1GE6A

Zinc peptidase from grifola frondosa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
163
structure length
163
Chain Sequence
b'CSSSEQSALAAAASAAQSYVAESLSYLQTHTAATPRYTTWFGSYISSRHSTVLQHYTDMNSNDFSSYSFDCTCTAAGTFAYVYPNRFGTVYLCGAFWKAPTTGTDSQAGTLVHESSHFTRNGGTKDYAYGQAAAKSLATMDPDKAVMNADNHEYFSENNPAQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-LYS METALLOENDOPEPTIDASE
publication title Structure of a new 'aspzincin' metalloendopeptidase from Grifola frondosa: implications for the catalytic mechanism and substrate specificity based on several different crystal forms.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.20: Peptidyl-Lys metalloendopeptidase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1ge6A00
1HV5A 1IAAA 4PKQA 1Q3AA 1JK3A 1SU3A 4AYKA 1PWWA 4A7BA 1XUDA 1FBLA 1XFXA 2WOAA 2YB9A 2X3CA 3EDZA 1C3IA 2OXZA 3LE9A 2JIHA 1MMQA 4QKZA 5BOTA 1DMTA 3B92A 1EAKA 4L63A 4L6TA 4AIGA 4I03A 1KBCA 4HX3A 1ZTQA 4PKTA 3WV2A 1O0QA 3HBUP 2W14A 5D7WA 4H2EA 3G5CA 1CXVA 4ZR5A 1KUIA 3G42A 4IN9A 1OM6A 3TVCA 1AF0A 1IADA 4DD8A 1BKCI 3LEAA 1BKCE 3WV1A 4GR3A 1JIWP 3DL1A 5CXAA 4IJOA 2MZEA 1ND1A 1A86A 1MNCA 4PKSA 1SLNA 3N2VA 4JQGA 5I4OA 4JIJA 3Q2GA 1HTDA 1HY7A 1IACA 2X7MA 2XS3A 2DW1A 2YIGA 4DV8A 3KMCA 4J4MA 5B5OA 3USNA 3RTTA 1JAQA 1PWVA 2XS4A 1MMRA 4GQLA 1CGFA 1D5JA 2D1NA 3TSKA 3F15A 2W15A 1OO9A 5D1TA 3ZUKA 3U1RA 1USNA 1C8TA 1DTHA 3P24A 1JANA 4H82A 5D2BA 2OW1A 2USNA 3TT4A 1G4KA 3GBOA 1MMPA 3HDBA 3F16A 2DDFA 4H76A 4XM6A 4GR0A 5I43A 4FVLA 4XBHA 1XURA 2DDYA 1D8MA 4FXQA 1XFYA 3LQ0A 1BKCA 1JIZA 1K7GA 3TS4A 1ROSA 2OI0A 1BQQM 2DW0A 2K9CA 1QICA 1HFCA 4H1QA 2AIGP 1UTTA 3UVCA 3LJGA 1CAQA 1UEAA 3HYGA 1O0TA 5CUHA 3VI1A 2L0RA 3NX7A 3RTSA 4DF9A 2W12A 1YQYA 1D8FA 1HFSA 1C7KA 1GE5A 1D7XA 2OXWA 3E8RA 3CKIA 1XFWA 4PKRA 3DWBA 2JT5A 3MA2A 1EB6A 1ZP5A 1OS2A 2OZRA 4PKVA 3I7IA 2D1OA 2OVZA 4H49A 3LK8A 5L7FA 1ZXCA 3WV3A 4CTHA 4H84A 4GWMA 3AYUA 2MZIA 2PJTA 3KHIA 1ZVXA 3V96B 1B3DA 1BM6A 1KUFA 3OHLA 1I1IP 5I3MA 1OM7A 1PWUA 3P1VA 1I73A 4FXYP 5I0LA 1BUVM 1QJJA 1BIWA 2MZHA 1GKDA 2J0TA 2OXUA 3BA0A 1GO8P 4FU4A 2QPJA 4WF6A 1JKYA 1SLMA 2POJA 1Y8JA 2WO9A 1J7NA 5H8XA 4Q1LA 4GF1A 5I12A 3HY9A 2Y6CA 3DPEA 5CZMA 3EDIA 1IAGA 1K7IA 2V4BA 1YP1A 2Z2DA 1BZSA 2N8RA 4ON1A 1BQOA 4L19A 2FV9A 1WNIA 1PWPA 3LKAA 1UMTA 1Y93A 1L6JA 3SHIA 1S4BP 5LABA 1GKCA 1R1IA 4DPEA 1EUBA 3LIKA 1CGEA 3DPFA 3B8ZA 1B8YA 2E3XA 3AYKA 3LUMA 3F18A 4WKEA 3HDAP 2K2GA 5BPAA 2X3BA 2MLRA 1FLSA 1BSWA 3LUNA 1OS9A 2EROA 1JAPA 4JPAA 1UTZA 2O36A 1GE6A 4IUWA 3EWJA 2OW0A 1XFVA 5D1UA 1G9KA 2KRJA 2I47A 1AYKA 2OY2A 2RJQA 4AUOA 2RJPA 1RMZA 1G05A 1KUKA 2AYKA 3LIRA 1OM8A 3EDGA 2CKIA 1UMSA 1PWQA 1XFZA 1GXDA 2J83A 2JT6A 2Y6DA 4WKIA 1IABA 3F19A 1SATA 1XFUA 3LJTA 1QUAA 1CK7A 4GR8A 3K7NA 3B2ZA 4JP4A 1BUDA 3K7LA 4I35A 2OY4A 4XM8A 1ATLA 4WK7A 