1MMQA

Matrilysin complexed with hydroxamate inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metalloprotease
molecule keywords MATRILYSIN
publication title Matrilysin-inhibitor complexes: common themes among metalloproteases.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 1995-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1mmqA00
5I3MA 2I47A 1SLMA 2WO8A 1Y93A 1JJ9A 2DDYA 5D2BA 3MA2A 5B5PA 4ILWD 4XM6A 2OXUA 1BUDA 1WNIA 1UTTA 1ND1A 4GR3A 3ELMA 3LMCA 3ZUKA 3L0VA 3RTTA 2E3XA 3DSLA 4WKIA 4HMAA 2USNA 2W14A 1XUDA 1BM6A 1BZSA 1SMPA 1CK7A 1Z3JA 1GE5A 4I35A 1KUKA 5JMYA 1ZP5A 3LK8A 3KEJA 2OZRA 4AYKA 2K9CA 5D7WA 4FVLA 2DDFA 1HY7A 1QIBA 1SATA 1Y8JA 4R3VA 1AF0A 1JH1A 1MMBA 3WV3A 1FM1A 1G12A 3DNGA 4J4MA 1G49A 2JNPA 1AYKA 2W12A 2MZIA 1CIZA 2JT5A 3HBVP 1QJJA 1YCMA 4XM8A 2JT6A 1K7IA 1O0TA 1CAQA 3KEKA 1O0QA 1PWQA 4HX3A 1PWUA 1MMPA 2QPJA 4JP4A 1I1IP 2MLRA 2W15A 3KMEA 2K2GA 3LKAA 1OS2A 3USNA 4DPEA 2E2DA 2AIGP 2D1NA 4H1QA 2X3BA 1UMTA 1GXDA 3CKIA 1XURA 1I76A 2OW0A 1GE7A 4JQGA 4PKRA 3UVCA 3Q2GA 4PKQA 3E8RA 3L0TA 2WO9A 3KRYA 3DPEA 1G4KA 1C3IA 1IABA 4JPAA 1JAPA 2KRJA 3B92A 3P1VA 3N2UA 4WF6A 2Y6CA 4GWMA 4H82A 2W0DA 1HFSA 1FLSA 4A3WA 3BA0A 4I03A 5D3CA 1GKCA 3NX7A 1SLNA 2DW0A 3F15A 3TVCA 5CUHA 1H71P 4DF9A 1CGFA 4L6TA 3OHOA 3DL1A 3LILA 1MNCA 966CA 4WZVA 3AYKA 2AYKA 2N8RA 3LIRA 1D8MA 1L6JA 2OVXA 4PKUA 2ERPA 1SU3A 1R55A 2FV9A 1QUAA 1DTHA 1S4BP 1XFWA 1MMQA 1R1JA 3K7LA 1ATLA 1K7QA 2PJTA 1SRPA 1G05A 1IAGA 1BKCI 3GBOA 1KUIA 1AKLA 5I4OA 3HY9A 3HBUP 1OS9A 2J0TA 1EB6A 3TSKA 1JIZA 4G9LA 1ZXCA 1JANA 456CA 5I0LA 1HV5A 3KHIA 2O36A 3I7GA 4PKWA 2L0RA 5H8XA 1KUHA 4WK7A 1GKDA 5D1TA 1QICA 3F16A 3EHXA 1BQOA 3HDAP 4H30A 3TS4A 3LQBA 4IUWA 2MLSA 3KMCA 1A85A 1RM8A 3RTSA 1HTDA 4XBHA 3EDHA 1ZXVA 5I43A 1JK3A 4H3XA 4L19A 1XFVA 1UTZA 3LE9A 3LUNA 4G0DA 4Q1LA 1ZTQA 1IAEA 3HY7A 2Z2DA 1B8YA 2OY2A 3LJTA 4JA1A 1XUCA 3OHLA 3WV2A 1DMTA 2OXZA 3KECA 5B5OA 3EDIA 1ZS0A 1Y0VA 4H84A 2J83A 4PKSA 1XFXA 3HB2P 3LJZA 1XFZA 3DWBA 1HOVA 1UMSA 4AXQA 2X3AA 1CGEA 2MZHA 1BIWA 1BKCE 4GUYA 3F1AA 2YB9A 1J7NA 2MZEA 4AIGA 2D1OA 4H49A 1R1HA 1KBCA 3VTGA 2O3EA 2RJQA 4FXQA 2DW1A 1BUVM 2OI0A 2Y6DA 3F18A 5BOTA 2SRTA 4H76A 4XCTA 4A7BA 2V4BA 1C7KA 3DPFA 4XM7A 3Q2HA 4QKZA 1YOUA 1ROSA 1R1IA 1YQYA 2X3CA 830CA 4GR8A 3B8ZA 4DD8A 3O2XA 1OM7A 3I7IA 1PWVA 1RMZA 4GQLA 3K7NA 3AIGA 2CLTA 4GF1A 4CTHA 2RJPA 1UEAA 1OM6A 4H2EA 1JKYA 1G9KA 3VI1A 1JAQA 3SHIA 1KAPP 3B2ZA 2TCLA 4DV8A 1GO7P 4PKVA 4JIJA 1FBLA 1OM8A 1JAOA 5D1SA 1ASTA 2DW2A 5CXAA 4L63A 3G42A 3HDBA 2OW1A 1QIAA 3LJGA 3O64A 5LABA 1D5JA 1I73A 1QJIA 2OVZA 2POJA 2FV5A 5L79A 1CGLA 1Q3AA 4ON1A 3P24A 5I2ZA 1PWWA 3HYGA 3TT4A 2HU6A 3AYUA 3ZXHA 1KUGA 2EROA 5BPAA 1XFUA 4EFSA 3EDZA 1OO9A 3EWJA 1IADA 3G5CA 4GR0A 4WKEA 4GWNA 5BOYA 3N2VA 