4AYKA

Catalytic fragment of human fibroblast collagenase complexed with cgs-27023a, nmr, 30 structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
169
structure length
169
Chain Sequence
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Matrix metalloproteinase
molecule keywords PROTEIN (COLLAGENASE)
publication title NMR solution structure of the catalytic fragment of human fibroblast collagenase complexed with a sulfonamide derivative of a hydroxamic acid compound.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 169
sequence length 169
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 1999-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4aykA00
1XUDA 1ZP5A 3LJTA 3AYKA 3I7IA 4I03A 2D1NA 3KWVC 2XS4A 5BOYA 3NX7A 2OW9A 2O36A 3LIRA 4PKVA 1BIWA 4A7BA 2AYKA 4PKWA 4XBHA 4QKZA 1S4BP 2KRJA 1UMTA 4H2EA 5I3MA 1HTDA 3Q2GA 4DV8A 4EFSA 1PWWA 3V96B 4L6TA 1JH1A 3F16A 1CQRA 1IAAA 4H49A 3VTGA 3ZUKA 2QPJA 1CGLA 4H30A 2X3BA 1CGFA 3EHXA 4JIJA 2X3CA 3L0TA 1K7IA 2OXUA 1R55A 1Z3JA 1BQQM 2W14A 3TVCA 4GWNA 1HFCA 1QIAA 4FXQA 1G12A 1BZSA 1JJ9A 4Q1LA 2D1OA 1BQOA 1GKDA 2ERPA 1JANA 4XM8A 1BUDA 4HX3A 2CLTA 2DW0A 2O3EA 2J83A 2POJA 1HOVA 1O0TA 3TS4A 2FV5A 3DL1A 4DD8A 1MMQA 1SU3A 1ZXCA 3WV1A 3F1AA 1XFYA 1Y93A 2MLRA 4L19A 2OXZA 4PKTA 1GXDA 3HDBA 4FU4A 1SRPA 1BKCA 2FV9A 4H82A 3K7NA 4FVLA 4AXQA 1XFUA 2L0RA 2OXWA 1BSWA 3EDGA 3LEAA 2USNA 2JNPA 1SMPA 1DMTA 1MMPA 1G49A 4J4MA 1KUKA 3N2UA 4DF9A 1R54A 1PWQA 1R1JA 1H71P 3WV2A 1IAEA 3EDIA 2X7MA 4L63A 3O64A 1UTZA 2MZHA 4GR8A 2WO9A 1JAQA 1GE5A 1AYKA 2OVXA 3USNA 1GO7P 1FM1A 5I0LA 3MA2A 1C3IA 5I43A 4AUOA 1BKCI 1ZVXA 3EWJA 2XS3A 3KHIA 1YCMA 4HMAA 1ATLA 1QICA 1SLMA 5D1TA 4JP4A 1R1HA 3HY7A 3LE9A 1ZS0A 1C8TA 2J0TA 3B92A 1KBCA 4IN9A 1AF0A 2DDFA 3EDZA 3AYUA 5H8XA 1IADA 5I12A 456CA 1R1IA 3TSKA 4FXYP 1FBLA 1OM7A 966CA 4XM7A 4WF6A 3KMEA 5I4OA 2Y6DA 5D7WA 1OS2A 1D8MA 4JA1A 4GWMA 5L79A 1SLNA 1MMRA 4WKEA 1CXVA 1HV5A 2OW2A 2I47A 1QJIA 3KEKA 1USNA 4IJOA 3EHYA 4PKQA 1XFWA 4GUYA 1GE7A 3Q2HA 1PWPA 1I73A 4JPAA 1DTHA 3RTSA 3F17A 3DPFA 3G5CA 3HB2P 3HBUP 5I2ZA 3KMCA 1O0QA 1JK3A 3HDAP 4WK7A 3ELMA 4G9LA 1I76A 1RMZA 1D8FA 1HFSA 4ON1A 2JT5A 1EUBA 1JAPA 3TT4A 1D5JA 3F19A 1EAKA 1JIZA 2CKIA 4CTHA 2MZIA 3G42A 1D7XA 2N8RA 1GO8P 4H1QA 2AIGP 1J7NA 3N2VA 1G4KA 1AKLA 3RTTA 4PKSA 3KRYA 3HBVP 1CAQA 5B5PA 3I7GA 4PKRA 4DPEA 1WNIA 1QIBA 1XUCA 3O2XA 1HY7A 1OS9A 3LJGA 1ZTQA 4H84A 1IACA 3LKAA 