2JNPA 1ASTA 4G0DA 2TCLA 3HBVP 5JMYA 1Y0VA 1SRPA 1CQRA 1RM8A 3OHOA 4HMAA 1ZS0A 2JSDA 1JJ9A 1K7QA 3AIGA 4PKWA 3LGPA 2MLSA 5B5PA 3DSLA 3HY7A 3L0TA 4H3XA 3ZXHA 3EHXA 1QIAA 1G12A 1XUCA 3KRYA 1JH1A 4AXQA 1MMBA 3F1AA 1QIBA 3EDHA 1YOUA 3LILA 3O64A 4A3WA 4XCTA 2W13A 1KAPP 1GE7A 1GO7P 4PKUA 1I76A 1KUGA 3DNGA 1OMJA 3KEJA 1CGLA 2OW2A 2FV5A 3I7GA 3KWVC 1R1JA 966CA 4G9LA 4EFSA 1HOVA 1CIZA 2SRTA 3VTGA 2E2DA 2ERPA 1JAOA 3N2UA 2HU6A 4ILWD 1R54A 3LQBA 3KECA 2OVXA 1A85A 1H71P 5BOYA 2A8HA 5D1SA 4R3VA 5D3CA 456CA 3ZVSA 1AKLA 1QJIA 3O2XA 2O3EA 1R55A 5I2ZA 1R1HA 4XM7A 3L0VA 1G49A 3HB2P 4GUYA 3LMCA 1IAEA 1ZXVA 4H30A 4JA1A 3LJZA 2X3AA 2CLTA 2ERQA 3Q2HA 3KEKA 2DW2A 2WO8A 4WZVA 3F17A 3ELMA 1Z3JA 2W0DA 1KUHA 4GWNA 1FM1A 3EHYA 830CA 1YCMA 5L79A 2OW9A 1SMPA 3KMEA
chains in the Genus database with same CATH superfamily
1HV5A 1IAAA 4PKQA 1Q3AA 1JK3A 1SU3A 4AYKA 1PWWA 4A7BA 1XUDA 1FBLA 1XFXA 2WOAA 2YB9A 2X3CA 3EDZA 1C3IA 2OXZA 3LE9A 2JIHA 1MMQA 4QKZA 5BOTA 1DMTA 3B92A 1EAKA 1OZ9A 4L63A 4L6TA 4AIGA 4I03A 1KBCA 4HX3A 1ZTQA 4PKTA 3WV2A 1O0QA 3HBUP 2W14A 5D7WA 4H2EA 3G5CA 1CXVA 4ZR5A 1KUIA 3G42A 4IN9A 1OM6A 3TVCA 1AF0A 1IADA 4DD8A 1BKCI 3LEAA 1BKCE 3WV1A 4GR3A 1JIWP 3DL1A 5CXAA 4IJOA 2YUFA 2MZEA 1ND1A 1A86A 1MNCA 4PKSA 1SLNA 3N2VA 4JQGA 5I4OA 4JIJA 3Q2GA 1HTDA 1HY7A 1IACA 2X7MA 2XS3A 2DW1A 2YIGA 4DV8A 3KMCA 4J4MA 5B5OA 3USNA 3RTTA 1JAQA 1PWVA 2XS4A 1MMRA 4GQLA 1CGFA 1XM5A 1D5JA 2D1NA 3TSKA 3F15A 2W15A 1OO9A 5D1TA 3ZUKA 3U1RA 1USNA 1C8TA 1DTHA 3P24A 1JANA 4H82A 5D2BA 2OW1A 2USNA 3TT4A 1G4KA 3GBOA 1MMPA 3HDBA 3F16A 2DDFA 4H76A 4XM6A 4GR0A 5I43A 4FVLA 4XBHA 1XURA 2DDYA 1D8MA 4FXQA 1XFYA 3LQ0A 1BKCA 1JIZA 1K7GA 3TS4A 1ROSA 2OI0A 1BQQM 2DW0A 2K9CA 1QICA 1HFCA 4H1QA 2AIGP 1UTTA 3UVCA 3LJGA 1CAQA 1UEAA 3HYGA 1O0TA 5CUHA 3VI1A 2L0RA 3NX7A 3RTSA 4DF9A 2W12A 1YQYA 1D8FA 1HFSA 1C7KA 1GE5A 1D7XA 2OXWA 3E8RA 3CKIA 1XFWA 4PKRA 3DWBA 2JT5A 3MA2A 1EB6A 1ZP5A 1XAXA 1OS2A 2OZRA 4PKVA 3I7IA 2D1OA 2OVZA 4H49A 3LK8A 5L7FA 1ZXCA 3WV3A 4CTHA 4H84A 4GWMA 3AYUA 2MZIA 2PJTA 3KHIA 1ZVXA 3V96B 1B3DA 1BM6A 1KUFA 3OHLA 1I1IP 5I3MA 1OM7A 1PWUA 3P1VA 1I73A 4FXYP 5I0LA 1BUVM 1QJJA 1BIWA 2MZHA 1GKDA 2J0TA 2OXUA 3BA0A 1GO8P 4FU4A 2QPJA 4WF6A 1JKYA 1SLMA 2POJA 1TVIA 1Y8JA 1J7NA 2WO9A 5H8XA 4Q1LA 4GF1A 5I12A 3HY9A 2Y6CA 3DPEA 5CZMA 3EDIA 1IAGA 1K7IA 2V4BA 1YP1A 2Z2DA 1BZSA 2N8RA 4ON1A 1BQOA 4L19A 2FV9A 1WNIA 1PWPA 3LKAA 1UMTA 1Y93A 1L6JA 3SHIA 1S4BP 5LABA 1GKCA 1R1IA 4DPEA 1EUBA 3LIKA 1CGEA 4L7AA 3DPFA 3B8ZA 1B8YA 2E3XA 3AYKA 3LUMA 3F18A 4WKEA 3HDAP 2K2GA 5BPAA 2X3BA 2MLRA 3DTEA 1FLSA 1BSWA 3LUNA 1OS9A 2EROA 1JAPA 4JPAA 1UTZA 2O36A 1GE6A 4IUWA 3EWJA 2OW0A 1XFVA 5D1UA 1G9KA 2KRJA 2I47A 1AYKA 2OY2A 2RJQA 4AUOA 2RJPA 1RMZA 1G05A 1KUKA 2AYKA 3LIRA 1OM8A 3EDGA 2CKIA 1UMSA 1PWQA 1XFZA 1GXDA 2J83A 2JT6A 2Y6DA 4WKIA 