3LUMA 4PKTA 1CQRA 2XS4A 3LEAA 2XS3A 3WV1A 1IACA 3F17A 1K7GA 3EHYA 1D8FA 1CXVA 4ZR5A 5I12A 2X7MA 3EDGA 1PWPA 1YP1A 1D7XA 1GO8P 2OY4A 3LIKA 2YIGA 2CKIA 2JIHA 1ZVXA 3LQ0A 1EAKA 2OW9A 2OW2A 2JSDA 4FXYP 1MMRA 3LGPA 4IN9A 2W13A 3KWVC 2WOAA 1BKCA 3V96B 3F19A 1JIWP 1B3DA 4FU4A 1OMJA 1R54A 1HFCA 3ZVSA 1KUFA 3U1RA 2OXWA 1USNA 1XFYA 1A86A 5CZMA 2ERQA 4AUOA 1BQQM 1C8TA 5L7FA 1IAAA 1EUBA 4IJOA 5D1UA 1BSWA 2A8HA 1GE6A
chains in the Genus database with same CATH superfamily
5I3MA 2I47A 1SLMA 2WO8A 2YUFA 1Y93A 1JJ9A 2DDYA 5D2BA 3MA2A 5B5PA 3DTKA 4ILWD 4XM6A 2OXUA 1BUDA 1WNIA 1UTTA 1ND1A 4GR3A 3ELMA 3LMCA 3ZUKA 3L0VA 3RTTA 2E3XA 3DSLA 4WKIA 4HMAA 2USNA 2W14A 1XUDA 1BM6A 1BZSA 1SMPA 1CK7A 1Z3JA 1GE5A 4I35A 1KUKA 4L7AA 5JMYA 1ZP5A 3LK8A 3KEJA 2OZRA 4AYKA 2K9CA 5D7WA 4FVLA 2DDFA 1HY7A 1QIBA 1SATA 1Y8JA 4R3VA 1AF0A 1JH1A 1MMBA 3WV3A 1FM1A 1G12A 3DNGA 4J4MA 1G49A 2JNPA 1AYKA 2W12A 2MZIA 1CIZA 2JT5A 3HBVP 1QJJA 1YCMA 4XM8A 2JT6A 1K7IA 1O0TA 1CAQA 3KEKA 1O0QA 1PWQA 4HX3A 1PWUA 1MMPA 2QPJA 4JP4A 1I1IP 2MLRA 2W15A 3KMEA 2K2GA 3LKAA 1OS2A 3USNA 4DPEA 2E2DA 2AIGP 2D1NA 4H1QA 2X3BA 1UMTA 1GXDA 3CKIA 1XURA 1I76A 2OW0A 1GE7A 4JQGA 4PKRA 3UVCA 3Q2GA 4PKQA 3E8RA 3L0TA 2WO9A 3KRYA 3DPEA 1G4KA 1C3IA 1IABA 4JPAA 1JAPA 2KRJA 3B92A 3P1VA 3N2UA 4WF6A 2Y6CA 4GWMA 4H82A 2W0DA 1HFSA 1FLSA 4A3WA 3BA0A 4I03A 5D3CA 1GKCA 3NX7A 1SLNA 2DW0A 3F15A 3TVCA 5CUHA 1H71P 4DF9A 1CGFA 4L6TA 3OHOA 3DL1A 3LILA 1MNCA 966CA 4WZVA 3AYKA 2AYKA 2N8RA 3LIRA 1D8MA 1L6JA 2OVXA 4PKUA 2ERPA 1SU3A 1R55A 2FV9A 1QUAA 1DTHA 1S4BP 1XFWA 1MMQA 1R1JA 3K7LA 1ATLA 1K7QA 2PJTA 1SRPA 1G05A 1IAGA 1BKCI 3GBOA 1KUIA 1AKLA 5I4OA 3HY9A 3HBUP 1OS9A 2J0TA 1EB6A 3TSKA 1JIZA 4G9LA 1ZXCA 1JANA 456CA 5I0LA 1HV5A 3KHIA 2O36A 3I7GA 4PKWA 2L0RA 5H8XA 1KUHA 4WK7A 1GKDA 5D1TA 1QICA 3F16A 3EHXA 1BQOA 3HDAP 4H30A 3TS4A 3LQBA 4IUWA 2MLSA 3KMCA 1A85A 1RM8A 3RTSA 1HTDA 4XBHA 3EDHA 1ZXVA 5I43A 1JK3A 4H3XA 4L19A 1XFVA 1UTZA 1XAXA 3LE9A 3LUNA 4G0DA 4Q1LA 1ZTQA 1IAEA 3HY7A 2Z2DA 1B8YA 2OY2A 3LJTA 4JA1A 1XUCA 3OHLA 3WV2A 1DMTA 2OXZA 3KECA 5B5OA 3EDIA 1ZS0A 1Y0VA 4H84A 2J83A 4PKSA 1XFXA 3HB2P 3LJZA 1XFZA 3DWBA 1HOVA 1UMSA 4AXQA 2X3AA 1CGEA 2MZHA 1BIWA 1BKCE 4GUYA 3F1AA 2YB9A 1J7NA 2MZEA 4AIGA 2D1OA 4H49A 1R1HA 1KBCA 3VTGA 2O3EA 2RJQA 4FXQA 1OZ9A 2DW1A 1BUVM 1XM5A 2OI0A 2Y6DA 3F18A 5BOTA 2SRTA 4H76A 4XCTA 4A7BA 2V4BA 1C7KA 3DPFA 4XM7A 3Q2HA 4QKZA 1YOUA 1ROSA 1R1IA 1YQYA 2X3CA 830CA 4GR8A 3B8ZA 4DD8A 3O2XA 1OM7A 3I7IA 1PWVA 1RMZA 4GQLA 3K7NA 3AIGA 2CLTA 4GF1A 4CTHA 2RJPA 1UEAA 1OM6A 4H2EA 1JKYA 1G9KA 3VI1A 1JAQA 3SHIA 1KAPP 3B2ZA 2TCLA 4DV8A 1GO7P 4PKVA 4JIJA 1FBLA 1OM8A 1JAOA 5D1SA 1ASTA 2DW2A 5CXAA 3DTEA 4L63A 3G42A 3HDBA 2OW1A 1QIAA 3LJGA 3O64A 5LABA 1D5JA 1I73A 1QJIA 2OVZA 2POJA 2FV5A 5L79A 