1GE6A

Zinc peptidase from grifola frondosa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
163
structure length
163
Chain Sequence
CSSSEQSALAAAASAAQSYVAESLSYLQTHTAATPRYTTWFGSYISSRHSTVLQHYTDMNSNDFSSYSFDCTCTAAGTFAYVYPNRFGTVYLCGAFWKAPTTGTDSQAGTLVHESSHFTRNGGTKDYAYGQAAAKSLATMDPDKAVMNADNHEYFSENNPAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PEPTIDYL-LYS METALLOENDOPEPTIDASE
publication title Structure of a new 'aspzincin' metalloendopeptidase from Grifola frondosa: implications for the catalytic mechanism and substrate specificity based on several different crystal forms.
pubmed doi rcsb
total genus 63
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.20: Peptidyl-Lys metalloendopeptidase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1ge6A00
1JIWP 3SHIA 2POJA 4L63A 4ILWD 1I1IP 3OHLA 2AIGP 2OXZA 5D3CA 2OW2A 3CKIA 4H82A 1PWWA 3L0VA 2HU6A 1ROSA 1CGEA 1JAQA 1ZS0A 1CIZA 1BM6A 1IABA 4Q1LA 3EDZA 4IUWA 3ZXHA 1IACA 4DPEA 1G4KA 4J4MA 3LEAA 3AYKA 3KRYA 1I73A 1BUDA 3EDHA 2OI0A 1BKCI 4H1QA 3ZVSA 2MLSA 1GE5A 5CZMA 2OZRA 3F17A 4G9LA 1OS2A 1Y93A 4R3VA 1KAPP 3EDGA 4GQLA 1GXDA 3ELMA 1A86A 5I3MA 2DW0A 3HY7A 4ZR5A 3F19A 1XFYA 2YIGA 2W15A 1ZXVA 1G9KA 4H49A 3LE9A 3NX7A 1HY7A 1C8TA 2D1NA 456CA 5D1SA 4AXQA 4WK7A 5BOTA 5B5OA 1A85A 3KHIA 1MMQA 1GE6A 4HMAA 2X7MA 4H30A 3P24A 1K7GA 5D7WA 4PKRA 2OY4A 3HBVP 1XFVA 4GWMA 1SLMA 3TVCA 2CLTA 1SU3A 3DNGA 1HV5A 1XFXA 3TS4A 4L19A 3N2VA 3EDIA 1D7XA 2W0DA 2DDFA 3USNA 3WV1A 4JQGA 4PKSA 1ZVXA 2WO9A 1SATA 1MMPA 3O64A 5I4OA 1JAOA 3GBOA 4XBHA 1JANA 1PWPA 1Y0VA 830CA 1ASTA 1GO7P 1R1IA 3Q2GA 2OXUA 1USNA 3TT4A 2K2GA 3UVCA 1MMBA 3DWBA 4HX3A 5I43A 1JKYA 3AIGA 2W13A 1OO9A 4FU4A 1SMPA 2QPJA 2Y6CA 1K7IA 2YB9A 3E8RA 1FM1A 1I76A 5LABA 2E2DA 4IN9A 2DW2A 3VTGA 4I03A 2Z2DA 1KUIA 3DL1A 1ATLA 3LILA 1CAQA 1SLNA 1BQQM 1MNCA 1XFUA 5B5PA 1G05A 3HYGA 2OW9A 1G49A 1DTHA 1RMZA 1OM8A 1UMTA 1CGLA 1D8MA 4XM8A 5BPAA 1YQYA 4FXQA 2USNA 3P1VA 1KUGA 4H2EA 3RTSA 1H71P 1YP1A 2OY2A 4IJOA 2ERQA 4PKTA 1K7QA 2J0TA 1CK7A 1UEAA 1C3IA 1FLSA 1BZSA 3LJGA 1OMJA 3LUNA 5D1UA 3LMCA 1L6JA 2J83A 1QUAA 4DD8A 1O0QA 1OM7A 3B2ZA 1S4BP 2OW1A 1BUVM 5D1TA 4H84A 4PKWA 3LJTA 3KMEA 3WV3A 3KEKA 2EROA 2K9CA 1BKCA 4JA1A 1RM8A 1GKDA 1QIBA 1R54A 1ZP5A 1PWQA 1FBLA 1HTDA 2V4BA 2OXWA 1XUCA 2SRTA 1B3DA 5CXAA 1HOVA 1PWVA 4FXYP 2MZEA 2JIHA 4XM6A 2ERPA 2XS3A 4QKZA 1EUBA 1CXVA 2OVXA 3HB2P 4A7BA 1GO8P 1KUKA 1OM6A 3KECA 2MZHA 2E3XA 1EAKA 4WKEA 4H3XA 3O2XA 1MMRA 3DSLA 4EFSA 1XFWA 2DW1A 1BKCE 5H8XA 2JNPA 2KRJA 1R1HA 4XCTA 2A8HA 4GR0A 3DPEA 2JSDA 1D8FA 1IAGA 4WZVA 2Y6DA 2FV5A 1KUHA 2RJPA 3HBUP 1XFZA 5BOYA 1JK3A 4GF1A 1KBCA 2I47A 1JH1A 4A3WA 4GR3A 2OVZA 1AYKA 4JP4A 3LIKA 2O3EA 1HFSA 3MA2A 3G5CA 1XURA 1ZXCA 4WKIA 1O0TA 2W14A 5L7FA 1ZTQA 3LGPA 3F15A 4CTHA 1JIZA 3B8ZA 3HDBA 3LUMA 3RTTA 4AYKA 2N8RA 