1IABA 3F19A 1SATA 1XFUA 3LJTA 1QUAA 1CK7A 4GR8A 3K7NA 3B2ZA 4JP4A 1BUDA 3K7LA 4I35A 2OY4A 4XM8A 1ATLA 4WK7A 3DTKA 2JNPA 1ASTA 4G0DA 2TCLA 3HBVP 5JMYA 1Y0VA 1SRPA 1CQRA 1RM8A 3OHOA 4HMAA 1ZS0A 2JSDA 1JJ9A 1K7QA 3AIGA 4PKWA 3LGPA 2MLSA 5B5PA 3DSLA 3HY7A 3L0TA 4H3XA 3ZXHA 3EHXA 1QIAA 1G12A 1XUCA 3KRYA 1JH1A 4AXQA 1MMBA 3F1AA 1QIBA 3EDHA 1YOUA 3LILA 3O64A 4A3WA 4XCTA 2W13A 1KAPP 1GE7A 1GO7P 4PKUA 1I76A 1KUGA 3DNGA 1OMJA 3KEJA 1CGLA 2OW2A 2FV5A 3I7GA 3KWVC 1R1JA 966CA 4G9LA 4EFSA 1HOVA 1CIZA 2SRTA 3VTGA 2E2DA 2ERPA 1JAOA 3N2UA 2HU6A 4ILWD 1R54A 3LQBA 3KECA 2OVXA 1A85A 1H71P 5BOYA 2A8HA 5D1SA 4R3VA 5D3CA 456CA 3ZVSA 1AKLA 1QJIA 3O2XA 2O3EA 1R55A 5I2ZA 1R1HA 4XM7A 3L0VA 1G49A 3HB2P 4GUYA 3LMCA 1IAEA 1ZXVA 4H30A 4JA1A 3LJZA 2X3AA 2CLTA 2ERQA 3Q2HA 3KEKA 2DW2A 2WO8A 4WZVA 3F17A 3ELMA 1Z3JA 2W0DA 1KUHA 4GWNA 1FM1A 3EHYA 830CA 3DTIA 1YCMA 5L79A 2OW9A 1SMPA 3KMEA
chains in the Genus database with same CATH topology
1HV5A 1IAAA 4PKQA 1Q3AA 1JK3A 1SU3A 4AYKA 1PWWA 4A7BA 1XUDA 1FBLA 1XFXA 2WOAA 2YB9A 2X3CA 3EDZA 1C3IA 2OXZA 3LE9A 2JIHA 1MMQA 4QKZA 5BOTA 1DMTA 3B92A 1EAKA 4L63A 4L6TA 4AIGA 4I03A 1KBCA 4HX3A 1ZTQA 4PKTA 3WV2A 1O0QA 3HBUP 2W14A 5D7WA 4H2EA 3G5CA 1CXVA 4ZR5A 1KUIA 3G42A 4IN9A 1OM6A 3TVCA 1AF0A 1IADA 4DD8A 1BKCI 3LEAA 1BKCE 3WV1A 4GR3A 1JIWP 3DL1A 5CXAA 4IJOA 2YUFA 2MZEA 1ND1A 1A86A 1MNCA 4PKSA 1SLNA 3N2VA 4JQGA 5I4OA 4JIJA 3Q2GA 1HTDA 1HY7A 1IACA 2X7MA 2XS3A 2DW1A 2YIGA 4DV8A 3KMCA 4J4MA 5B5OA 3USNA 3RTTA 1JAQA 1PWVA 2XS4A 1MMRA 4GQLA 1CGFA 1D5JA 2D1NA 3TSKA 3F15A 2W15A 1OO9A 5D1TA 3ZUKA 3U1RA 1USNA 1C8TA 1DTHA 3P24A 1JANA 4H82A 5D2BA 2OW1A 2USNA 3TT4A 1G4KA 3GBOA 1MMPA 3HDBA 3F16A 2DDFA 4H76A 4XM6A 4GR0A 5I43A 4FVLA 4XBHA 1XURA 2DDYA 1D8MA 4FXQA 1XFYA 3LQ0A 1BKCA 1JIZA 1K7GA 3TS4A 1ROSA 2OI0A 1BQQM 2DW0A 2K9CA 1QICA 1HFCA 4H1QA 2AIGP 1UTTA 3UVCA 3LJGA 1CAQA 1UEAA 3HYGA 1O0TA 5CUHA 3VI1A 2L0RA 3NX7A 3RTSA 4DF9A 2W12A 1YQYA 1D8FA 1HFSA 1C7KA 1GE5A 1D7XA 2OXWA 3E8RA 3CKIA 1XFWA 4PKRA 3DWBA 2JT5A 3MA2A 1EB6A 1ZP5A 1OS2A 2OZRA 4PKVA 3I7IA 2D1OA 2OVZA 4H49A 3LK8A 5L7FA 1ZXCA 3WV3A 4CTHA 4H84A 4GWMA 3AYUA 2MZIA 2PJTA 3KHIA 1ZVXA 3V96B 1B3DA 1BM6A 1KUFA 3OHLA 1I1IP 5I3MA 1OM7A 1PWUA 3P1VA 1I73A 4FXYP 5I0LA 1BUVM 1QJJA 1BIWA 2MZHA 1GKDA 2J0TA 2OXUA 3BA0A 1GO8P 4FU4A 2QPJA 4WF6A 1JKYA 1SLMA 2POJA 1Y8JA 2WO9A 1J7NA 5H8XA 4Q1LA 4GF1A 5I12A 3HY9A 2Y6CA 3DPEA 5CZMA 3EDIA 1IAGA 1K7IA 2V4BA 1YP1A 2Z2DA 1BZSA 2N8RA 4ON1A 1BQOA 4L19A 2FV9A 1WNIA 1PWPA 3LKAA 1UMTA 1Y93A 1L6JA 3SHIA 1S4BP 5LABA 1GKCA 1R1IA 4DPEA 1EUBA 3LIKA 1CGEA 4L7AA 3DPFA 3B8ZA 1B8YA 2E3XA 3AYKA 3LUMA 3F18A 4WKEA 3HDAP 2K2GA 5BPAA 2X3BA 2MLRA 3DTEA 1FLSA 1BSWA 3LUNA 1OS9A 2EROA 1JAPA 4JPAA 1UTZA 2O36A 1GE6A 4IUWA 3EWJA 2OW0A 1XFVA 5D1UA 1G9KA 2KRJA 2I47A 1AYKA 2OY2A 2RJQA 4AUOA 2RJPA 