1JAOA 3EDHA 3E8RA 2RJPA 3LJZA 2ERQA 1BKCE 1PWUA 1CGEA 2JT6A 2OI0A 3F15A 2OZRA 2WO8A 3LMCA 2TCLA 1YQYA 3LILA 1YP1A 2W15A 3U1RA 2A8HA 5BPAA 1L6JA 1JIWP 5D3CA 1A85A 5D2BA 2Z2DA 3KEJA 2DDYA 2K2GA 3P1VA 3CKIA 2E3XA 2MZEA 1B3DA 1A86A 3HY9A 1KAPP 1FLSA 1OMJA 4XM6A 2OVZA 3DWBA 1Y0VA 2X3AA 2SRTA 1QJJA 830CA 4IUWA 1ASTA 3B8ZA 1GE6A 1XFXA 2RJQA 2JSDA 1MNCA 1ZXVA 5L7FA 1Q3AA 2YIGA 3HYGA 5B5OA 3LQBA 5JMYA 1KUHA 1ND1A 3ZVSA 1XFVA 4R3VA 3ZXHA 1KUGA 4A3WA 1I1IP 3LUNA 1BUVM 1CK7A 1G05A 3GBOA 3LQ0A 2DW2A 3LGPA 3WV3A 3BA0A 1RM8A 4GQLA 4AIGA 4H3XA 4AYKA 1Y8JA 1QUAA 1IAGA 3DPEA 4GF1A 1KUFA 2EROA 2HU6A 3LIKA 1GKCA 2OY4A 2W13A 2JIHA 4XCTA 4JQGA 1XURA 1JKYA 2PJTA 5LABA 1OO9A 2DW1A 1ROSA 3DSLA 5D1UA 3DNGA 1B8YA 3UVCA 5D1SA 3F18A 4I35A 3P24A 5CZMA 1K7QA 4WKIA 4ZR5A 3B2ZA 4PKUA 1CIZA 3LUMA 5BOTA 2V4BA 1PWVA 2Y6CA 2MLSA 2OW1A 1C7KA 1OM6A 1K7GA 3OHOA 2OW0A 5CUHA 1OM8A 1KUIA 3KECA 1UEAA 3OHLA 2K9CA 4WZVA 2YB9A 1EB6A 3K7LA 1SATA 1XFZA 1BM6A 4GR3A 2OY2A 1UMSA 3LK8A 1UTTA 3SHIA 2WOAA 4GR0A 2W12A 1MMBA 2E2DA 3VI1A 1G9KA 4G0DA 4ILWD 5CXAA 3AIGA 4H76A 2W0DA 1IABA 3L0VA 1YOUA
chains in the Genus database with same CATH superfamily
1XUDA 1ZP5A 3LJTA 3AYKA 3I7IA 4I03A 2D1NA 3KWVC 2XS4A 5BOYA 3NX7A 2OW9A 2O36A 3LIRA 4PKVA 1BIWA 4A7BA 2AYKA 4PKWA 4XBHA 4QKZA 1S4BP 2KRJA 1UMTA 4H2EA 5I3MA 1HTDA 3Q2GA 4DV8A 4EFSA 1PWWA 3V96B 4L6TA 4L7AA 1JH1A 3F16A 1CQRA 1IAAA 4H49A 3VTGA 3ZUKA 2QPJA 1CGLA 4H30A 2X3BA 1CGFA 3EHXA 4JIJA 2X3CA 3L0TA 1K7IA 2OXUA 1R55A 1Z3JA 1BQQM 2W14A 3TVCA 4GWNA 1HFCA 1QIAA 4FXQA 1G12A 1BZSA 1JJ9A 4Q1LA 2D1OA 1BQOA 1GKDA 2ERPA 1JANA 4XM8A 1BUDA 4HX3A 2CLTA 2DW0A 2O3EA 2J83A 2POJA 1HOVA 1O0TA 3TS4A 2FV5A 3DL1A 4DD8A 1MMQA 1SU3A 1ZXCA 3WV1A 3F1AA 1XFYA 1Y93A 2MLRA 4L19A 2OXZA 4PKTA 1GXDA 3HDBA 4FU4A 1SRPA 1BKCA 2FV9A 4H82A 3K7NA 4FVLA 4AXQA 1XFUA 2L0RA 2OXWA 1BSWA 3EDGA 3LEAA 2USNA 2JNPA 1SMPA 1DMTA 1MMPA 1G49A 4J4MA 1KUKA 1XAXA 3N2UA 4DF9A 1R54A 1PWQA 1R1JA 1H71P 3WV2A 1IAEA 3EDIA 2X7MA 4L63A 3O64A 1UTZA 2MZHA 4GR8A 2WO9A 1JAQA 1GE5A 1AYKA 2OVXA 3USNA 1GO7P 1FM1A 5I0LA 3MA2A 1C3IA 5I43A 4AUOA 1BKCI 1ZVXA 3EWJA 2XS3A 3KHIA 1YCMA 4HMAA 1ATLA 1QICA 1SLMA 3DTKA 5D1TA 4JP4A 1R1HA 3HY7A 3LE9A 1ZS0A 1C8TA 2J0TA 3B92A 1KBCA 4IN9A 1AF0A 2DDFA 3EDZA 3AYUA 5H8XA 1IADA 5I12A 456CA 1R1IA 3TSKA 4FXYP 1FBLA 1OM7A 966CA 4XM7A 4WF6A 3KMEA 5I4OA 2Y6DA 5D7WA 1OS2A 1D8MA 4JA1A 4GWMA 5L79A 1SLNA 1MMRA 4WKEA 1CXVA 1HV5A 2OW2A 