1D5JA 3F18A 3HY9A 5CUHA 3LKAA 1Q3AA 1BSWA 3EHYA 4I35A 3LK8A 2JT6A 3AYUA 3I7IA 1AKLA 4GUYA 1WNIA 1Y8JA 3K7NA 1EB6A 4L6TA 3F1AA 3HDAP 3ZUKA 5L79A 1CGFA 2TCLA 1YCMA 2CKIA 2L0RA 4WF6A 1R1JA 2X3BA 1JJ9A 3V96B 2MLRA 1YOUA 4AIGA 2XS4A 1UTTA 3Q2HA 3G42A 3B92A 4JPAA 2RJQA 1IAEA 2PJTA 4H76A 966CA 1ND1A 2X3CA 1QJIA 3DPFA 4PKUA 3I7GA 1AF0A 3KMCA 1BQOA 5JMYA 1SRPA 1QICA 1UMSA 3LQBA 4XM7A 3N2UA 1C7KA 3TSKA 1B8YA 1R55A 3OHOA 5I12A 1JAPA 1BIWA 5I2ZA 2WO8A 1J7NA 2AYKA 3U1RA 3LIRA 3EHXA 3EWJA 4JIJA 2FV9A 3LQ0A 1GKCA 1DMTA 2OW0A 3KEJA 3LJZA 1CQRA 2MZIA 2O36A 1OS9A 4G0DA 4AUOA 1QIAA 1KUFA 3KWVC 2DDYA 2D1OA 4GWNA 5I0LA 4FVLA 4PKVA 1GE7A 1UTZA 1IADA 4GR8A 3BA0A 1Z3JA 4ON1A 5D2BA 3VI1A 4DV8A 3L0TA 1PWUA 1G12A 2W12A 3K7LA 1QJJA 2WOAA 4PKQA 2JT5A 1IAAA 3WV2A 1XUDA 1HFCA 4DF9A 2X3AA 3F16A
chains in the Genus database with same CATH superfamily
1JIWP 3SHIA 2POJA 4L63A 4ILWD 1TVIA 1I1IP 3OHLA 2AIGP 2OXZA 5D3CA 2OW2A 3CKIA 4H82A 1PWWA 3L0VA 2HU6A 1ROSA 1CGEA 1JAQA 1ZS0A 1CIZA 1BM6A 1IABA 4Q1LA 3EDZA 4IUWA 4L7AA 3ZXHA 1IACA 4DPEA 1G4KA 4J4MA 3LEAA 3AYKA 3KRYA 1I73A 1BUDA 3EDHA 2OI0A 1BKCI 4H1QA 3ZVSA 2MLSA 1GE5A 1XM5A 5CZMA 2OZRA 3F17A 4G9LA 1OS2A 1Y93A 4R3VA 1KAPP 3DTKA 3EDGA 4GQLA 1GXDA 3ELMA 1A86A 5I3MA 2DW0A 3HY7A 4ZR5A 3F19A 1XFYA 2YIGA 2W15A 1ZXVA 1G9KA 4H49A 3LE9A 3NX7A 1HY7A 3DTIA 1C8TA 2D1NA 456CA 5D1SA 4AXQA 4WK7A 5BOTA 5B5OA 1A85A 3KHIA 1MMQA 1GE6A 4HMAA 2X7MA 4H30A 3P24A 1K7GA 5D7WA 4PKRA 2OY4A 3HBVP 1XFVA 4GWMA 1SLMA 3TVCA 2CLTA 1SU3A 3DNGA 1HV5A 1XFXA 3TS4A 4L19A 3N2VA 3EDIA 1D7XA 2W0DA 2DDFA 3USNA 3WV1A 1XAXA 4JQGA 4PKSA 1ZVXA 2WO9A 1SATA 1MMPA 3O64A 5I4OA 1JAOA 3GBOA 4XBHA 1JANA 1PWPA 1Y0VA 830CA 1ASTA 1GO7P 1R1IA 3Q2GA 2OXUA 1USNA 3TT4A 2K2GA 3UVCA 1OZ9A 1MMBA 3DWBA 4HX3A 5I43A 1JKYA 3AIGA 2W13A 1OO9A 4FU4A 1SMPA 2QPJA 2Y6CA 1K7IA 2YB9A 3E8RA 1FM1A 1I76A 5LABA 2E2DA 4IN9A 2DW2A 3VTGA 4I03A 2Z2DA 1KUIA 3DL1A 1ATLA 3LILA 1CAQA 1SLNA 1BQQM 1MNCA 1XFUA 3DTEA 5B5PA 1G05A 3HYGA 2OW9A 1G49A 1DTHA 1RMZA 1OM8A 1UMTA 1CGLA 1D8MA 4XM8A 5BPAA 1YQYA 4FXQA 2USNA 3P1VA 1KUGA 4H2EA 3RTSA 1H71P 1YP1A 2OY2A 4IJOA 2ERQA 4PKTA 1K7QA 2J0TA 1CK7A 1UEAA 1C3IA 1FLSA 1BZSA 3LJGA 1OMJA 3LUNA 5D1UA 3LMCA 1L6JA 2J83A 1QUAA 4DD8A 1O0QA 1OM7A 3B2ZA 1S4BP 2OW1A 1BUVM 5D1TA 4H84A 4PKWA 3LJTA 3KMEA 3WV3A 3KEKA 2EROA 2K9CA 1BKCA 4JA1A 1RM8A 1GKDA 1QIBA 1R54A 1ZP5A 1PWQA 1FBLA 1HTDA 2V4BA 2OXWA 1XUCA 2SRTA 1B3DA 5CXAA 1HOVA 1PWVA 4FXYP 2MZEA 2JIHA 4XM6A 2ERPA 2XS3A 4QKZA 1EUBA 1CXVA 2OVXA 3HB2P 4A7BA 1GO8P 1KUKA 1OM6A 3KECA 2MZHA 2E3XA 1EAKA 4WKEA 4H3XA 3O2XA 1MMRA 3DSLA 4EFSA 1XFWA 2DW1A 1BKCE 5H8XA 2JNPA 2KRJA 1R1HA 4XCTA 2A8HA 4GR0A 3DPEA 2JSDA 1D8FA 1IAGA 4WZVA 2Y6DA 2FV5A 1KUHA 2RJPA 3HBUP 1XFZA 5BOYA 1JK3A 4GF1A 1KBCA 2I47A 1JH1A 4A3WA 4GR3A 2OVZA 1AYKA 4JP4A 3LIKA 2O3EA 1HFSA 