1CGLA 1Q3AA 4ON1A 3P24A 5I2ZA 1PWWA 3HYGA 3TT4A 2HU6A 3AYUA 3ZXHA 1KUGA 2EROA 5BPAA 1XFUA 4EFSA 3EDZA 1OO9A 3EWJA 1IADA 3G5CA 4GR0A 4WKEA 4GWNA 5BOYA 3N2VA 3LUMA 4PKTA 1CQRA 2XS4A 3LEAA 2XS3A 3WV1A 1IACA 3F17A 1K7GA 3EHYA 1D8FA 1CXVA 4ZR5A 5I12A 2X7MA 3EDGA 1PWPA 1YP1A 1D7XA 1GO8P 2OY4A 3LIKA 2YIGA 2CKIA 2JIHA 3DTIA 1ZVXA 3LQ0A 1EAKA 2OW9A 2OW2A 2JSDA 4FXYP 1MMRA 3LGPA 4IN9A 2W13A 3KWVC 2WOAA 1BKCA 3V96B 3F19A 1JIWP 1B3DA 4FU4A 1TVIA 1OMJA 1R54A 1HFCA 3ZVSA 1KUFA 3U1RA 2OXWA 1USNA 1XFYA 1A86A 5CZMA 2ERQA 4AUOA 1BQQM 1C8TA 5L7FA 1IAAA 1EUBA 4IJOA 5D1UA 1BSWA 2A8HA 1GE6A
chains in the Genus database with same CATH topology
5I3MA 2I47A 1SLMA 2WO8A 2YUFA 1Y93A 1JJ9A 2DDYA 5D2BA 3MA2A 5B5PA 3DTKA 4ILWD 4XM6A 2OXUA 1BUDA 1WNIA 1UTTA 1ND1A 4GR3A 3ELMA 3LMCA 3ZUKA 3L0VA 3RTTA 2E3XA 3DSLA 4WKIA 4HMAA 2USNA 2W14A 1XUDA 1BM6A 1BZSA 1SMPA 1CK7A 1Z3JA 1GE5A 4I35A 1KUKA 4L7AA 5JMYA 1ZP5A 3LK8A 3KEJA 2OZRA 4AYKA 2K9CA 5D7WA 4FVLA 2DDFA 1HY7A 1QIBA 1SATA 1Y8JA 4R3VA 1AF0A 1JH1A 1MMBA 3WV3A 1FM1A 1G12A 3DNGA 4J4MA 1G49A 2JNPA 1AYKA 2W12A 2MZIA 1CIZA 2JT5A 3HBVP 1QJJA 1YCMA 4XM8A 2JT6A 1K7IA 1O0TA 1CAQA 3KEKA 1O0QA 1PWQA 4HX3A 1PWUA 1MMPA 2QPJA 4JP4A 1I1IP 2MLRA 2W15A 3KMEA 2K2GA 3LKAA 1OS2A 3USNA 4DPEA 2E2DA 2AIGP 2D1NA 4H1QA 2X3BA 1UMTA 1GXDA 3CKIA 1XURA 1I76A 2OW0A 1GE7A 4JQGA 4PKRA 3UVCA 3Q2GA 4PKQA 3E8RA 3L0TA 2WO9A 3KRYA 3DPEA 1G4KA 1C3IA 1IABA 4JPAA 1JAPA 2KRJA 3B92A 3P1VA 3N2UA 4WF6A 2Y6CA 4GWMA 4H82A 2W0DA 1HFSA 1FLSA 4A3WA 3BA0A 4I03A 5D3CA 1GKCA 3NX7A 1SLNA 2DW0A 3F15A 3TVCA 5CUHA 1H71P 4DF9A 1CGFA 4L6TA 3OHOA 3DL1A 3LILA 1MNCA 966CA 4WZVA 3AYKA 2AYKA 2N8RA 3LIRA 1D8MA 1L6JA 2OVXA 4PKUA 2ERPA 1SU3A 1R55A 2FV9A 1QUAA 1DTHA 1S4BP 1XFWA 1MMQA 1R1JA 3K7LA 1ATLA 1K7QA 2PJTA 1SRPA 1G05A 1IAGA 1BKCI 3GBOA 1KUIA 1AKLA 5I4OA 3HY9A 3HBUP 1OS9A 2J0TA 1EB6A 3TSKA 1JIZA 4G9LA 1ZXCA 1JANA 456CA 5I0LA 1HV5A 3KHIA 2O36A 3I7GA 4PKWA 2L0RA 5H8XA 1KUHA 4WK7A 1GKDA 5D1TA 1QICA 3F16A 3EHXA 1BQOA 3HDAP 4H30A 3TS4A 3LQBA 4IUWA 2MLSA 3KMCA 1A85A 1RM8A 3RTSA 1HTDA 4XBHA 3EDHA 1ZXVA 5I43A 1JK3A 4H3XA 4L19A 1XFVA 1UTZA 3LE9A 3LUNA 4G0DA 4Q1LA 1ZTQA 1IAEA 3HY7A 2Z2DA 1B8YA 2OY2A 3LJTA 4JA1A 1XUCA 3OHLA 3WV2A 1DMTA 2OXZA 3KECA 5B5OA 3EDIA 1ZS0A 1Y0VA 4H84A 2J83A 4PKSA 1XFXA 3HB2P 3LJZA 1XFZA 3DWBA 1HOVA 1UMSA 4AXQA 2X3AA 1CGEA 2MZHA 1BIWA 1BKCE 4GUYA 3F1AA 2YB9A 1J7NA 2MZEA 4AIGA 2D1OA 4H49A 1R1HA 1KBCA 3VTGA 2O3EA 2RJQA 4FXQA 2DW1A 1BUVM 2OI0A 2Y6DA 3F18A 5BOTA 2SRTA 4H76A 4XCTA 4A7BA 2V4BA 1C7KA 3DPFA 4XM7A 3Q2HA 4QKZA 1YOUA 1ROSA 1R1IA 1YQYA 2X3CA 830CA 4GR8A 3B8ZA 4DD8A 3O2XA 1OM7A 3I7IA 1PWVA 1RMZA 4GQLA 3K7NA 3AIGA 2CLTA 4GF1A 4CTHA 2RJPA 1UEAA 1OM6A 4H2EA 1JKYA 1G9KA 3VI1A 1JAQA 3SHIA 1KAPP 3B2ZA 2TCLA 4DV8A 1GO7P 