2I47A 1QJIA 3KEKA 1USNA 4IJOA 3EHYA 4PKQA 1XFWA 4GUYA 1GE7A 3Q2HA 1PWPA 1I73A 4JPAA 1DTHA 3RTSA 3F17A 3DPFA 3G5CA 3HB2P 3HBUP 5I2ZA 3KMCA 1O0QA 1JK3A 3HDAP 4WK7A 3ELMA 4G9LA 1I76A 1RMZA 1D8FA 1HFSA 4ON1A 2JT5A 1EUBA 1JAPA 3TT4A 1D5JA 3F19A 1EAKA 1JIZA 2CKIA 4CTHA 2MZIA 3G42A 1D7XA 2N8RA 1GO8P 4H1QA 2AIGP 1J7NA 3N2VA 1G4KA 1AKLA 3RTTA 4PKSA 3KRYA 3HBVP 1CAQA 5B5PA 3I7GA 4PKRA 4DPEA 1WNIA 1QIBA 1XUCA 3O2XA 1HY7A 1TVIA 1OS9A 3LJGA 1ZTQA 4H84A 1IACA 3LKAA 1JAOA 3EDHA 3E8RA 2RJPA 3LJZA 2ERQA 1BKCE 1PWUA 1CGEA 2JT6A 2OI0A 3F15A 3DTIA 2OZRA 2WO8A 3LMCA 2TCLA 1YQYA 3LILA 1YP1A 2W15A 3U1RA 2A8HA 5BPAA 1L6JA 1JIWP 5D3CA 1A85A 5D2BA 2Z2DA 3KEJA 2DDYA 2K2GA 3P1VA 3CKIA 2E3XA 2MZEA 1B3DA 1A86A 3HY9A 1KAPP 1FLSA 1OMJA 4XM6A 2OVZA 3DWBA 1Y0VA 2X3AA 2SRTA 1QJJA 830CA 4IUWA 1ASTA 3B8ZA 1GE6A 1XFXA 2RJQA 2JSDA 1MNCA 1ZXVA 5L7FA 1Q3AA 2YIGA 3HYGA 5B5OA 3LQBA 5JMYA 1KUHA 1ND1A 3ZVSA 1XFVA 4R3VA 3ZXHA 1KUGA 4A3WA 1I1IP 3LUNA 1BUVM 1CK7A 1G05A 3GBOA 3LQ0A 2DW2A 3LGPA 3WV3A 3BA0A 1RM8A 4GQLA 4AIGA 4H3XA 4AYKA 1Y8JA 1QUAA 1IAGA 3DPEA 4GF1A 1KUFA 2EROA 2HU6A 3LIKA 1GKCA 2OY4A 2W13A 2JIHA 4XCTA 4JQGA 1XURA 1JKYA 2PJTA 5LABA 1OO9A 2DW1A 1ROSA 3DSLA 5D1UA 3DNGA 1B8YA 3UVCA 5D1SA 3F18A 4I35A 3P24A 5CZMA 2YUFA 1K7QA 4WKIA 4ZR5A 3B2ZA 3DTEA 4PKUA 1CIZA 3LUMA 5BOTA 2V4BA 1PWVA 2Y6CA 2MLSA 2OW1A 1C7KA 1OM6A 1K7GA 3OHOA 2OW0A 5CUHA 1OM8A 1KUIA 3KECA 1UEAA 3OHLA 2K9CA 4WZVA 2YB9A 1EB6A 3K7LA 1SATA 1XFZA 1BM6A 4GR3A 2OY2A 1UMSA 3LK8A 1XM5A 1UTTA 3SHIA 2WOAA 4GR0A 2W12A 1MMBA 2E2DA 3VI1A 1G9KA 1OZ9A 4G0DA 4ILWD 5CXAA 3AIGA 4H76A 2W0DA 1IABA 3L0VA 1YOUA
chains in the Genus database with same CATH topology
1XUDA 1ZP5A 3LJTA 3AYKA 3I7IA 4I03A 2D1NA 3KWVC 2XS4A 5BOYA 3NX7A 2OW9A 2O36A 3LIRA 4PKVA 1BIWA 4A7BA 2AYKA 4PKWA 4XBHA 4QKZA 1S4BP 2KRJA 1UMTA 4H2EA 5I3MA 1HTDA 3Q2GA 4DV8A 4EFSA 1PWWA 3V96B 4L6TA 4L7AA 1JH1A 3F16A 1CQRA 1IAAA 4H49A 3VTGA 3ZUKA 2QPJA 1CGLA 4H30A 2X3BA 1CGFA 3EHXA 4JIJA 2X3CA 3L0TA 1K7IA 2OXUA 1R55A 1Z3JA 1BQQM 2W14A 3TVCA 4GWNA 1HFCA 1QIAA 4FXQA 1G12A 1BZSA 1JJ9A 4Q1LA 2D1OA 1BQOA 1GKDA 2ERPA 1JANA 4XM8A 1BUDA 4HX3A 2CLTA 2DW0A 2O3EA 2J83A 2POJA 1HOVA 1O0TA 3TS4A 2FV5A 3DL1A 4DD8A 1MMQA 1SU3A 1ZXCA 3WV1A 3F1AA 1XFYA 1Y93A 2MLRA 4L19A 2OXZA 4PKTA 1GXDA 3HDBA 4FU4A 1SRPA 1BKCA 2FV9A 4H82A 3K7NA 4FVLA 4AXQA 1XFUA 2L0RA 2OXWA 1BSWA 3EDGA 3LEAA 2USNA 2JNPA 1SMPA 1DMTA 1MMPA 1G49A 4J4MA 1KUKA 3N2UA 4DF9A 