3MA2A 3G5CA 1XURA 1ZXCA 4WKIA 1O0TA 2W14A 5L7FA 1ZTQA 3LGPA 3F15A 4CTHA 1JIZA 3B8ZA 3HDBA 3LUMA 3RTTA 4AYKA 2N8RA 1D5JA 3F18A 3HY9A 5CUHA 3LKAA 1Q3AA 1BSWA 3EHYA 4I35A 3LK8A 2JT6A 3AYUA 3I7IA 1AKLA 4GUYA 1WNIA 1Y8JA 3K7NA 1EB6A 4L6TA 3F1AA 3HDAP 3ZUKA 5L79A 1CGFA 2TCLA 1YCMA 2CKIA 2L0RA 4WF6A 1R1JA 2X3BA 1JJ9A 3V96B 2MLRA 1YOUA 4AIGA 2XS4A 1UTTA 3Q2HA 3G42A 3B92A 4JPAA 2RJQA 1IAEA 2PJTA 4H76A 966CA 1ND1A 2X3CA 1QJIA 3DPFA 4PKUA 3I7GA 1AF0A 3KMCA 1BQOA 5JMYA 1SRPA 1QICA 1UMSA 3LQBA 4XM7A 3N2UA 1C7KA 3TSKA 1B8YA 1R55A 3OHOA 5I12A 1JAPA 1BIWA 5I2ZA 2WO8A 1J7NA 2AYKA 3U1RA 3LIRA 3EHXA 3EWJA 4JIJA 2FV9A 3LQ0A 1GKCA 1DMTA 2OW0A 3KEJA 3LJZA 1CQRA 2MZIA 2O36A 1OS9A 4G0DA 4AUOA 1QIAA 1KUFA 3KWVC 2DDYA 2D1OA 4GWNA 5I0LA 2YUFA 4FVLA 4PKVA 1GE7A 1UTZA 1IADA 4GR8A 3BA0A 1Z3JA 4ON1A 5D2BA 3VI1A 4DV8A 3L0TA 1PWUA 1G12A 2W12A 3K7LA 1QJJA 2WOAA 4PKQA 2JT5A 1IAAA 3WV2A 1XUDA 1HFCA 4DF9A 2X3AA 3F16A
chains in the Genus database with same CATH topology
1JIWP 3SHIA 2POJA 4L63A 4ILWD 1I1IP 3OHLA 2AIGP 2OXZA 5D3CA 2OW2A 3CKIA 4H82A 1PWWA 3L0VA 2HU6A 1ROSA 1CGEA 1JAQA 1ZS0A 1CIZA 1BM6A 1IABA 4Q1LA 3EDZA 4IUWA 4L7AA 3ZXHA 1IACA 4DPEA 1G4KA 4J4MA 3LEAA 3AYKA 3KRYA 1I73A 1BUDA 3EDHA 2OI0A 1BKCI 4H1QA 3ZVSA 2MLSA 1GE5A 5CZMA 2OZRA 3F17A 4G9LA 1OS2A 1Y93A 4R3VA 1KAPP 3DTKA 3EDGA 4GQLA 1GXDA 3ELMA 1A86A 5I3MA 2DW0A 3HY7A 4ZR5A 3F19A 1XFYA 2YIGA 2W15A 1ZXVA 1G9KA 4H49A 3LE9A 3NX7A 1HY7A 3DTIA 1C8TA 2D1NA 456CA 5D1SA 4AXQA 4WK7A 5BOTA 5B5OA 1A85A 3KHIA 1MMQA 1GE6A 4HMAA 2X7MA 4H30A 3P24A 1K7GA 5D7WA 4PKRA 2OY4A 3HBVP 1XFVA 4GWMA 1SLMA 3TVCA 2CLTA 1SU3A 3DNGA 1HV5A 1XFXA 3TS4A 4L19A 3N2VA 3EDIA 1D7XA 2W0DA 2DDFA 3USNA 3WV1A 4JQGA 4PKSA 1ZVXA 2WO9A 1SATA 1MMPA 3O64A 5I4OA 1JAOA 3GBOA 4XBHA 1JANA 1PWPA 1Y0VA 830CA 1ASTA 1GO7P 1R1IA 3Q2GA 2OXUA 1USNA 3TT4A 2K2GA 3UVCA 1MMBA 3DWBA 4HX3A 5I43A 1JKYA 3AIGA 2W13A 1OO9A 4FU4A 1SMPA 2QPJA 2Y6CA 1K7IA 2YB9A 3E8RA 1FM1A 1I76A 5LABA 2E2DA 4IN9A 2DW2A 3VTGA 4I03A 2Z2DA 1KUIA 3DL1A 1ATLA 3LILA 1CAQA 1SLNA 1BQQM 1MNCA 1XFUA 3DTEA 5B5PA 1G05A 3HYGA 2OW9A 1G49A 1DTHA 1RMZA 1OM8A 1UMTA 1CGLA 1D8MA 4XM8A 5BPAA 1YQYA 4FXQA 2USNA 3P1VA 1KUGA 4H2EA 3RTSA 1H71P 1YP1A 2OY2A 4IJOA 2ERQA 4PKTA 1K7QA 2J0TA 1CK7A 1UEAA 1C3IA 1FLSA 1BZSA 3LJGA 1OMJA 3LUNA 5D1UA 3LMCA 1L6JA 2J83A 1QUAA 4DD8A 1O0QA 1OM7A 3B2ZA 1S4BP 2OW1A 1BUVM 5D1TA 4H84A 4PKWA 3LJTA 3KMEA 3WV3A 3KEKA 2EROA 2K9CA 1BKCA 4JA1A 1RM8A 1GKDA 1QIBA 1R54A 1ZP5A 1PWQA 1FBLA 1HTDA 2V4BA 2OXWA 1XUCA 2SRTA 1B3DA 5CXAA 1HOVA 1PWVA 4FXYP 2MZEA 2JIHA 4XM6A 2ERPA 2XS3A 4QKZA 1EUBA 1CXVA 2OVXA 3HB2P 4A7BA 1GO8P 1KUKA 1OM6A 3KECA 2MZHA 2E3XA 1EAKA 4WKEA 4H3XA 3O2XA 1MMRA 3DSLA 4EFSA 1XFWA 2DW1A 1BKCE 5H8XA 2JNPA 2KRJA 1R1HA 4XCTA 2A8HA 4GR0A 3DPEA 2JSDA 1D8FA 1IAGA 4WZVA 2Y6DA 2FV5A 1KUHA 2RJPA 3HBUP 1XFZA 