1RMZA 1G05A 1KUKA 2AYKA 3LIRA 1OM8A 3EDGA 2CKIA 1UMSA 1PWQA 1XFZA 1GXDA 2J83A 2JT6A 2Y6DA 4WKIA 1IABA 3F19A 1SATA 1XFUA 3LJTA 1QUAA 1CK7A 4GR8A 3K7NA 3B2ZA 4JP4A 1BUDA 3K7LA 4I35A 2OY4A 4XM8A 1ATLA 4WK7A 3DTKA 2JNPA 1ASTA 4G0DA 2TCLA 3HBVP 5JMYA 1Y0VA 1SRPA 1CQRA 1RM8A 3OHOA 4HMAA 1ZS0A 2JSDA 1JJ9A 1K7QA 3AIGA 4PKWA 3LGPA 2MLSA 5B5PA 3DSLA 3HY7A 3L0TA 4H3XA 3ZXHA 3EHXA 1QIAA 1G12A 1XUCA 3KRYA 1JH1A 4AXQA 1MMBA 3F1AA 1QIBA 3EDHA 1YOUA 3LILA 3O64A 4A3WA 4XCTA 2W13A 1KAPP 1GE7A 1GO7P 4PKUA 1I76A 1KUGA 3DNGA 1OMJA 3KEJA 1CGLA 2OW2A 2FV5A 3I7GA 3KWVC 1R1JA 966CA 4G9LA 4EFSA 1HOVA 1CIZA 2SRTA 3VTGA 2E2DA 2ERPA 1JAOA 3N2UA 2HU6A 4ILWD 1R54A 3LQBA 3KECA 2OVXA 1A85A 1H71P 5BOYA 2A8HA 5D1SA 4R3VA 5D3CA 456CA 3ZVSA 1AKLA 1QJIA 3O2XA 2O3EA 1R55A 5I2ZA 1R1HA 4XM7A 3L0VA 1G49A 3HB2P 4GUYA 3LMCA 1IAEA 1ZXVA 4H30A 4JA1A 3LJZA 2X3AA 2CLTA 2ERQA 3Q2HA 3KEKA 2DW2A 2WO8A 4WZVA 3F17A 3ELMA 1Z3JA 2W0DA 1KUHA 4GWNA 1FM1A 3EHYA 830CA 3DTIA 1YCMA 5L79A 2OW9A 1SMPA 3KMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HV5 A;  1IAA A;  4PKQ A;  1Q3A A;  1JK3 A;  1SU3 A;  4AYK A;  1PWW A;  4A7B A;  1XUD A;  1FBL A;  1XFX A;  2WOA A;  2YB9 A;  2X3C A;  3EDZ A;  1C3I A;  2OXZ A;  3LE9 A;  2JIH A;  1MMQ A;  4QKZ A;  5BOT A;  1DMT A;  3B92 A;  1EAK A;  4L63 A;  4L6T A;  4AIG A;  4I03 A;  1KBC A;  4HX3 A;  1ZTQ A;  4PKT A;  3WV2 A;  1O0Q A;  3HBU P;  2W14 A;  5D7W A;  4H2E A;  3G5C A;  1CXV A;  4ZR5 A;  1KUI A;  3G42 A;  4IN9 A;  1OM6 A;  3TVC A;  1AF0 A;  1IAD A;  4DD8 A;  1BKC I;  3LEA A;  1BKC E;  3WV1 A;  4GR3 A;  1JIW P;  3DL1 A;  5CXA A;  4IJO A;  2MZE A;  1ND1 A;  1A86 A;  1MNC A;  4PKS A;  1SLN A;  3N2V A;  4JQG A;  5I4O A;  4JIJ A;  3Q2G A;  1HTD A;  1HY7 A;  1IAC A;  2X7M A;  2XS3 A;  2DW1 A;  2YIG A;  4DV8 A;  3KMC A;  4J4M A;  5B5O A;  3USN A;  3RTT A;  1JAQ A;  1PWV A;  2XS4 A;  1MMR A;  4GQL A;  1CGF A;  1D5J A;  2D1N A;  3TSK A;  3F15 A;  2W15 A;  1OO9 A;  5D1T A;  3ZUK A;  3U1R A;  1USN A;  1C8T A;  1DTH A;  3P24 A;  1JAN A;  4H82 A;  5D2B A;  2OW1 A;  2USN A;  3TT4 A;  1G4K A;  3GBO A;  1MMP A;  3HDB A;  3F16 A;  2DDF A;  4H76 A;  4XM6 A;  4GR0 A;  5I43 A;  4FVL A;  4XBH A;  1XUR A;  2DDY A;  1D8M A;  4FXQ A;  1XFY A;  3LQ0 A;  1BKC A;  1JIZ A;  1K7G A;  3TS4 A;  1ROS A;  2OI0 A;  1BQQ M;  2DW0 A;  2K9C A;  1QIC A;  1HFC A;  4H1Q A;  2AIG P;  1UTT A;  3UVC A;  3LJG A;  1CAQ A;  1UEA A;  3HYG A;  1O0T A;  5CUH A;  3VI1 A;  2L0R A;  3NX7 A;  3RTS A;  4DF9 A;  2W12 A;  1YQY A;  1D8F A;  1HFS A;  1C7K A;  1GE5 A;  1D7X A;  2OXW A;  3E8R A;  3CKI A;  1XFW A;  4PKR A;  3DWB A;  2JT5 A;  3MA2 A;  1EB6 A;  1ZP5 A;  1OS2 A;  2OZR A;  4PKV A;  3I7I A;  2D1O A;  2OVZ A;  4H49 A;  3LK8 A;  5L7F A;  1ZXC A;  3WV3 A;  4CTH A;  4H84 A;  4GWM A;  3AYU A;  2MZI A;  