4PKVA 4JIJA 1FBLA 1OM8A 1JAOA 5D1SA 1ASTA 2DW2A 5CXAA 3DTEA 4L63A 3G42A 3HDBA 2OW1A 1QIAA 3LJGA 3O64A 5LABA 1D5JA 1I73A 1QJIA 2OVZA 2POJA 2FV5A 5L79A 1CGLA 1Q3AA 4ON1A 3P24A 5I2ZA 1PWWA 3HYGA 3TT4A 2HU6A 3AYUA 3ZXHA 1KUGA 2EROA 5BPAA 1XFUA 4EFSA 3EDZA 1OO9A 3EWJA 1IADA 3G5CA 4GR0A 4WKEA 4GWNA 5BOYA 3N2VA 3LUMA 4PKTA 1CQRA 2XS4A 3LEAA 2XS3A 3WV1A 1IACA 3F17A 1K7GA 3EHYA 1D8FA 1CXVA 4ZR5A 5I12A 2X7MA 3EDGA 1PWPA 1YP1A 1D7XA 1GO8P 2OY4A 3LIKA 2YIGA 2CKIA 2JIHA 3DTIA 1ZVXA 3LQ0A 1EAKA 2OW9A 2OW2A 2JSDA 4FXYP 1MMRA 3LGPA 4IN9A 2W13A 3KWVC 2WOAA 1BKCA 3V96B 3F19A 1JIWP 1B3DA 4FU4A 1OMJA 1R54A 1HFCA 3ZVSA 1KUFA 3U1RA 2OXWA 1USNA 1XFYA 1A86A 5CZMA 2ERQA 4AUOA 1BQQM 1C8TA 5L7FA 1IAAA 1EUBA 4IJOA 5D1UA 1BSWA 2A8HA 1GE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I3M A;  2I47 A;  1SLM A;  2WO8 A;  1Y93 A;  1JJ9 A;  2DDY A;  5D2B A;  3MA2 A;  5B5P A;  4ILW D;  4XM6 A;  2OXU A;  1BUD A;  1WNI A;  1UTT A;  1ND1 A;  4GR3 A;  3ELM A;  3LMC A;  3ZUK A;  3L0V A;  3RTT A;  2E3X A;  3DSL A;  4WKI A;  4HMA A;  2USN A;  2W14 A;  1XUD A;  1BM6 A;  1BZS A;  1SMP A;  1CK7 A;  1Z3J A;  1GE5 A;  4I35 A;  1KUK A;  5JMY A;  1ZP5 A;  3LK8 A;  3KEJ A;  2OZR A;  4AYK A;  2K9C A;  5D7W A;  4FVL A;  2DDF A;  1HY7 A;  1QIB A;  1SAT A;  1Y8J A;  4R3V A;  1AF0 A;  1JH1 A;  1MMB A;  3WV3 A;  1FM1 A;  1G12 A;  3DNG A;  4J4M A;  1G49 A;  2JNP A;  1AYK A;  2W12 A;  2MZI A;  1CIZ A;  2JT5 A;  3HBV P;  1QJJ A;  1YCM A;  4XM8 A;  2JT6 A;  1K7I A;  1O0T A;  1CAQ A;  3KEK A;  1O0Q A;  1PWQ A;  4HX3 A;  1PWU A;  1MMP A;  2QPJ A;  4JP4 A;  1I1I P;  2MLR A;  2W15 A;  3KME A;  2K2G A;  3LKA A;  1OS2 A;  3USN A;  4DPE A;  2E2D A;  2AIG P;  2D1N A;  4H1Q A;  2X3B A;  1UMT A;  1GXD A;  3CKI A;  1XUR A;  1I76 A;  2OW0 A;  1GE7 A;  4JQG A;  4PKR A;  3UVC A;  3Q2G A;  4PKQ A;  3E8R A;  3L0T A;  2WO9 A;  3KRY A;  3DPE A;  1G4K A;  1C3I A;  1IAB A;  4JPA A;  1JAP A;  2KRJ A;  3B92 A;  3P1V A;  3N2U A;  4WF6 A;  2Y6C A;  4GWM A;  4H82 A;  2W0D A;  1HFS A;  1FLS A;  4A3W A;  3BA0 A;  4I03 A;  5D3C A;  1GKC A;  3NX7 A;  1SLN A;  2DW0 A;  3F15 A;  3TVC A;  5CUH A;  1H71 P;  4DF9 A;  1CGF A;  4L6T A;  3OHO A;  3DL1 A;  3LIL A;  1MNC A;  966C A;  4WZV A;  3AYK A;  2AYK A;  2N8R A;  3LIR A;  1D8M A;  1L6J A;  2OVX A;  4PKU A;  2ERP A;  1SU3 A;  1R55 A;  2FV9 A;  1QUA A;  1DTH A;  1S4B P;  1XFW A;  1MMQ A;  1R1J A;  3K7L A;  1ATL A;  1K7Q A;  2PJT A;  1SRP A;  1G05 A;  1IAG A;  1BKC I;  3GBO A;  1KUI A;  1AKL A;  5I4O A;  3HY9 A;  3HBU P;  1OS9 A;  2J0T A;  1EB6 A;  3TSK A;  1JIZ A;  4G9L A;  1ZXC A;  1JAN A;  456C A;  5I0L A;  1HV5 A;  3KHI A;  2O36 A;  3I7G A;  4PKW A;  2L0R A;  5H8X A;  1KUH A;  4WK7 A;  1GKD A;  5D1T A;  1QIC A;  3F16 A;  3EHX