1R54A 1PWQA 1R1JA 1H71P 3WV2A 1IAEA 3EDIA 2X7MA 4L63A 3O64A 1UTZA 2MZHA 4GR8A 2WO9A 1JAQA 1GE5A 1AYKA 2OVXA 3USNA 1GO7P 1FM1A 5I0LA 3MA2A 1C3IA 5I43A 4AUOA 1BKCI 1ZVXA 3EWJA 2XS3A 3KHIA 1YCMA 4HMAA 1ATLA 1QICA 1SLMA 3DTKA 5D1TA 4JP4A 1R1HA 3HY7A 3LE9A 1ZS0A 1C8TA 2J0TA 3B92A 1KBCA 4IN9A 1AF0A 2DDFA 3EDZA 3AYUA 5H8XA 1IADA 5I12A 456CA 1R1IA 3TSKA 4FXYP 1FBLA 1OM7A 966CA 4XM7A 4WF6A 3KMEA 5I4OA 2Y6DA 5D7WA 1OS2A 1D8MA 4JA1A 4GWMA 5L79A 1SLNA 1MMRA 4WKEA 1CXVA 1HV5A 2OW2A 2I47A 1QJIA 3KEKA 1USNA 4IJOA 3EHYA 4PKQA 1XFWA 4GUYA 1GE7A 3Q2HA 1PWPA 1I73A 4JPAA 1DTHA 3RTSA 3F17A 3DPFA 3G5CA 3HB2P 3HBUP 5I2ZA 3KMCA 1O0QA 1JK3A 3HDAP 4WK7A 3ELMA 4G9LA 1I76A 1RMZA 1D8FA 1HFSA 4ON1A 2JT5A 1EUBA 1JAPA 3TT4A 1D5JA 3F19A 1EAKA 1JIZA 2CKIA 4CTHA 2MZIA 3G42A 1D7XA 2N8RA 1GO8P 4H1QA 2AIGP 1J7NA 3N2VA 1G4KA 1AKLA 3RTTA 4PKSA 3KRYA 3HBVP 1CAQA 5B5PA 3I7GA 4PKRA 4DPEA 1WNIA 1QIBA 1XUCA 3O2XA 1HY7A 1OS9A 3LJGA 1ZTQA 4H84A 1IACA 3LKAA 1JAOA 3EDHA 3E8RA 2RJPA 3LJZA 2ERQA 1BKCE 1PWUA 1CGEA 2JT6A 2OI0A 3F15A 3DTIA 2OZRA 2WO8A 3LMCA 2TCLA 1YQYA 3LILA 1YP1A 2W15A 3U1RA 2A8HA 5BPAA 1L6JA 1JIWP 5D3CA 1A85A 5D2BA 2Z2DA 3KEJA 2DDYA 2K2GA 3P1VA 3CKIA 2E3XA 2MZEA 1B3DA 1A86A 3HY9A 1KAPP 1FLSA 1OMJA 4XM6A 2OVZA 3DWBA 1Y0VA 2X3AA 2SRTA 1QJJA 830CA 4IUWA 1ASTA 3B8ZA 1GE6A 1XFXA 2RJQA 2JSDA 1MNCA 1ZXVA 5L7FA 1Q3AA 2YIGA 3HYGA 5B5OA 3LQBA 5JMYA 1KUHA 1ND1A 3ZVSA 1XFVA 4R3VA 3ZXHA 1KUGA 4A3WA 1I1IP 3LUNA 1BUVM 1CK7A 1G05A 3GBOA 3LQ0A 2DW2A 3LGPA 3WV3A 3BA0A 1RM8A 4GQLA 4AIGA 4H3XA 4AYKA 1Y8JA 1QUAA 1IAGA 3DPEA 4GF1A 1KUFA 2EROA 2HU6A 3LIKA 1GKCA 2OY4A 2W13A 2JIHA 4XCTA 4JQGA 1XURA 1JKYA 2PJTA 5LABA 1OO9A 2DW1A 1ROSA 3DSLA 5D1UA 3DNGA 1B8YA 3UVCA 5D1SA 3F18A 4I35A 3P24A 5CZMA 2YUFA 1K7QA 4WKIA 4ZR5A 3B2ZA 3DTEA 4PKUA 1CIZA 3LUMA 5BOTA 2V4BA 1PWVA 2Y6CA 2MLSA 2OW1A 1C7KA 1OM6A 1K7GA 3OHOA 2OW0A 5CUHA 1OM8A 1KUIA 3KECA 1UEAA 3OHLA 2K9CA 4WZVA 2YB9A 1EB6A 3K7LA 1SATA 1XFZA 1BM6A 4GR3A 2OY2A 1UMSA 3LK8A 1UTTA 3SHIA 2WOAA 4GR0A 2W12A 1MMBA 2E2DA 3VI1A 1G9KA 4G0DA 4ILWD 5CXAA 3AIGA 4H76A 2W0DA 1IABA 3L0VA 1YOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUD A;  1ZP5 A;  3LJT A;  3AYK A;  3I7I A;  4I03 A;  2D1N A;  3KWV C;  2XS4 A;  5BOY A;  3NX7 A;  2OW9 A;  2O36 A;  3LIR A;  4PKV A;  1BIW A;  4A7B A;  2AYK A;  4PKW A;  4XBH A;  4QKZ A;  1S4B P;  2KRJ A;  1UMT A;  4H2E A;  5I3M A;  1HTD A;  3Q2G A;  4DV8 A;  4EFS A;  