2PJT A;  3KHI A;  1ZVX A;  3V96 B;  1B3D A;  1BM6 A;  1KUF A;  3OHL A;  1I1I P;  5I3M A;  1OM7 A;  1PWU A;  3P1V A;  1I73 A;  4FXY P;  5I0L A;  1BUV M;  1QJJ A;  1BIW A;  2MZH A;  1GKD A;  2J0T A;  2OXU A;  3BA0 A;  1GO8 P;  4FU4 A;  2QPJ A;  4WF6 A;  1JKY A;  1SLM A;  2POJ A;  1Y8J A;  2WO9 A;  1J7N A;  5H8X A;  4Q1L A;  4GF1 A;  5I12 A;  3HY9 A;  2Y6C A;  3DPE A;  5CZM A;  3EDI A;  1IAG A;  1K7I A;  2V4B A;  1YP1 A;  2Z2D A;  1BZS A;  2N8R A;  4ON1 A;  1BQO A;  4L19 A;  2FV9 A;  1WNI A;  1PWP A;  3LKA A;  1UMT A;  1Y93 A;  1L6J A;  3SHI A;  1S4B P;  5LAB A;  1GKC A;  1R1I A;  4DPE A;  1EUB A;  3LIK A;  1CGE A;  3DPF A;  3B8Z A;  1B8Y A;  2E3X A;  3AYK A;  3LUM A;  3F18 A;  4WKE A;  3HDA P;  2K2G A;  5BPA A;  2X3B A;  2MLR A;  1FLS A;  1BSW A;  3LUN A;  1OS9 A;  2ERO A;  1JAP A;  4JPA A;  1UTZ A;  2O36 A;  1GE6 A;  4IUW A;  3EWJ A;  2OW0 A;  1XFV A;  5D1U A;  1G9K A;  2KRJ A;  2I47 A;  1AYK A;  2OY2 A;  2RJQ A;  4AUO A;  2RJP A;  1RMZ A;  1G05 A;  1KUK A;  2AYK A;  3LIR A;  1OM8 A;  3EDG A;  2CKI A;  1UMS A;  1PWQ A;  1XFZ A;  1GXD A;  2J83 A;  2JT6 A;  2Y6D A;  4WKI A;  1IAB A;  3F19 A;  1SAT A;  1XFU A;  3LJT A;  1QUA A;  1CK7 A;  4GR8 A;  3K7N A;  3B2Z A;  4JP4 A;  1BUD A;  3K7L A;  4I35 A;  2OY4 A;  4XM8 A;  1ATL A;  4WK7 A;  2JNP A;  1AST A;  4G0D A;  2TCL A;  3HBV P;  5JMY A;  1Y0V A;  1SRP A;  1CQR A;  1RM8 A;  3OHO A;  4HMA A;  1ZS0 A;  2JSD A;  1JJ9 A;  1K7Q A;  3AIG A;  4PKW A;  3LGP A;  2MLS A;  5B5P A;  3DSL A;  3HY7 A;  3L0T A;  4H3X A;  3ZXH A;  3EHX A;  1QIA A;  1G12 A;  1XUC A;  3KRY A;  1JH1 A;  4AXQ A;  1MMB A;  3F1A A;  1QIB A;  3EDH A;  1YOU A;  3LIL A;  3O64 A;  4A3W A;  4XCT A;  2W13 A;  1KAP P;  1GE7 A;  1GO7 P;  4PKU A;  1I76 A;  1KUG A;  3DNG A;  1OMJ A;  3KEJ A;  1CGL A;  2OW2 A;  2FV5 A;  3I7G A;  3KWV C;  1R1J A;  966C A;  4G9L A;  4EFS A;  1HOV A;  1CIZ A;  2SRT A;  3VTG A;  2E2D A;  2ERP A;  1JAO A;  3N2U A;  2HU6 A;  4ILW D;  1R54 A;  3LQB A;  3KEC A;  2OVX A;  1A85 A;  1H71 P;  5BOY A;  2A8H A;  5D1S A;  4R3V A;  5D3C A;  456C A;  3ZVS A;  1AKL A;  1QJI A;  3O2X A;  2O3E A;  1R55 A;  5I2Z A;  1R1H A;  4XM7 A;  3L0V A;  1G49 A;  3HB2 P;  4GUY A;  3LMC A;  1IAE A;  1ZXV A;  4H30 A;  4JA1 A;  3LJZ A;  2X3A A;  2CLT A;  2ERQ A;  3Q2H A;  3KEK A;  2DW2 A;  2WO8 A;  4WZV A;  3F17 A;  3ELM A;  1Z3J A;  2W0D A;  1KUH A;  4GWN A;  1FM1 A;  3EHY A;  830C A;  1YCM A;  5L79 A;  2OW9 A;  1SMP A;  3KME A; 
#chains in the Genus database with same CATH topology