A;  1BQO A;  3HDA P;  4H30 A;  3TS4 A;  3LQB A;  4IUW A;  2MLS A;  3KMC A;  1A85 A;  1RM8 A;  3RTS A;  1HTD A;  4XBH A;  3EDH A;  1ZXV A;  5I43 A;  1JK3 A;  4H3X A;  4L19 A;  1XFV A;  1UTZ A;  3LE9 A;  3LUN A;  4G0D A;  4Q1L A;  1ZTQ A;  1IAE A;  3HY7 A;  2Z2D A;  1B8Y A;  2OY2 A;  3LJT A;  4JA1 A;  1XUC A;  3OHL A;  3WV2 A;  1DMT A;  2OXZ A;  3KEC A;  5B5O A;  3EDI A;  1ZS0 A;  1Y0V A;  4H84 A;  2J83 A;  4PKS A;  1XFX A;  3HB2 P;  3LJZ A;  1XFZ A;  3DWB A;  1HOV A;  1UMS A;  4AXQ A;  2X3A A;  1CGE A;  2MZH A;  1BIW A;  1BKC E;  4GUY A;  3F1A A;  2YB9 A;  1J7N A;  2MZE A;  4AIG A;  2D1O A;  4H49 A;  1R1H A;  1KBC A;  3VTG A;  2O3E A;  2RJQ A;  4FXQ A;  2DW1 A;  1BUV M;  2OI0 A;  2Y6D A;  3F18 A;  5BOT A;  2SRT A;  4H76 A;  4XCT A;  4A7B A;  2V4B A;  1C7K A;  3DPF A;  4XM7 A;  3Q2H A;  4QKZ A;  1YOU A;  1ROS A;  1R1I A;  1YQY A;  2X3C A;  830C A;  4GR8 A;  3B8Z A;  4DD8 A;  3O2X A;  1OM7 A;  3I7I A;  1PWV A;  1RMZ A;  4GQL A;  3K7N A;  3AIG A;  2CLT A;  4GF1 A;  4CTH A;  2RJP A;  1UEA A;  1OM6 A;  4H2E A;  1JKY A;  1G9K A;  3VI1 A;  1JAQ A;  3SHI A;  1KAP P;  3B2Z A;  2TCL A;  4DV8 A;  1GO7 P;  4PKV A;  4JIJ A;  1FBL A;  1OM8 A;  1JAO A;  5D1S A;  1AST A;  2DW2 A;  5CXA A;  4L63 A;  3G42 A;  3HDB A;  2OW1 A;  1QIA A;  3LJG A;  3O64 A;  5LAB A;  1D5J A;  1I73 A;  1QJI A;  2OVZ A;  2POJ A;  2FV5 A;  5L79 A;  1CGL A;  1Q3A A;  4ON1 A;  3P24 A;  5I2Z A;  1PWW A;  3HYG A;  3TT4 A;  2HU6 A;  3AYU A;  3ZXH A;  1KUG A;  2ERO A;  5BPA A;  1XFU A;  4EFS A;  3EDZ A;  1OO9 A;  3EWJ A;  1IAD A;  3G5C A;  4GR0 A;  4WKE A;  4GWN A;  5BOY A;  3N2V A;  3LUM A;  4PKT A;  1CQR A;  2XS4 A;  3LEA A;  2XS3 A;  3WV1 A;  1IAC A;  3F17 A;  1K7G A;  3EHY A;  1D8F A;  1CXV A;  4ZR5 A;  5I12 A;  2X7M A;  3EDG A;  1PWP A;  1YP1 A;  1D7X A;  1GO8 P;  2OY4 A;  3LIK A;  2YIG A;  2CKI A;  2JIH A;  1ZVX A;  3LQ0 A;  1EAK A;  2OW9 A;  2OW2 A;  2JSD A;  4FXY P;  1MMR A;  3LGP A;  4IN9 A;  2W13 A;  3KWV C;  2WOA A;  1BKC A;  3V96 B;  3F19 A;  1JIW P;  1B3D A;  4FU4 A;  1OMJ A;  1R54 A;  1HFC A;  3ZVS A;  1KUF A;  3U1R A;  2OXW A;  1USN A;  1XFY A;  1A86 A;  5CZM A;  2ERQ A;  4AUO A;  1BQQ M;  1C8T A;  5L7F A;  1IAA A;  1EUB A;  4IJO A;  5D1U A;  1BSW A;  2A8H A;  1GE6 A; 
#chains in the Genus database with same CATH topology
 5I3M A;  2I47 A;  1SLM A;  2WO8 A;  2YUF A;  1Y93 A;  1JJ9 A;  2DDY A;  5D2B A;  3MA2 A;  5B5P A;  3DTK A;  4ILW D;  4XM6 A;  2OXU A;  1BUD A;  1WNI A;  1UTT A;  1ND1 A;  4GR3 A;  3ELM A;  3LMC A;  3ZUK A;  3L0V A;  3RTT A;  2E3X A;  3DSL A;  4WKI A;  4HMA A;  2USN A;  2W14 A;  1XUD A;  1BM6 A;  1BZS A;  1SMP A;  1CK7 A;  1Z3J A;  1GE5 A;  4I35 A;  1KUK A;  4L7A A;  5JMY A;  1ZP5 A;  3LK8 A;  3KEJ A;  