1PWW A;  3V96 B;  4L6T A;  1JH1 A;  3F16 A;  1CQR A;  1IAA A;  4H49 A;  3VTG A;  3ZUK A;  2QPJ A;  1CGL A;  4H30 A;  2X3B A;  1CGF A;  3EHX A;  4JIJ A;  2X3C A;  3L0T A;  1K7I A;  2OXU A;  1R55 A;  1Z3J A;  1BQQ M;  2W14 A;  3TVC A;  4GWN A;  1HFC A;  1QIA A;  4FXQ A;  1G12 A;  1BZS A;  1JJ9 A;  4Q1L A;  2D1O A;  1BQO A;  1GKD A;  2ERP A;  1JAN A;  4XM8 A;  1BUD A;  4HX3 A;  2CLT A;  2DW0 A;  2O3E A;  2J83 A;  2POJ A;  1HOV A;  1O0T A;  3TS4 A;  2FV5 A;  3DL1 A;  4DD8 A;  1MMQ A;  1SU3 A;  1ZXC A;  3WV1 A;  3F1A A;  1XFY A;  1Y93 A;  2MLR A;  4L19 A;  2OXZ A;  4PKT A;  1GXD A;  3HDB A;  4FU4 A;  1SRP A;  1BKC A;  2FV9 A;  4H82 A;  3K7N A;  4FVL A;  4AXQ A;  1XFU A;  2L0R A;  2OXW A;  1BSW A;  3EDG A;  3LEA A;  2USN A;  2JNP A;  1SMP A;  1DMT A;  1MMP A;  1G49 A;  4J4M A;  1KUK A;  3N2U A;  4DF9 A;  1R54 A;  1PWQ A;  1R1J A;  1H71 P;  3WV2 A;  1IAE A;  3EDI A;  2X7M A;  4L63 A;  3O64 A;  1UTZ A;  2MZH A;  4GR8 A;  2WO9 A;  1JAQ A;  1GE5 A;  1AYK A;  2OVX A;  3USN A;  1GO7 P;  1FM1 A;  5I0L A;  3MA2 A;  1C3I A;  5I43 A;  4AUO A;  1BKC I;  1ZVX A;  3EWJ A;  2XS3 A;  3KHI A;  1YCM A;  4HMA A;  1ATL A;  1QIC A;  1SLM A;  5D1T A;  4JP4 A;  1R1H A;  3HY7 A;  3LE9 A;  1ZS0 A;  1C8T A;  2J0T A;  3B92 A;  1KBC A;  4IN9 A;  1AF0 A;  2DDF A;  3EDZ A;  3AYU A;  5H8X A;  1IAD A;  5I12 A;  456C A;  1R1I A;  3TSK A;  4FXY P;  1FBL A;  1OM7 A;  966C A;  4XM7 A;  4WF6 A;  3KME A;  5I4O A;  2Y6D A;  5D7W A;  1OS2 A;  1D8M A;  4JA1 A;  4GWM A;  5L79 A;  1SLN A;  1MMR A;  4WKE A;  1CXV A;  1HV5 A;  2OW2 A;  2I47 A;  1QJI A;  3KEK A;  1USN A;  4IJO A;  3EHY A;  4PKQ A;  1XFW A;  4GUY A;  1GE7 A;  3Q2H A;  1PWP A;  1I73 A;  4JPA A;  1DTH A;  3RTS A;  3F17 A;  3DPF A;  3G5C A;  3HB2 P;  3HBU P;  5I2Z A;  3KMC A;  1O0Q A;  1JK3 A;  3HDA P;  4WK7 A;  3ELM A;  4G9L A;  1I76 A;  1RMZ A;  1D8F A;  1HFS A;  4ON1 A;  2JT5 A;  1EUB A;  1JAP A;  3TT4 A;  1D5J A;  3F19 A;  1EAK A;  1JIZ A;  2CKI A;  4CTH A;  2MZI A;  3G42 A;  1D7X A;  2N8R A;  1GO8 P;  4H1Q A;  2AIG P;  1J7N A;  3N2V A;  1G4K A;  1AKL A;  3RTT A;  4PKS A;  3KRY A;  3HBV P;  1CAQ A;  5B5P A;  3I7G A;  4PKR A;  4DPE A;  1WNI A;  1QIB A;  1XUC A;  3O2X A;  1HY7 A;  1OS9 A;  3LJG A;  1ZTQ A;  4H84 A;  1IAC A;  3LKA A;  1JAO A;  3EDH A;  3E8R A;  2RJP A;  3LJZ A;  2ERQ A;  1BKC E;  1PWU A;  1CGE A;  2JT6 A;  2OI0 A;  3F15 A;  2OZR A;  2WO8 A;  3LMC