 1HV5 A;  1IAA A;  4PKQ A;  1Q3A A;  1JK3 A;  1SU3 A;  4AYK A;  1PWW A;  4A7B A;  1XUD A;  1FBL A;  1XFX A;  2WOA A;  2YB9 A;  2X3C A;  3EDZ A;  1C3I A;  2OXZ A;  3LE9 A;  2JIH A;  1MMQ A;  4QKZ A;  5BOT A;  1DMT A;  3B92 A;  1EAK A;  1OZ9 A;  4L63 A;  4L6T A;  4AIG A;  4I03 A;  1KBC A;  4HX3 A;  1ZTQ A;  4PKT A;  3WV2 A;  1O0Q A;  3HBU P;  2W14 A;  5D7W A;  4H2E A;  3G5C A;  1CXV A;  4ZR5 A;  1KUI A;  3G42 A;  4IN9 A;  1OM6 A;  3TVC A;  1AF0 A;  1IAD A;  4DD8 A;  1BKC I;  3LEA A;  1BKC E;  3WV1 A;  4GR3 A;  1JIW P;  3DL1 A;  5CXA A;  4IJO A;  2YUF A;  2MZE A;  1ND1 A;  1A86 A;  1MNC A;  4PKS A;  1SLN A;  3N2V A;  4JQG A;  5I4O A;  4JIJ A;  3Q2G A;  1HTD A;  1HY7 A;  1IAC A;  2X7M A;  2XS3 A;  2DW1 A;  2YIG A;  4DV8 A;  3KMC A;  4J4M A;  5B5O A;  3USN A;  3RTT A;  1JAQ A;  1PWV A;  2XS4 A;  1MMR A;  4GQL A;  1CGF A;  1XM5 A;  1D5J A;  2D1N A;  3TSK A;  3F15 A;  2W15 A;  1OO9 A;  5D1T A;  3ZUK A;  3U1R A;  1USN A;  1C8T A;  1DTH A;  3P24 A;  1JAN A;  4H82 A;  5D2B A;  2OW1 A;  2USN A;  3TT4 A;  1G4K A;  3GBO A;  1MMP A;  3HDB A;  3F16 A;  2DDF A;  4H76 A;  4XM6 A;  4GR0 A;  5I43 A;  4FVL A;  4XBH A;  1XUR A;  2DDY A;  1D8M A;  4FXQ A;  1XFY A;  3LQ0 A;  1BKC A;  1JIZ A;  1K7G A;  3TS4 A;  1ROS A;  2OI0 A;  1BQQ M;  2DW0 A;  2K9C A;  1QIC A;  1HFC A;  4H1Q A;  2AIG P;  1UTT A;  3UVC A;  3LJG A;  1CAQ A;  1UEA A;  3HYG A;  1O0T A;  5CUH A;  3VI1 A;  2L0R A;  3NX7 A;  3RTS A;  4DF9 A;  2W12 A;  1YQY A;  1D8F A;  1HFS A;  1C7K A;  1GE5 A;  1D7X A;  2OXW A;  3E8R A;  3CKI A;  1XFW A;  4PKR A;  3DWB A;  2JT5 A;  3MA2 A;  1EB6 A;  1ZP5 A;  1XAX A;  1OS2 A;  2OZR A;  4PKV A;  3I7I A;  2D1O A;  2OVZ A;  4H49 A;  3LK8 A;  5L7F A;  1ZXC A;  3WV3 A;  4CTH A;  4H84 A;  4GWM A;  3AYU A;  2MZI A;  2PJT A;  3KHI A;  1ZVX A;  3V96 B;  1B3D A;  1BM6 A;  1KUF A;  3OHL A;  1I1I P;  5I3M A;  1OM7 A;  1PWU A;  3P1V A;  1I73 A;  4FXY P;  5I0L A;  1BUV M;  1QJJ A;  1BIW A;  2MZH A;  1GKD A;  2J0T A;  2OXU A;  3BA0 A;  1GO8 P;  4FU4 A;  2QPJ A;  4WF6 A;  1JKY A;  1SLM A;  2POJ A;  1TVI A;  1Y8J A;  1J7N A;  2WO9 A;  5H8X A;  4Q1L A;  4GF1 A;  5I12 A;  3HY9 A;  2Y6C A;  3DPE A;  5CZM A;  3EDI A;  1IAG A;  1K7I A;  2V4B A;  1YP1 A;  2Z2D A;  1BZS A;  2N8R A;  4ON1 A;  1BQO A;  4L19 A;  2FV9 A;  1WNI A;  1PWP A;  3LKA A;  1UMT A;  1Y93 A;  1L6J A;  3SHI A;  1S4B P;  5LAB A;  1GKC A;  1R1I A;  4DPE A;  1EUB A;  3LIK A;  1CGE A;  4L7A A;  3DPF A;  3B8Z A;  1B8Y A;  2E3X A;  3AYK A;  3LUM A;  3F18 A;  4WKE A;  3HDA P;  2K2G A;  5BPA A;  2X3B A;  2MLR A;  3DTE A;  1FLS A;  1BSW A;  3LUN A;  1OS9 A;  2ERO A;  1JAP A;  4JPA A;  1UTZ A;  2O36 A;  1GE6 A;  4IUW A;  3EWJ A;  2OW0 A;  1XFV A;  5D1U A;  1G9K A;  2KRJ A;  2I47 A;  1AYK A;  2OY2 A;  2RJQ A;  4AUO A;  2RJP A;  1RMZ A;  1G05 A;  1KUK A;  2AYK A;  3LIR A;  1OM8 A;  3EDG A;  2CKI A;  1UMS A;  1PWQ A;  1XFZ A;  1GXD A;  2J83 A;  2JT6 A;  2Y6D A;  4WKI A;  1IAB A;  3F19 A;  1SAT A;  1XFU A;  3LJT A;  1QUA A;  1CK7 A;  4GR8 A;  3K7N A;  3B2Z A;  4JP4 A;  1BUD A;  3K7L A;  4I35 