5BOYA 1JK3A 4GF1A 1KBCA 2I47A 1JH1A 4A3WA 4GR3A 2OVZA 1AYKA 4JP4A 3LIKA 2O3EA 1HFSA 3MA2A 3G5CA 1XURA 1ZXCA 4WKIA 1O0TA 2W14A 5L7FA 1ZTQA 3LGPA 3F15A 4CTHA 1JIZA 3B8ZA 3HDBA 3LUMA 3RTTA 4AYKA 2N8RA 1D5JA 3F18A 3HY9A 5CUHA 3LKAA 1Q3AA 1BSWA 3EHYA 4I35A 3LK8A 2JT6A 3AYUA 3I7IA 1AKLA 4GUYA 1WNIA 1Y8JA 3K7NA 1EB6A 4L6TA 3F1AA 3HDAP 3ZUKA 5L79A 1CGFA 2TCLA 1YCMA 2CKIA 2L0RA 4WF6A 1R1JA 2X3BA 1JJ9A 3V96B 2MLRA 1YOUA 4AIGA 2XS4A 1UTTA 3Q2HA 3G42A 3B92A 4JPAA 2RJQA 1IAEA 2PJTA 4H76A 966CA 1ND1A 2X3CA 1QJIA 3DPFA 4PKUA 3I7GA 1AF0A 3KMCA 1BQOA 5JMYA 1SRPA 1QICA 1UMSA 3LQBA 4XM7A 3N2UA 1C7KA 3TSKA 1B8YA 1R55A 3OHOA 5I12A 1JAPA 1BIWA 5I2ZA 2WO8A 1J7NA 2AYKA 3U1RA 3LIRA 3EHXA 3EWJA 4JIJA 2FV9A 3LQ0A 1GKCA 1DMTA 2OW0A 3KEJA 3LJZA 1CQRA 2MZIA 2O36A 1OS9A 4G0DA 4AUOA 1QIAA 1KUFA 3KWVC 2DDYA 2D1OA 4GWNA 5I0LA 2YUFA 4FVLA 4PKVA 1GE7A 1UTZA 1IADA 4GR8A 3BA0A 1Z3JA 4ON1A 5D2BA 3VI1A 4DV8A 3L0TA 1PWUA 1G12A 2W12A 3K7LA 1QJJA 2WOAA 4PKQA 2JT5A 1IAAA 3WV2A 1XUDA 1HFCA 4DF9A 2X3AA 3F16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JIW P;  3SHI A;  2POJ A;  4L63 A;  4ILW D;  1I1I P;  3OHL A;  2AIG P;  2OXZ A;  5D3C A;  2OW2 A;  3CKI A;  4H82 A;  1PWW A;  3L0V A;  2HU6 A;  1ROS A;  1CGE A;  1JAQ A;  1ZS0 A;  1CIZ A;  1BM6 A;  1IAB A;  4Q1L A;  3EDZ A;  4IUW A;  3ZXH A;  1IAC A;  4DPE A;  1G4K A;  4J4M A;  3LEA A;  3AYK A;  3KRY A;  1I73 A;  1BUD A;  3EDH A;  2OI0 A;  1BKC I;  4H1Q A;  3ZVS A;  2MLS A;  1GE5 A;  5CZM A;  2OZR A;  3F17 A;  4G9L A;  1OS2 A;  1Y93 A;  4R3V A;  1KAP P;  3EDG A;  4GQL A;  1GXD A;  3ELM A;  1A86 A;  5I3M A;  2DW0 A;  3HY7 A;  4ZR5 A;  3F19 A;  1XFY A;  2YIG A;  2W15 A;  1ZXV A;  1G9K A;  4H49 A;  3LE9 A;  3NX7 A;  1HY7 A;  1C8T A;  2D1N A;  456C A;  5D1S A;  4AXQ A;  4WK7 A;  5BOT A;  5B5O A;  1A85 A;  3KHI A;  1MMQ A;  1GE6 A;  4HMA A;  2X7M A;  4H30 A;  3P24 A;  1K7G A;  5D7W A;  4PKR A;  2OY4 A;  3HBV P;  1XFV A;  4GWM A;  1SLM A;  3TVC A;  2CLT A;  1SU3 A;  3DNG A;  1HV5 A;  1XFX A;  3TS4 A;  4L19 A;  3N2V A;  3EDI A;  1D7X A;  2W0D A;  2DDF A;  3USN A;  3WV1 A;  4JQG A;  4PKS A;  1ZVX A;  2WO9 A;  1SAT A;  1MMP A;  3O64 A;  5I4O A;  1JAO A;  3GBO A;  4XBH A;  1JAN A;  1PWP A;  1Y0V A;  830C A;  1AST A;  1GO7 P;  1R1I A;  3Q2G A;  2OXU A;  1USN A;  3TT4 A;  2K2G A;  3UVC A;  1MMB A;  3DWB A;  4HX3 A;  5I43 A;  1JKY A;  3AIG A;  2W13 A;  1OO9 A;  4FU4 A;  1SMP A;  2QPJ A;  2Y6C A;  1K7I A;  2YB9 A;  3E8R A;  1FM1 A;  1I76 A;  5LAB A;  2E2D A;  4IN9 A;  2DW2 A;  3VTG A;  4I03 A;  2Z2D A;  1KUI A;  3DL1 A;  1ATL A;  3LIL A;  1CAQ A;  1SLN A;  1BQQ M;  1MNC A;  1XFU A;  5B5P A;  1G05 A;  3HYG A;  2OW9 A;  1G49 A;  1DTH A;  1RMZ A;  1OM8 A;  1UMT A;  1CGL A;  1D8M A;  4XM8 A;  5BPA A;  1YQY A;  4FXQ A;  2USN A;  3P1V A;  1KUG A;  