  1KBC A;  1USN A;  5LAB A;  2MZH A;  3HY7 A;  1ZTQ A;  3AYK A;  4HMA A;  1CAQ A;  1IAA A;  3I7I A;  2WOA A;  1H71 P;  4PKW A;  1HY7 A;  3RTS A;  3BA0 A;  2KRJ A;  2OW1 A;  2V4B A;  1FM1 A;  3K7N A;  3GBO A;  1GKC A;  1JIW P;  2L0R A;  2OY4 A;  5H8X A;  2FV9 A;  4G0D A;  2D1N A;  1GE5 A;  3LJT A;  2J83 A;  2I47 A;  4AUO A;  1YOU A;  5I0L A;  1ZXC A;  1XUD A;  3LUM A;  2CLT A;  1OM6 A;  3L0T A;  2YUF A;  1XUR A;  1GE6 A;  1D8M A;  1J7N A;  3EDZ A;  2MZI A;  5D1U A;  1GO7 P;  1UTT A;  1JIZ A;  3DWB A;  1CK7 A;  1UEA A;  2DW2 A;  2OXZ A;  3F18 A;  1C3I A;  2O3E A;  4ILW D;  1KUH A;  3TVC A;  3UVC A;  1YP1 A;  4L6T A;  2JNP A;  1FLS A;  2O36 A;  4CTH A;  4H76 A;  1SLN A;  2W0D A;  3HDB A;  1JJ9 A;  3HBV P;  2ERP A;  1BM6 A;  3RTT A;  4FXQ A;  4L19 A;  3DL1 A;  5D1S A;  1OS2 A;  3DPF A;  2OXW A;  4H49 A;  3B8Z A;  3TT4 A;  3VTG A;  1CIZ A;  1UTZ A;  2AIG P;  1EB6 A;  1B3D A;  1GO8 P;  4WK7 A;  5I2Z A;  4GR3 A;  1BKC E;  1KAP P;  1OS9 A;  1AF0 A;  3VI1 A;  1K7Q A;  2SRT A;  1AST A;  4H3X A;  1R1H A;  1BUD A;  1L6J A;  2OI0 A;  3HYG A;  1EAK A;  3ZUK A;  2W12 A;  4EFS A;  4HX3 A;  3TSK A;  1R1J A;  5CZM A;  2AYK A;  4GR8 A;  4PKR A;  1XFY A;  4IUW A;  1QIB A;  1JAP A;  2X3C A;  2OXU A;  1O0Q A;  1Y8J A;  2Z2D A;  3KRY A;  1Z3J A;  1QJJ A;  2USN A;  4JIJ A;  3Q2H A;  3HB2 P;  5D7W A;  4PKU A;  2DDF A;  1B8Y A;  4IJO A;  5L79 A;  1DTH A;  1IAE A;  1PWV A;  3EDI A;  3P1V A;  4JA1 A;  1XUC A;  4GUY A;  1QJI A;  3LEA A;  4XM7 A;  5BOT A;  1G4K A;  4JPA A;  2DW1 A;  1Y93 A;  1SAT A;  2OVX A;  4DF9 A;  1CGE A;  2X7M A;  4AXQ A;  2MLR A;  1QUA A;  1WNI A;  3KEK A;  1PWW A;  4FVL A;  2XS3 A;  1OM7 A;  3I7G A;  4XBH A;  5I43 A;  4WKI A;  4H1Q A;  4WKE A;  3B2Z A;  1K7G A;  3LKA A;  3SHI A;  3EWJ A;  3KME A;  5D3C A;  1UMS A;  1FBL A;  3OHL A;  2Y6D A;  1CXV A;  1G49 A;  2JT6 A;  3LUN A;  1BUV M;  2OW9 A;  3WV1 A;  4DD8 A;  4FU4 A;  1D5J A;  1QIA A;  3DTK A;  3G42 A;  3LIL A;  4J4M A;  1IAB A;  3LE9 A;  2K9C A;  1UMT A;  1OM8 A;  4GWN A;  1HFS A;  1BKC I;  1ZP5 A;  3WV2 A;  2FV5 A;  3HBU P;  3LJG A;  1Q3A A;  3DNG A;  4XCT A;  3DTE A;  2W13 A;  1ZS0 A;  3V96 B;  2POJ A;  1OMJ A;  2E3X A;  2MZE A;  2DDY A;  5D2B A;  1IAG A;  1K7I A;  2YIG A;  1JH1 A;  1RMZ A;  4WF6 A;  1HFC A;  3F19 A;  1KUI A;  2A8H A;  1MNC A;  1MMB A;  3N2V A;  5B5O A;  4DV8 A;  2OW2 A;  3F1A A;  1JK3 A;  1BKC A;  2ERO A;  1O0T A;  3EHY A;  1G9K A;  2OVZ A;  2JIH A;  4ZR5 A;  1BZS A;  1DMT A;  1C7K A;  1KUG A;  1SRP A;  4H30 A;  3O64 A;  3DPE A;  3MA2 A;  3KHI A;  1ZXV A;  3LIR A;  4IN9 A;  3CKI A;  1D8F A;  2X3A A;  5JMY A;  1PWU A;  3DTI A;  3F17 A;  2TCL A;  3LJZ A;  1BQO A;  5CUH A;  1YCM A;  3KWV C;  1G12 A;  2ERQ A;  3OHO A;  1A85 A;  1C8T A;  4PKS A;  3HY9 A;  2K2G A;  5I3M A;  3AYU A;  1R1I A;  3LMC A;  5B5P A;  1XFU A;  4H82 A;  1BIW A;  3EDG A;  1I73 A;  4AIG A;  456C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...