2OZR A;  4AYK A;  2K9C A;  5D7W A;  4FVL A;  2DDF A;  1HY7 A;  1QIB A;  1SAT A;  1Y8J A;  4R3V A;  1AF0 A;  1JH1 A;  1MMB A;  3WV3 A;  1FM1 A;  1G12 A;  3DNG A;  4J4M A;  1G49 A;  2JNP A;  1AYK A;  2W12 A;  2MZI A;  1CIZ A;  2JT5 A;  3HBV P;  1QJJ A;  1YCM A;  4XM8 A;  2JT6 A;  1K7I A;  1O0T A;  1CAQ A;  3KEK A;  1O0Q A;  1PWQ A;  4HX3 A;  1PWU A;  1MMP A;  2QPJ A;  4JP4 A;  1I1I P;  2MLR A;  2W15 A;  3KME A;  2K2G A;  3LKA A;  1OS2 A;  3USN A;  4DPE A;  2E2D A;  2AIG P;  2D1N A;  4H1Q A;  2X3B A;  1UMT A;  1GXD A;  3CKI A;  1XUR A;  1I76 A;  2OW0 A;  1GE7 A;  4JQG A;  4PKR A;  3UVC A;  3Q2G A;  4PKQ A;  3E8R A;  3L0T A;  2WO9 A;  3KRY A;  3DPE A;  1G4K A;  1C3I A;  1IAB A;  4JPA A;  1JAP A;  2KRJ A;  3B92 A;  3P1V A;  3N2U A;  4WF6 A;  2Y6C A;  4GWM A;  4H82 A;  2W0D A;  1HFS A;  1FLS A;  4A3W A;  3BA0 A;  4I03 A;  5D3C A;  1GKC A;  3NX7 A;  1SLN A;  2DW0 A;  3F15 A;  3TVC A;  5CUH A;  1H71 P;  4DF9 A;  1CGF A;  4L6T A;  3OHO A;  3DL1 A;  3LIL A;  1MNC A;  966C A;  4WZV A;  3AYK A;  2AYK A;  2N8R A;  3LIR A;  1D8M A;  1L6J A;  2OVX A;  4PKU A;  2ERP A;  1SU3 A;  1R55 A;  2FV9 A;  1QUA A;  1DTH A;  1S4B P;  1XFW A;  1MMQ A;  1R1J A;  3K7L A;  1ATL A;  1K7Q A;  2PJT A;  1SRP A;  1G05 A;  1IAG A;  1BKC I;  3GBO A;  1KUI A;  1AKL A;  5I4O A;  3HY9 A;  3HBU P;  1OS9 A;  2J0T A;  1EB6 A;  3TSK A;  1JIZ A;  4G9L A;  1ZXC A;  1JAN A;  456C A;  5I0L A;  1HV5 A;  3KHI A;  2O36 A;  3I7G A;  4PKW A;  2L0R A;  5H8X A;  1KUH A;  4WK7 A;  1GKD A;  5D1T A;  1QIC A;  3F16 A;  3EHX A;  1BQO A;  3HDA P;  4H30 A;  3TS4 A;  3LQB A;  4IUW A;  2MLS A;  3KMC A;  1A85 A;  1RM8 A;  3RTS A;  1HTD A;  4XBH A;  3EDH A;  1ZXV A;  5I43 A;  1JK3 A;  4H3X A;  4L19 A;  1XFV A;  1UTZ A;  1XAX A;  3LE9 A;  3LUN A;  4G0D A;  4Q1L A;  1ZTQ A;  1IAE A;  3HY7 A;  2Z2D A;  1B8Y A;  2OY2 A;  3LJT A;  4JA1 A;  1XUC A;  3OHL A;  3WV2 A;  1DMT A;  2OXZ A;  3KEC A;  5B5O A;  3EDI A;  1ZS0 A;  1Y0V A;  4H84 A;  2J83 A;  4PKS A;  1XFX A;  3HB2 P;  3LJZ A;  1XFZ A;  3DWB A;  1HOV A;  1UMS A;  4AXQ A;  2X3A A;  1CGE A;  2MZH A;  1BIW A;  1BKC E;  4GUY A;  3F1A A;  2YB9 A;  1J7N A;  2MZE A;  4AIG A;  2D1O A;  4H49 A;  1R1H A;  1KBC A;  3VTG A;  2O3E A;  2RJQ A;  4FXQ A;  1OZ9 A;  2DW1 A;  1BUV M;  1XM5 A;  2OI0 A;  2Y6D A;  3F18 A;  5BOT A;  2SRT A;  4H76 A;  4XCT A;  4A7B A;  2V4B A;  1C7K A;  3DPF A;  4XM7 A;  3Q2H A;  4QKZ A;  1YOU A;  1ROS A;  1R1I A;  1YQY A;  2X3C A;  830C A;  4GR8 A;  3B8Z A;  4DD8 A;  3O2X A;  1OM7 A;  3I7I A;  1PWV A;  1RMZ A;  4GQL A;  3K7N A;  3AIG A;  2CLT A;  4GF1 A;  4CTH A;  2RJP A;  1UEA A;  1OM6 A;  4H2E A;  1JKY A;  1G9K A;  3VI1 A;  1JAQ A;  3SHI A;  1KAP P;  3B2Z A;  2TCL A;  4DV8 A;  1GO7 P;  4PKV A;  