4H2E A;  3RTS A;  1H71 P;  1YP1 A;  2OY2 A;  4IJO A;  2ERQ A;  4PKT A;  1K7Q A;  2J0T A;  1CK7 A;  1UEA A;  1C3I A;  1FLS A;  1BZS A;  3LJG A;  1OMJ A;  3LUN A;  5D1U A;  3LMC A;  1L6J A;  2J83 A;  1QUA A;  4DD8 A;  1O0Q A;  1OM7 A;  3B2Z A;  1S4B P;  2OW1 A;  1BUV M;  5D1T A;  4H84 A;  4PKW A;  3LJT A;  3KME A;  3WV3 A;  3KEK A;  2ERO A;  2K9C A;  1BKC A;  4JA1 A;  1RM8 A;  1GKD A;  1QIB A;  1R54 A;  1ZP5 A;  1PWQ A;  1FBL A;  1HTD A;  2V4B A;  2OXW A;  1XUC A;  2SRT A;  1B3D A;  5CXA A;  1HOV A;  1PWV A;  4FXY P;  2MZE A;  2JIH A;  4XM6 A;  2ERP A;  2XS3 A;  4QKZ A;  1EUB A;  1CXV A;  2OVX A;  3HB2 P;  4A7B A;  1GO8 P;  1KUK A;  1OM6 A;  3KEC A;  2MZH A;  2E3X A;  1EAK A;  4WKE A;  4H3X A;  3O2X A;  1MMR A;  3DSL A;  4EFS A;  1XFW A;  2DW1 A;  1BKC E;  5H8X A;  2JNP A;  2KRJ A;  1R1H A;  4XCT A;  2A8H A;  4GR0 A;  3DPE A;  2JSD A;  1D8F A;  1IAG A;  4WZV A;  2Y6D A;  2FV5 A;  1KUH A;  2RJP A;  3HBU P;  1XFZ A;  5BOY A;  1JK3 A;  4GF1 A;  1KBC A;  2I47 A;  1JH1 A;  4A3W A;  4GR3 A;  2OVZ A;  1AYK A;  4JP4 A;  3LIK A;  2O3E A;  1HFS A;  3MA2 A;  3G5C A;  1XUR A;  1ZXC A;  4WKI A;  1O0T A;  2W14 A;  5L7F A;  1ZTQ A;  3LGP A;  3F15 A;  4CTH A;  1JIZ A;  3B8Z A;  3HDB A;  3LUM A;  3RTT A;  4AYK A;  2N8R A;  1D5J A;  3F18 A;  3HY9 A;  5CUH A;  3LKA A;  1Q3A A;  1BSW A;  3EHY A;  4I35 A;  3LK8 A;  2JT6 A;  3AYU A;  3I7I A;  1AKL A;  4GUY A;  1WNI A;  1Y8J A;  3K7N A;  1EB6 A;  4L6T A;  3F1A A;  3HDA P;  3ZUK A;  5L79 A;  1CGF A;  2TCL A;  1YCM A;  2CKI A;  2L0R A;  4WF6 A;  1R1J A;  2X3B A;  1JJ9 A;  3V96 B;  2MLR A;  1YOU A;  4AIG A;  2XS4 A;  1UTT A;  3Q2H A;  3G42 A;  3B92 A;  4JPA A;  2RJQ A;  1IAE A;  2PJT A;  4H76 A;  966C A;  1ND1 A;  2X3C A;  1QJI A;  3DPF A;  4PKU A;  3I7G A;  1AF0 A;  3KMC A;  1BQO A;  5JMY A;  1SRP A;  1QIC A;  1UMS A;  3LQB A;  4XM7 A;  3N2U A;  1C7K A;  3TSK A;  1B8Y A;  1R55 A;  3OHO A;  5I12 A;  1JAP A;  1BIW A;  5I2Z A;  2WO8 A;  1J7N A;  2AYK A;  3U1R A;  3LIR A;  3EHX A;  3EWJ A;  4JIJ A;  2FV9 A;  3LQ0 A;  1GKC A;  1DMT A;  2OW0 A;  3KEJ A;  3LJZ A;  1CQR A;  2MZI A;  2O36 A;  1OS9 A;  4G0D A;  4AUO A;  1QIA A;  1KUF A;  3KWV C;  2DDY A;  2D1O A;  4GWN A;  5I0L A;  4FVL A;  4PKV A;  1GE7 A;  1UTZ A;  1IAD A;  4GR8 A;  3BA0 A;  1Z3J A;  4ON1 A;  5D2B A;  3VI1 A;  4DV8 A;  3L0T A;  1PWU A;  1G12 A;  2W12 A;  3K7L A;  1QJJ A;  2WOA A;  4PKQ A;  2JT5 A;  1IAA A;  3WV2 A;  1XUD A;  1HFC A;  4DF9 A;  2X3A A;  3F16 A; 
#chains in the Genus database with same CATH topology