A;  2OY4 A;  4XM8 A;  1ATL A;  4WK7 A;  3DTK A;  2JNP A;  1AST A;  4G0D A;  2TCL A;  3HBV P;  5JMY A;  1Y0V A;  1SRP A;  1CQR A;  1RM8 A;  3OHO A;  4HMA A;  1ZS0 A;  2JSD A;  1JJ9 A;  1K7Q A;  3AIG A;  4PKW A;  3LGP A;  2MLS A;  5B5P A;  3DSL A;  3HY7 A;  3L0T A;  4H3X A;  3ZXH A;  3EHX A;  1QIA A;  1G12 A;  1XUC A;  3KRY A;  1JH1 A;  4AXQ A;  1MMB A;  3F1A A;  1QIB A;  3EDH A;  1YOU A;  3LIL A;  3O64 A;  4A3W A;  4XCT A;  2W13 A;  1KAP P;  1GE7 A;  1GO7 P;  4PKU A;  1I76 A;  1KUG A;  3DNG A;  1OMJ A;  3KEJ A;  1CGL A;  2OW2 A;  2FV5 A;  3I7G A;  3KWV C;  1R1J A;  966C A;  4G9L A;  4EFS A;  1HOV A;  1CIZ A;  2SRT A;  3VTG A;  2E2D A;  2ERP A;  1JAO A;  3N2U A;  2HU6 A;  4ILW D;  1R54 A;  3LQB A;  3KEC A;  2OVX A;  1A85 A;  1H71 P;  5BOY A;  2A8H A;  5D1S A;  4R3V A;  5D3C A;  456C A;  3ZVS A;  1AKL A;  1QJI A;  3O2X A;  2O3E A;  1R55 A;  5I2Z A;  1R1H A;  4XM7 A;  3L0V A;  1G49 A;  3HB2 P;  4GUY A;  3LMC A;  1IAE A;  1ZXV A;  4H30 A;  4JA1 A;  3LJZ A;  2X3A A;  2CLT A;  2ERQ A;  3Q2H A;  3KEK A;  2DW2 A;  2WO8 A;  4WZV A;  3F17 A;  3ELM A;  1Z3J A;  2W0D A;  1KUH A;  4GWN A;  1FM1 A;  3EHY A;  830C A;  3DTI A;  1YCM A;  5L79 A;  2OW9 A;  1SMP A;  3KME A; 
#chains in the Genus database with same CATH homology
 1HV5 A;  1IAA A;  4PKQ A;  1Q3A A;  1JK3 A;  1SU3 A;  4AYK A;  1PWW A;  4A7B A;  1XUD A;  1FBL A;  1XFX A;  2WOA A;  2YB9 A;  2X3C A;  3EDZ A;  1C3I A;  2OXZ A;  3LE9 A;  2JIH A;  1MMQ A;  4QKZ A;  5BOT A;  1DMT A;  3B92 A;  1EAK A;  4L63 A;  4L6T A;  4AIG A;  4I03 A;  1KBC A;  4HX3 A;  1ZTQ A;  4PKT A;  3WV2 A;  1O0Q A;  3HBU P;  2W14 A;  5D7W A;  4H2E A;  3G5C A;  1CXV A;  4ZR5 A;  1KUI A;  3G42 A;  4IN9 A;  1OM6 A;  3TVC A;  1AF0 A;  1IAD A;  4DD8 A;  1BKC I;  3LEA A;  1BKC E;  3WV1 A;  4GR3 A;  1JIW P;  3DL1 A;  5CXA A;  4IJO A;  2YUF A;  2MZE A;  1ND1 A;  1A86 A;  1MNC A;  4PKS A;  1SLN A;  3N2V A;  4JQG A;  5I4O A;  4JIJ A;  3Q2G A;  1HTD A;  1HY7 A;  1IAC A;  2X7M A;  2XS3 A;  2DW1 A;  2YIG A;  4DV8 A;  3KMC A;  4J4M A;  5B5O A;  3USN A;  3RTT A;  1JAQ A;  1PWV A;  2XS4 A;  1MMR A;  4GQL A;  1CGF A;  1D5J A;  2D1N A;  3TSK A;  3F15 A;  2W15 A;  1OO9 A;  5D1T A;  3ZUK A;  3U1R A;  1USN A;  1C8T A;  1DTH A;  3P24 A;  1JAN A;  4H82 A;  5D2B A;  2OW1 A;  2USN A;  3TT4 A;  1G4K A;  3GBO A;  1MMP A;  3HDB A;  3F16 A;  2DDF A;  4H76 A;  4XM6 A;  4GR0 A;  5I43 A;  4FVL A;  4XBH A;  1XUR A;  2DDY A;  1D8M A;  4FXQ A;  1XFY A;  3LQ0 A;  1BKC A;  1JIZ A;  1K7G A;  3TS4 A;  1ROS A;  2OI0 A;  1BQQ M;  2DW0 A;  2K9C A;  1QIC A;  1HFC A;  4H1Q A;  2AIG P;  1UTT A;  3UVC A;  3LJG A;  1CAQ A;  1UEA A;  3HYG A;  1O0T A;  5CUH A;  3VI1 A;  2L0R A;  3NX7 A;  3RTS A;  4DF9 A;  2W12 A;  1YQY A;  1D8F A;  1HFS A;  1C7K A;  1GE5 A;  1D7X A;  2OXW