A;  2TCL A;  1YQY A;  3LIL A;  1YP1 A;  2W15 A;  3U1R A;  2A8H A;  5BPA A;  1L6J A;  1JIW P;  5D3C A;  1A85 A;  5D2B A;  2Z2D A;  3KEJ A;  2DDY A;  2K2G A;  3P1V A;  3CKI A;  2E3X A;  2MZE A;  1B3D A;  1A86 A;  3HY9 A;  1KAP P;  1FLS A;  1OMJ A;  4XM6 A;  2OVZ A;  3DWB A;  1Y0V A;  2X3A A;  2SRT A;  1QJJ A;  830C A;  4IUW A;  1AST A;  3B8Z A;  1GE6 A;  1XFX A;  2RJQ A;  2JSD A;  1MNC A;  1ZXV A;  5L7F A;  1Q3A A;  2YIG A;  3HYG A;  5B5O A;  3LQB A;  5JMY A;  1KUH A;  1ND1 A;  3ZVS A;  1XFV A;  4R3V A;  3ZXH A;  1KUG A;  4A3W A;  1I1I P;  3LUN A;  1BUV M;  1CK7 A;  1G05 A;  3GBO A;  3LQ0 A;  2DW2 A;  3LGP A;  3WV3 A;  3BA0 A;  1RM8 A;  4GQL A;  4AIG A;  4H3X A;  4AYK A;  1Y8J A;  1QUA A;  1IAG A;  3DPE A;  4GF1 A;  1KUF A;  2ERO A;  2HU6 A;  3LIK A;  1GKC A;  2OY4 A;  2W13 A;  2JIH A;  4XCT A;  4JQG A;  1XUR A;  1JKY A;  2PJT A;  5LAB A;  1OO9 A;  2DW1 A;  1ROS A;  3DSL A;  5D1U A;  3DNG A;  1B8Y A;  3UVC A;  5D1S A;  3F18 A;  4I35 A;  3P24 A;  5CZM A;  1K7Q A;  4WKI A;  4ZR5 A;  3B2Z A;  4PKU A;  1CIZ A;  3LUM A;  5BOT A;  2V4B A;  1PWV A;  2Y6C A;  2MLS A;  2OW1 A;  1C7K A;  1OM6 A;  1K7G A;  3OHO A;  2OW0 A;  5CUH A;  1OM8 A;  1KUI A;  3KEC A;  1UEA A;  3OHL A;  2K9C A;  4WZV A;  2YB9 A;  1EB6 A;  3K7L A;  1SAT A;  1XFZ A;  1BM6 A;  4GR3 A;  2OY2 A;  1UMS A;  3LK8 A;  1UTT A;  3SHI A;  2WOA A;  4GR0 A;  2W12 A;  1MMB A;  2E2D A;  3VI1 A;  1G9K A;  4G0D A;  4ILW D;  5CXA A;  3AIG A;  4H76 A;  2W0D A;  1IAB A;  3L0V A;  1YOU A; 
#chains in the Genus database with same CATH topology
 1XUD A;  1ZP5 A;  3LJT A;  3AYK A;  3I7I A;  4I03 A;  2D1N A;  3KWV C;  2XS4 A;  5BOY A;  3NX7 A;  2OW9 A;  2O36 A;  3LIR A;  4PKV A;  1BIW A;  4A7B A;  2AYK A;  4PKW A;  4XBH A;  4QKZ A;  1S4B P;  2KRJ A;  1UMT A;  4H2E A;  5I3M A;  1HTD A;  3Q2G A;  4DV8 A;  4EFS A;  1PWW A;  3V96 B;  4L6T A;  4L7A A;  1JH1 A;  3F16 A;  1CQR A;  1IAA A;  4H49 A;  3VTG A;  3ZUK A;  2QPJ A;  1CGL A;  4H30 A;  2X3B A;  1CGF A;  3EHX A;  4JIJ A;  2X3C A;  3L0T A;  1K7I A;  2OXU A;  1R55 A;  1Z3J A;  1BQQ M;  2W14 A;  3TVC A;  4GWN A;  1HFC A;  1QIA A;  4FXQ A;  1G12 A;  1BZS A;  1JJ9 A;  4Q1L A;  2D1O A;  1BQO A;  1GKD A;  2ERP A;  1JAN A;  4XM8 A;  1BUD A;  4HX3 A;  2CLT A;  2DW0 A;  2O3E A;  2J83 A;  2POJ A;  1HOV A;  1O0T A;  3TS4 A;  2FV5 A;  3DL1 A;  4DD8 A;  1MMQ A;  1SU3 A;  1ZXC A;  3WV1 A;  3F1A A;  1XFY A;  