 1JIW P;  3SHI A;  2POJ A;  4L63 A;  4ILW D;  1TVI A;  1I1I P;  3OHL A;  2AIG P;  2OXZ A;  5D3C A;  2OW2 A;  3CKI A;  4H82 A;  1PWW A;  3L0V A;  2HU6 A;  1ROS A;  1CGE A;  1JAQ A;  1ZS0 A;  1CIZ A;  1BM6 A;  1IAB A;  4Q1L A;  3EDZ A;  4IUW A;  4L7A A;  3ZXH A;  1IAC A;  4DPE A;  1G4K A;  4J4M A;  3LEA A;  3AYK A;  3KRY A;  1I73 A;  1BUD A;  3EDH A;  2OI0 A;  1BKC I;  4H1Q A;  3ZVS A;  2MLS A;  1GE5 A;  1XM5 A;  5CZM A;  2OZR A;  3F17 A;  4G9L A;  1OS2 A;  1Y93 A;  4R3V A;  1KAP P;  3DTK A;  3EDG A;  4GQL A;  1GXD A;  3ELM A;  1A86 A;  5I3M A;  2DW0 A;  3HY7 A;  4ZR5 A;  3F19 A;  1XFY A;  2YIG A;  2W15 A;  1ZXV A;  1G9K A;  4H49 A;  3LE9 A;  3NX7 A;  1HY7 A;  3DTI A;  1C8T A;  2D1N A;  456C A;  5D1S A;  4AXQ A;  4WK7 A;  5BOT A;  5B5O A;  1A85 A;  3KHI A;  1MMQ A;  1GE6 A;  4HMA A;  2X7M A;  4H30 A;  3P24 A;  1K7G A;  5D7W A;  4PKR A;  2OY4 A;  3HBV P;  1XFV A;  4GWM A;  1SLM A;  3TVC A;  2CLT A;  1SU3 A;  3DNG A;  1HV5 A;  1XFX A;  3TS4 A;  4L19 A;  3N2V A;  3EDI A;  1D7X A;  2W0D A;  2DDF A;  3USN A;  3WV1 A;  1XAX A;  4JQG A;  4PKS A;  1ZVX A;  2WO9 A;  1SAT A;  1MMP A;  3O64 A;  5I4O A;  1JAO A;  3GBO A;  4XBH A;  1JAN A;  1PWP A;  1Y0V A;  830C A;  1AST A;  1GO7 P;  1R1I A;  3Q2G A;  2OXU A;  1USN A;  3TT4 A;  2K2G A;  3UVC A;  1OZ9 A;  1MMB A;  3DWB A;  4HX3 A;  5I43 A;  1JKY A;  3AIG A;  2W13 A;  1OO9 A;  4FU4 A;  1SMP A;  2QPJ A;  2Y6C A;  1K7I A;  2YB9 A;  3E8R A;  1FM1 A;  1I76 A;  5LAB A;  2E2D A;  4IN9 A;  2DW2 A;  3VTG A;  4I03 A;  2Z2D A;  1KUI A;  3DL1 A;  1ATL A;  3LIL A;  1CAQ A;  1SLN A;  1BQQ M;  1MNC A;  1XFU A;  3DTE A;  5B5P A;  1G05 A;  3HYG A;  2OW9 A;  1G49 A;  1DTH A;  1RMZ A;  1OM8 A;  1UMT A;  1CGL A;  1D8M A;  4XM8 A;  5BPA A;  1YQY A;  4FXQ A;  2USN A;  3P1V A;  1KUG A;  4H2E A;  3RTS A;  1H71 P;  1YP1 A;  2OY2 A;  4IJO A;  2ERQ A;  4PKT A;  1K7Q A;  2J0T A;  1CK7 A;  1UEA A;  1C3I A;  1FLS A;  1BZS A;  3LJG A;  1OMJ A;  3LUN A;  5D1U A;  3LMC A;  1L6J A;  2J83 A;  1QUA A;  4DD8 A;  1O0Q A;  1OM7 A;  3B2Z A;  1S4B P;  2OW1 A;  1BUV M;  5D1T A;  4H84 A;  4PKW A;  3LJT A;  3KME A;  3WV3 A;  3KEK A;  2ERO A;  2K9C A;  1BKC A;  4JA1 A;  1RM8 A;  1GKD A;  1QIB A;  1R54 A;  1ZP5 A;  1PWQ A;  1FBL A;  1HTD A;  2V4B A;  2OXW A;  1XUC A;  2SRT A;  1B3D A;  5CXA A;  1HOV A;  1PWV A;  4FXY P;  2MZE A;  2JIH A;  4XM6 A;  2ERP A;  2XS3 A;  4QKZ A;  1EUB A;  1CXV A;  2OVX A;  3HB2 P;  4A7B A;  1GO8 P;  1KUK A;  1OM6 A;  3KEC A;  2MZH A;  2E3X A;  1EAK A;  4WKE A;  4H3X A;  3O2X A;  1MMR A;  3DSL A;  4EFS A;  1XFW A;  2DW1 A;  1BKC E;  5H8X A;  2JNP A;  2KRJ A;  1R1H A;  4XCT A;  2A8H A;  4GR0 A;  3DPE A;  2JSD A;  1D8F A;  1IAG A;  4WZV A;  2Y6D A;  2FV5 A;  1KUH A;  2RJP A;  3HBU P;  1XFZ A;  5BOY A;  1JK3 A;  4GF1 A;  1KBC A;  2I47 A;  1JH1 A;  4A3W A;  4GR3 A;  2OVZ A;  1AYK A;  4JP4 A;  3LIK A;  2O3E A;  1HFS A;  3MA2 A;  3G5C A;  1XUR A;  1ZXC A;  4WKI A;  1O0T A;  2W14 A;  5L7F A;  1ZTQ A;  3LGP A;  3F15 A;  4CTH A;  1JIZ A;  3B8Z A;  3HDB A;  3LUM A;  3RTT A;  4AYK