A;  3E8R A;  3CKI A;  1XFW A;  4PKR A;  3DWB A;  2JT5 A;  3MA2 A;  1EB6 A;  1ZP5 A;  1OS2 A;  2OZR A;  4PKV A;  3I7I A;  2D1O A;  2OVZ A;  4H49 A;  3LK8 A;  5L7F A;  1ZXC A;  3WV3 A;  4CTH A;  4H84 A;  4GWM A;  3AYU A;  2MZI A;  2PJT A;  3KHI A;  1ZVX A;  3V96 B;  1B3D A;  1BM6 A;  1KUF A;  3OHL A;  1I1I P;  5I3M A;  1OM7 A;  1PWU A;  3P1V A;  1I73 A;  4FXY P;  5I0L A;  1BUV M;  1QJJ A;  1BIW A;  2MZH A;  1GKD A;  2J0T A;  2OXU A;  3BA0 A;  1GO8 P;  4FU4 A;  2QPJ A;  4WF6 A;  1JKY A;  1SLM A;  2POJ A;  1Y8J A;  2WO9 A;  1J7N A;  5H8X A;  4Q1L A;  4GF1 A;  5I12 A;  3HY9 A;  2Y6C A;  3DPE A;  5CZM A;  3EDI A;  1IAG A;  1K7I A;  2V4B A;  1YP1 A;  2Z2D A;  1BZS A;  2N8R A;  4ON1 A;  1BQO A;  4L19 A;  2FV9 A;  1WNI A;  1PWP A;  3LKA A;  1UMT A;  1Y93 A;  1L6J A;  3SHI A;  1S4B P;  5LAB A;  1GKC A;  1R1I A;  4DPE A;  1EUB A;  3LIK A;  1CGE A;  4L7A A;  3DPF A;  3B8Z A;  1B8Y A;  2E3X A;  3AYK A;  3LUM A;  3F18 A;  4WKE A;  3HDA P;  2K2G A;  5BPA A;  2X3B A;  2MLR A;  3DTE A;  1FLS A;  1BSW A;  3LUN A;  1OS9 A;  2ERO A;  1JAP A;  4JPA A;  1UTZ A;  2O36 A;  1GE6 A;  4IUW A;  3EWJ A;  2OW0 A;  1XFV A;  5D1U A;  1G9K A;  2KRJ A;  2I47 A;  1AYK A;  2OY2 A;  2RJQ A;  4AUO A;  2RJP A;  1RMZ A;  1G05 A;  1KUK A;  2AYK A;  3LIR A;  1OM8 A;  3EDG A;  2CKI A;  1UMS A;  1PWQ A;  1XFZ A;  1GXD A;  2J83 A;  2JT6 A;  2Y6D A;  4WKI A;  1IAB A;  3F19 A;  1SAT A;  1XFU A;  3LJT A;  1QUA A;  1CK7 A;  4GR8 A;  3K7N A;  3B2Z A;  4JP4 A;  1BUD A;  3K7L A;  4I35 A;  2OY4 A;  4XM8 A;  1ATL A;  4WK7 A;  3DTK A;  2JNP A;  1AST A;  4G0D A;  2TCL A;  3HBV P;  5JMY A;  1Y0V A;  1SRP A;  1CQR A;  1RM8 A;  3OHO A;  4HMA A;  1ZS0 A;  2JSD A;  1JJ9 A;  1K7Q A;  3AIG A;  4PKW A;  3LGP A;  2MLS A;  5B5P A;  3DSL A;  3HY7 A;  3L0T A;  4H3X A;  3ZXH A;  3EHX A;  1QIA A;  1G12 A;  1XUC A;  3KRY A;  1JH1 A;  4AXQ A;  1MMB A;  3F1A A;  1QIB A;  3EDH A;  1YOU A;  3LIL A;  3O64 A;  4A3W A;  4XCT A;  2W13 A;  1KAP P;  1GE7 A;  1GO7 P;  4PKU A;  1I76 A;  1KUG A;  3DNG A;  1OMJ A;  3KEJ A;  1CGL A;  2OW2 A;  2FV5 A;  3I7G A;  3KWV C;  1R1J A;  966C A;  4G9L A;  4EFS A;  1HOV A;  1CIZ A;  2SRT A;  3VTG A;  2E2D A;  2ERP A;  1JAO A;  3N2U A;  2HU6 A;  4ILW D;  1R54 A;  3LQB A;  3KEC A;  2OVX A;  1A85 A;  1H71 P;  5BOY A;  2A8H A;  5D1S A;  4R3V A;  5D3C A;  456C A;  3ZVS A;  1AKL A;  1QJI A;  3O2X A;  2O3E A;  1R55 A;  5I2Z A;  1R1H A;  4XM7 A;  3L0V A;  1G49 A;  3HB2 P;  4GUY A;  3LMC A;  1IAE A;  1ZXV A;  4H30 A;  4JA1 A;  3LJZ A;  2X3A A;  2CLT A;  2ERQ A;  3Q2H A;  3KEK A;  2DW2 A;  2WO8 A;  4WZV A;  3F17 A;  3ELM A;  1Z3J A;  2W0D A;  1KUH A;  4GWN A;  1FM1 A;  3EHY A;  830C A;  3DTI A;  1YCM A;  5L79 A;  2OW9 A;  1SMP A;  3KME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...