1Y93 A;  2MLR A;  4L19 A;  2OXZ A;  4PKT A;  1GXD A;  3HDB A;  4FU4 A;  1SRP A;  1BKC A;  2FV9 A;  4H82 A;  3K7N A;  4FVL A;  4AXQ A;  1XFU A;  2L0R A;  2OXW A;  1BSW A;  3EDG A;  3LEA A;  2USN A;  2JNP A;  1SMP A;  1DMT A;  1MMP A;  1G49 A;  4J4M A;  1KUK A;  1XAX A;  3N2U A;  4DF9 A;  1R54 A;  1PWQ A;  1R1J A;  1H71 P;  3WV2 A;  1IAE A;  3EDI A;  2X7M A;  4L63 A;  3O64 A;  1UTZ A;  2MZH A;  4GR8 A;  2WO9 A;  1JAQ A;  1GE5 A;  1AYK A;  2OVX A;  3USN A;  1GO7 P;  1FM1 A;  5I0L A;  3MA2 A;  1C3I A;  5I43 A;  4AUO A;  1BKC I;  1ZVX A;  3EWJ A;  2XS3 A;  3KHI A;  1YCM A;  4HMA A;  1ATL A;  1QIC A;  1SLM A;  3DTK A;  5D1T A;  4JP4 A;  1R1H A;  3HY7 A;  3LE9 A;  1ZS0 A;  1C8T A;  2J0T A;  3B92 A;  1KBC A;  4IN9 A;  1AF0 A;  2DDF A;  3EDZ A;  3AYU A;  5H8X A;  1IAD A;  5I12 A;  456C A;  1R1I A;  3TSK A;  4FXY P;  1FBL A;  1OM7 A;  966C A;  4XM7 A;  4WF6 A;  3KME A;  5I4O A;  2Y6D A;  5D7W A;  1OS2 A;  1D8M A;  4JA1 A;  4GWM A;  5L79 A;  1SLN A;  1MMR A;  4WKE A;  1CXV A;  1HV5 A;  2OW2 A;  2I47 A;  1QJI A;  3KEK A;  1USN A;  4IJO A;  3EHY A;  4PKQ A;  1XFW A;  4GUY A;  1GE7 A;  3Q2H A;  1PWP A;  1I73 A;  4JPA A;  1DTH A;  3RTS A;  3F17 A;  3DPF A;  3G5C A;  3HB2 P;  3HBU P;  5I2Z A;  3KMC A;  1O0Q A;  1JK3 A;  3HDA P;  4WK7 A;  3ELM A;  4G9L A;  1I76 A;  1RMZ A;  1D8F A;  1HFS A;  4ON1 A;  2JT5 A;  1EUB A;  1JAP A;  3TT4 A;  1D5J A;  3F19 A;  1EAK A;  1JIZ A;  2CKI A;  4CTH A;  2MZI A;  3G42 A;  1D7X A;  2N8R A;  1GO8 P;  4H1Q A;  2AIG P;  1J7N A;  3N2V A;  1G4K A;  1AKL A;  3RTT A;  4PKS A;  3KRY A;  3HBV P;  1CAQ A;  5B5P A;  3I7G A;  4PKR A;  4DPE A;  1WNI A;  1QIB A;  1XUC A;  3O2X A;  1HY7 A;  1TVI A;  1OS9 A;  3LJG A;  1ZTQ A;  4H84 A;  1IAC A;  3LKA A;  1JAO A;  3EDH A;  3E8R A;  2RJP A;  3LJZ A;  2ERQ A;  1BKC E;  1PWU A;  1CGE A;  2JT6 A;  2OI0 A;  3F15 A;  3DTI A;  2OZR A;  2WO8 A;  3LMC A;  2TCL A;  1YQY A;  3LIL A;  1YP1 A;  2W15 A;  3U1R A;  2A8H A;  5BPA A;  1L6J A;  1JIW P;  5D3C A;  1A85 A;  5D2B A;  2Z2D A;  3KEJ A;  2DDY A;  2K2G A;  3P1V A;  3CKI A;  2E3X A;  2MZE A;  1B3D A;  1A86 A;  3HY9 A;  1KAP P;  1FLS A;  1OMJ A;  4XM6 A;  2OVZ A;  3DWB A;  1Y0V A;  2X3A A;  2SRT A;  1QJJ A;  830C A;  4IUW A;  1AST A;  3B8Z A;  1GE6 A;  1XFX A;  2RJQ A;  2JSD A;  1MNC A;  1ZXV A;  5L7F A;  1Q3A A;  2YIG A;  3HYG A;  5B5O A;  3LQB A;  5JMY A;  1KUH A;  1ND1 A;  3ZVS A;  1XFV