A;  2N8R A;  1D5J A;  3F18 A;  3HY9 A;  5CUH A;  3LKA A;  1Q3A A;  1BSW A;  3EHY A;  4I35 A;  3LK8 A;  2JT6 A;  3AYU A;  3I7I A;  1AKL A;  4GUY A;  1WNI A;  1Y8J A;  3K7N A;  1EB6 A;  4L6T A;  3F1A A;  3HDA P;  3ZUK A;  5L79 A;  1CGF A;  2TCL A;  1YCM A;  2CKI A;  2L0R A;  4WF6 A;  1R1J A;  2X3B A;  1JJ9 A;  3V96 B;  2MLR A;  1YOU A;  4AIG A;  2XS4 A;  1UTT A;  3Q2H A;  3G42 A;  3B92 A;  4JPA A;  2RJQ A;  1IAE A;  2PJT A;  4H76 A;  966C A;  1ND1 A;  2X3C A;  1QJI A;  3DPF A;  4PKU A;  3I7G A;  1AF0 A;  3KMC A;  1BQO A;  5JMY A;  1SRP A;  1QIC A;  1UMS A;  3LQB A;  4XM7 A;  3N2U A;  1C7K A;  3TSK A;  1B8Y A;  1R55 A;  3OHO A;  5I12 A;  1JAP A;  1BIW A;  5I2Z A;  2WO8 A;  1J7N A;  2AYK A;  3U1R A;  3LIR A;  3EHX A;  3EWJ A;  4JIJ A;  2FV9 A;  3LQ0 A;  1GKC A;  1DMT A;  2OW0 A;  3KEJ A;  3LJZ A;  1CQR A;  2MZI A;  2O36 A;  1OS9 A;  4G0D A;  4AUO A;  1QIA A;  1KUF A;  3KWV C;  2DDY A;  2D1O A;  4GWN A;  5I0L A;  2YUF A;  4FVL A;  4PKV A;  1GE7 A;  1UTZ A;  1IAD A;  4GR8 A;  3BA0 A;  1Z3J A;  4ON1 A;  5D2B A;  3VI1 A;  4DV8 A;  3L0T A;  1PWU A;  1G12 A;  2W12 A;  3K7L A;  1QJJ A;  2WOA A;  4PKQ A;  2JT5 A;  1IAA A;  3WV2 A;  1XUD A;  1HFC A;  4DF9 A;  2X3A A;  3F16 A; 
#chains in the Genus database with same CATH homology
 1JIW P;  3SHI A;  2POJ A;  4L63 A;  4ILW D;  1I1I P;  3OHL A;  2AIG P;  2OXZ A;  5D3C A;  2OW2 A;  3CKI A;  4H82 A;  1PWW A;  3L0V A;  2HU6 A;  1ROS A;  1CGE A;  1JAQ A;  1ZS0 A;  1CIZ A;  1BM6 A;  1IAB A;  4Q1L A;  3EDZ A;  4IUW A;  4L7A A;  3ZXH A;  1IAC A;  4DPE A;  1G4K A;  4J4M A;  3LEA A;  3AYK A;  3KRY A;  1I73 A;  1BUD A;  3EDH A;  2OI0 A;  1BKC I;  4H1Q A;  3ZVS A;  2MLS A;  1GE5 A;  5CZM A;  2OZR A;  3F17 A;  4G9L A;  1OS2 A;  1Y93 A;  4R3V A;  1KAP P;  3DTK A;  3EDG A;  4GQL A;  1GXD A;  3ELM A;  1A86 A;  5I3M A;  2DW0 A;  3HY7 A;  4ZR5 A;  3F19 A;  1XFY A;  2YIG A;  2W15 A;  1ZXV A;  1G9K A;  4H49 A;  3LE9 A;  3NX7 A;  1HY7 A;  3DTI A;  1C8T A;  2D1N A;  456C A;  5D1S A;  4AXQ A;  4WK7 A;  5BOT A;  5B5O A;  1A85 A;  3KHI A;  1MMQ A;  1GE6 A;  4HMA A;  2X7M A;  4H30 A;  3P24 A;  1K7G A;  5D7W A;  4PKR A;  2OY4 A;  3HBV P;  1XFV A;  4GWM A;  1SLM A;  3TVC A;  2CLT A;  1SU3 A;  3DNG A;  1HV5 A;  1XFX A;  3TS4 A;  4L19 A;  3N2V A;  3EDI A;  1D7X A;  2W0D A;  2DDF A;  3USN A;  3WV1 A;  4JQG A;  4PKS A;  1ZVX A;  2WO9 A;  1SAT A;  1MMP A;  3O64 A;  5I4O A;  1JAO A;  3GBO A;  4XBH A;  1JAN A;  1PWP A;  1Y0V A;  830C A;  1AST A;  1GO7 P;  1R1I A;  3Q2G A;  2OXU A;  1USN A;  3TT4 A;  2K2G A;  3UVC A;  1MMB A;  3DWB A;  4HX3 A;  5I43 A;  1JKY A;  3AIG A;  2W13 A;  1OO9 A;  4FU4 A;  1SMP A;  2QPJ A;  2Y6C A;  1K7I A;  2YB9 A;  3E8R A;  1FM1 A;  1I76 A;  5LAB A;  2E2D A;  4IN9 A;  2DW2 A;  3VTG A;  4I03 A;  2Z2D A;  1KUI A;  