4JIJ A;  1FBL A;  1OM8 A;  1JAO A;  5D1S A;  1AST A;  2DW2 A;  5CXA A;  3DTE A;  4L63 A;  3G42 A;  3HDB A;  2OW1 A;  1QIA A;  3LJG A;  3O64 A;  5LAB A;  1D5J A;  1I73 A;  1QJI A;  2OVZ A;  2POJ A;  2FV5 A;  5L79 A;  1CGL A;  1Q3A A;  4ON1 A;  3P24 A;  5I2Z A;  1PWW A;  3HYG A;  3TT4 A;  2HU6 A;  3AYU A;  3ZXH A;  1KUG A;  2ERO A;  5BPA A;  1XFU A;  4EFS A;  3EDZ A;  1OO9 A;  3EWJ A;  1IAD A;  3G5C A;  4GR0 A;  4WKE A;  4GWN A;  5BOY A;  3N2V A;  3LUM A;  4PKT A;  1CQR A;  2XS4 A;  3LEA A;  2XS3 A;  3WV1 A;  1IAC A;  3F17 A;  1K7G A;  3EHY A;  1D8F A;  1CXV A;  4ZR5 A;  5I12 A;  2X7M A;  3EDG A;  1PWP A;  1YP1 A;  1D7X A;  1GO8 P;  2OY4 A;  3LIK A;  2YIG A;  2CKI A;  2JIH A;  3DTI A;  1ZVX A;  3LQ0 A;  1EAK A;  2OW9 A;  2OW2 A;  2JSD A;  4FXY P;  1MMR A;  3LGP A;  4IN9 A;  2W13 A;  3KWV C;  2WOA A;  1BKC A;  3V96 B;  3F19 A;  1JIW P;  1B3D A;  4FU4 A;  1TVI A;  1OMJ A;  1R54 A;  1HFC A;  3ZVS A;  1KUF A;  3U1R A;  2OXW A;  1USN A;  1XFY A;  1A86 A;  5CZM A;  2ERQ A;  4AUO A;  1BQQ M;  1C8T A;  5L7F A;  1IAA A;  1EUB A;  4IJO A;  5D1U A;  1BSW A;  2A8H A;  1GE6 A; 
#chains in the Genus database with same CATH homology
 5I3M A;  2I47 A;  1SLM A;  2WO8 A;  2YUF A;  1Y93 A;  1JJ9 A;  2DDY A;  5D2B A;  3MA2 A;  5B5P A;  3DTK A;  4ILW D;  4XM6 A;  2OXU A;  1BUD A;  1WNI A;  1UTT A;  1ND1 A;  4GR3 A;  3ELM A;  3LMC A;  3ZUK A;  3L0V A;  3RTT A;  2E3X A;  3DSL A;  4WKI A;  4HMA A;  2USN A;  2W14 A;  1XUD A;  1BM6 A;  1BZS A;  1SMP A;  1CK7 A;  1Z3J A;  1GE5 A;  4I35 A;  1KUK A;  4L7A A;  5JMY A;  1ZP5 A;  3LK8 A;  3KEJ A;  2OZR A;  4AYK A;  2K9C A;  5D7W A;  4FVL A;  2DDF A;  1HY7 A;  1QIB A;  1SAT A;  1Y8J A;  4R3V A;  1AF0 A;  1JH1 A;  1MMB A;  3WV3 A;  1FM1 A;  1G12 A;  3DNG A;  4J4M A;  1G49 A;  2JNP A;  1AYK A;  2W12 A;  2MZI A;  1CIZ A;  2JT5 A;  3HBV P;  1QJJ A;  1YCM A;  4XM8 A;  2JT6 A;  1K7I A;  1O0T A;  1CAQ A;  3KEK A;  1O0Q A;  1PWQ A;  4HX3 A;  1PWU A;  1MMP A;  2QPJ A;  4JP4 A;  1I1I P;  2MLR A;  2W15 A;  3KME A;  2K2G A;  3LKA A;  1OS2 A;  3USN A;  4DPE A;  2E2D A;  2AIG P;  2D1N A;  4H1Q A;  2X3B A;  1UMT A;  1GXD A;  3CKI A;  1XUR A;  1I76 A;  2OW0 A;  1GE7 A;  4JQG A;  4PKR A;  3UVC A;  3Q2G A;  4PKQ A;  3E8R A;  3L0T A;  2WO9 A;  3KRY A;  3DPE A;  1G4K A;  1C3I A;  1IAB A;  4JPA A;  1JAP A;  2KRJ A;  3B92 A;  3P1V A;  3N2U A;  4WF6 A;  2Y6C A;  4GWM A;  4H82 A;  2W0D A;  1HFS A;  1FLS A;  4A3W A;  3BA0 A;  4I03 A;  5D3C A;  1GKC A;  3NX7 A;  1SLN A;  2DW0 A;  3F15 A;  3TVC A;  5CUH A;  1H71 P;  4DF9 A;  1CGF A;  4L6T A;  3OHO A;  3DL1 A;  3LIL A;  1MNC A;  966C A;  4WZV A;  3AYK A;  2AYK A;  2N8R A;  3LIR A;  1D8M A;  1L6J A;  2OVX A;  4PKU A;  2ERP A;  1SU3 A;  1R55 A;  2FV9 A;  1QUA A;  1DTH A;  1S4B P;  1XFW A;  1MMQ A;  1R1J A;  3K7L A;  1ATL A;  1K7Q A;  2PJT A;  1SRP A;  1G05 A;  1IAG A;  1BKC I;  3GBO A;  1KUI A;  1AKL A;  5I4O A;  3HY9 A;  3HBU P;  1OS9 A;  2J0T A;  1EB6 A;  3TSK A;  1JIZ A;  4G9L A;  1ZXC A;  1JAN A;  456C A;  5I0L A;  1HV5 A;  3KHI A;  2O36 A;  3I7G A;  4PKW A;  2L0R A;  5H8X A;  1KUH A;  4WK7 A;  1GKD A;  5D1T A;  1QIC A;  3F16 A;  3EHX A;  1BQO A;  3HDA P;  4H30 A;  3TS4 A;  3LQB A;  4IUW A;  2MLS A;  3KMC A;  1A85 A;  1RM8 A;  3RTS A;  1HTD A;  4XBH A;  3EDH A;  1ZXV A;  5I43 A;  1JK3 A;  4H3X A;  4L19 A;  1XFV A;  1UTZ A;  3LE9 A;  3LUN A;  4G0D A;  4Q1L A;  1ZTQ A;  1IAE A;  3HY7 A;  2Z2D A;  1B8Y A;  2OY2 A;  3LJT A;  4JA1 A;  1XUC A;  3OHL A;  3WV2 A;  1DMT A;  2OXZ A;  3KEC A;  5B5O A;  3EDI A;  1ZS0 A;  1Y0V A;  4H84 A;  2J83 A;  4PKS A;  1XFX A;  3HB2 P;  3LJZ A;  1XFZ A;  3DWB A;  1HOV A;  1UMS A;  4AXQ A;  2X3A A;  1CGE A;  2MZH A;  1BIW A;  1BKC E;  4GUY A;  3F1A A;  2YB9 A;  1J7N A;  2MZE A;  4AIG A;  2D1O A;  4H49 A;  1R1H A;  1KBC A;  3VTG A;  2O3E A;  2RJQ A;  4FXQ A;  2DW1 A;  1BUV M;  2OI0 A;  2Y6D A;  3F18 A;  5BOT A;  2SRT A;  4H76 A;  4XCT A;  4A7B A;  2V4B A;  1C7K A;  3DPF A;  4XM7 A;  3Q2H A;  4QKZ A;  1YOU A;  1ROS A;  1R1I A;  1YQY A;  2X3C A;  830C A;  4GR8 A;  3B8Z A;  4DD8 A;  3O2X A;  1OM7 A;  3I7I A;  1PWV A;  1RMZ A;  4GQL A;  3K7N A;  3AIG A;  2CLT A;  4GF1 A;  4CTH A;  2RJP A;  1UEA A;  1OM6 A;  4H2E A;  1JKY A;  1G9K A;  3VI1 A;  1JAQ A;  3SHI A;  1KAP P;  3B2Z A;  2TCL A;  4DV8 A;  1GO7 P;  4PKV A;  4JIJ A;  1FBL A;  1OM8 A;  1JAO A;  5D1S A;  1AST A;  2DW2 A;  5CXA A;  3DTE A;  4L63 A;  3G42 A;  3HDB A;  2OW1 A;  1QIA A;  3LJG A;  3O64 A;  5LAB A;  1D5J A;  1I73 A;  1QJI A;  2OVZ A;  2POJ A;  2FV5 A;  5L79 A;  1CGL A;  1Q3A A;  4ON1 A;  3P24 A;  5I2Z A;  1PWW A;  3HYG A;  3TT4 A;  2HU6 A;  3AYU A;  3ZXH A;  1KUG A;  2ERO A;  5BPA A;  1XFU A;  4EFS A;  3EDZ A;  1OO9 A;  3EWJ A;  1IAD A;  3G5C A;  4GR0 A;  4WKE A;  4GWN A;  5BOY A;  3N2V A;  3LUM A;  4PKT A;  1CQR A;  2XS4 A;  3LEA A;  2XS3 A;  3WV1 A;  1IAC A;  3F17 A;  1K7G A;  3EHY A;  1D8F A;  1CXV A;  4ZR5 A;  5I12 A;  2X7M A;  3EDG A;  1PWP A;  1YP1 A;  1D7X A;  1GO8 P;  2OY4 A;  3LIK A;  2YIG A;  2CKI A;  2JIH A;  3DTI A;  1ZVX A;  3LQ0 A;  1EAK A;  2OW9 A;  2OW2 A;  2JSD A;  4FXY P;  1MMR A;  3LGP A;  4IN9 A;  2W13 A;  3KWV C;  2WOA A;  1BKC A;  3V96 B;  3F19 A;  1JIW P;  1B3D A;  4FU4 A;  1OMJ A;  1R54 A;  1HFC A;  3ZVS A;  1KUF A;  3U1R A;  2OXW A;  1USN A;  1XFY A;  1A86 A;  5CZM A;  2ERQ A;  4AUO A;  1BQQ M;  1C8T A;  5L7F A;  1IAA A;  1EUB A;  4IJO A;  5D1U A;  1BSW A;  2A8H A;  1GE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...