3DL1 A;  1ATL A;  3LIL A;  1CAQ A;  1SLN A;  1BQQ M;  1MNC A;  1XFU A;  3DTE A;  5B5P A;  1G05 A;  3HYG A;  2OW9 A;  1G49 A;  1DTH A;  1RMZ A;  1OM8 A;  1UMT A;  1CGL A;  1D8M A;  4XM8 A;  5BPA A;  1YQY A;  4FXQ A;  2USN A;  3P1V A;  1KUG A;  4H2E A;  3RTS A;  1H71 P;  1YP1 A;  2OY2 A;  4IJO A;  2ERQ A;  4PKT A;  1K7Q A;  2J0T A;  1CK7 A;  1UEA A;  1C3I A;  1FLS A;  1BZS A;  3LJG A;  1OMJ A;  3LUN A;  5D1U A;  3LMC A;  1L6J A;  2J83 A;  1QUA A;  4DD8 A;  1O0Q A;  1OM7 A;  3B2Z A;  1S4B P;  2OW1 A;  1BUV M;  5D1T A;  4H84 A;  4PKW A;  3LJT A;  3KME A;  3WV3 A;  3KEK A;  2ERO A;  2K9C A;  1BKC A;  4JA1 A;  1RM8 A;  1GKD A;  1QIB A;  1R54 A;  1ZP5 A;  1PWQ A;  1FBL A;  1HTD A;  2V4B A;  2OXW A;  1XUC A;  2SRT A;  1B3D A;  5CXA A;  1HOV A;  1PWV A;  4FXY P;  2MZE A;  2JIH A;  4XM6 A;  2ERP A;  2XS3 A;  4QKZ A;  1EUB A;  1CXV A;  2OVX A;  3HB2 P;  4A7B A;  1GO8 P;  1KUK A;  1OM6 A;  3KEC A;  2MZH A;  2E3X A;  1EAK A;  4WKE A;  4H3X A;  3O2X A;  1MMR A;  3DSL A;  4EFS A;  1XFW A;  2DW1 A;  1BKC E;  5H8X A;  2JNP A;  2KRJ A;  1R1H A;  4XCT A;  2A8H A;  4GR0 A;  3DPE A;  2JSD A;  1D8F A;  1IAG A;  4WZV A;  2Y6D A;  2FV5 A;  1KUH A;  2RJP A;  3HBU P;  1XFZ A;  5BOY A;  1JK3 A;  4GF1 A;  1KBC A;  2I47 A;  1JH1 A;  4A3W A;  4GR3 A;  2OVZ A;  1AYK A;  4JP4 A;  3LIK A;  2O3E A;  1HFS A;  3MA2 A;  3G5C A;  1XUR A;  1ZXC A;  4WKI A;  1O0T A;  2W14 A;  5L7F A;  1ZTQ A;  3LGP A;  3F15 A;  4CTH A;  1JIZ A;  3B8Z A;  3HDB A;  3LUM A;  3RTT A;  4AYK A;  2N8R A;  1D5J A;  3F18 A;  3HY9 A;  5CUH A;  3LKA A;  1Q3A A;  1BSW A;  3EHY A;  4I35 A;  3LK8 A;  2JT6 A;  3AYU A;  3I7I A;  1AKL A;  4GUY A;  1WNI A;  1Y8J A;  3K7N A;  1EB6 A;  4L6T A;  3F1A A;  3HDA P;  3ZUK A;  5L79 A;  1CGF A;  2TCL A;  1YCM A;  2CKI A;  2L0R A;  4WF6 A;  1R1J A;  2X3B A;  1JJ9 A;  3V96 B;  2MLR A;  1YOU A;  4AIG A;  2XS4 A;  1UTT A;  3Q2H A;  3G42 A;  3B92 A;  4JPA A;  2RJQ A;  1IAE A;  2PJT A;  4H76 A;  966C A;  1ND1 A;  2X3C A;  1QJI A;  3DPF A;  4PKU A;  3I7G A;  1AF0 A;  3KMC A;  1BQO A;  5JMY A;  1SRP A;  1QIC A;  1UMS A;  3LQB A;  4XM7 A;  3N2U A;  1C7K A;  3TSK A;  1B8Y A;  1R55 A;  3OHO A;  5I12 A;  1JAP A;  1BIW A;  5I2Z A;  2WO8 A;  1J7N A;  2AYK A;  3U1R A;  3LIR A;  3EHX A;  3EWJ A;  4JIJ A;  2FV9 A;  3LQ0 A;  1GKC A;  1DMT A;  2OW0 A;  3KEJ A;  3LJZ A;  1CQR A;  2MZI A;  2O36 A;  1OS9 A;  4G0D A;  4AUO A;  1QIA A;  1KUF A;  3KWV C;  2DDY A;  2D1O A;  4GWN A;  5I0L A;  2YUF A;  4FVL A;  4PKV A;  1GE7 A;  1UTZ A;  1IAD A;  4GR8 A;  3BA0 A;  1Z3J A;  4ON1 A;  5D2B A;  3VI1 A;  4DV8 A;  3L0T A;  1PWU A;  1G12 A;  2W12 A;  3K7L A;  1QJJ A;  2WOA A;  4PKQ A;  2JT5 A;  1IAA A;  3WV2 A;  1XUD A;  1HFC A;  4DF9 A;  2X3A A;  3F16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...