A;  4R3V A;  3ZXH A;  1KUG A;  4A3W A;  1I1I P;  3LUN A;  1BUV M;  1CK7 A;  1G05 A;  3GBO A;  3LQ0 A;  2DW2 A;  3LGP A;  3WV3 A;  3BA0 A;  1RM8 A;  4GQL A;  4AIG A;  4H3X A;  4AYK A;  1Y8J A;  1QUA A;  1IAG A;  3DPE A;  4GF1 A;  1KUF A;  2ERO A;  2HU6 A;  3LIK A;  1GKC A;  2OY4 A;  2W13 A;  2JIH A;  4XCT A;  4JQG A;  1XUR A;  1JKY A;  2PJT A;  5LAB A;  1OO9 A;  2DW1 A;  1ROS A;  3DSL A;  5D1U A;  3DNG A;  1B8Y A;  3UVC A;  5D1S A;  3F18 A;  4I35 A;  3P24 A;  5CZM A;  2YUF A;  1K7Q A;  4WKI A;  4ZR5 A;  3B2Z A;  3DTE A;  4PKU A;  1CIZ A;  3LUM A;  5BOT A;  2V4B A;  1PWV A;  2Y6C A;  2MLS A;  2OW1 A;  1C7K A;  1OM6 A;  1K7G A;  3OHO A;  2OW0 A;  5CUH A;  1OM8 A;  1KUI A;  3KEC A;  1UEA A;  3OHL A;  2K9C A;  4WZV A;  2YB9 A;  1EB6 A;  3K7L A;  1SAT A;  1XFZ A;  1BM6 A;  4GR3 A;  2OY2 A;  1UMS A;  3LK8 A;  1XM5 A;  1UTT A;  3SHI A;  2WOA A;  4GR0 A;  2W12 A;  1MMB A;  2E2D A;  3VI1 A;  1G9K A;  1OZ9 A;  4G0D A;  4ILW D;  5CXA A;  3AIG A;  4H76 A;  2W0D A;  1IAB A;  3L0V A;  1YOU A; 
#chains in the Genus database with same CATH homology
 1XUD A;  1ZP5 A;  3LJT A;  3AYK A;  3I7I A;  4I03 A;  2D1N A;  3KWV C;  2XS4 A;  5BOY A;  3NX7 A;  2OW9 A;  2O36 A;  3LIR A;  4PKV A;  1BIW A;  4A7B A;  2AYK A;  4PKW A;  4XBH A;  4QKZ A;  1S4B P;  2KRJ A;  1UMT A;  4H2E A;  5I3M A;  1HTD A;  3Q2G A;  4DV8 A;  4EFS A;  1PWW A;  3V96 B;  4L6T A;  4L7A A;  1JH1 A;  3F16 A;  1CQR A;  1IAA A;  4H49 A;  3VTG A;  3ZUK A;  2QPJ A;  1CGL A;  4H30 A;  2X3B A;  1CGF A;  3EHX A;  4JIJ A;  2X3C A;  3L0T A;  1K7I A;  2OXU A;  1R55 A;  1Z3J A;  1BQQ M;  2W14 A;  3TVC A;  4GWN A;  1HFC A;  1QIA A;  4FXQ A;  1G12 A;  1BZS A;  1JJ9 A;  4Q1L A;  2D1O A;  1BQO A;  1GKD A;  2ERP A;  1JAN A;  4XM8 A;  1BUD A;  4HX3 A;  2CLT A;  2DW0 A;  2O3E A;  2J83 A;  2POJ A;  1HOV A;  1O0T A;  3TS4 A;  2FV5 A;  3DL1 A;  4DD8 A;  1MMQ A;  1SU3 A;  1ZXC A;  3WV1 A;  3F1A A;  1XFY A;  1Y93 A;  2MLR A;  4L19 A;  2OXZ A;  4PKT A;  1GXD A;  3HDB A;  4FU4 A;  1SRP A;  1BKC A;  2FV9 A;  4H82 A;  3K7N A;  4FVL A;  4AXQ A;  1XFU A;  2L0R A;  2OXW A;  1BSW A;  3EDG A;  3LEA A;  2USN A;  2JNP A;  1SMP A;  1DMT A;  1MMP A;  1G49 A;  4J4M A;  1KUK A;  3N2U A;  4DF9 A;  1R54 A;  1PWQ A;  1R1J A;  1H71 P;  3WV2 A;  1IAE A;  3EDI A;  2X7M A;  4L63 A;  3O64 A;  1UTZ A;  2MZH A;  4GR8 A;  2WO9 A;  1JAQ A;  1GE5 A;  1AYK A;  2OVX A;  3USN A;  1GO7 P;  1FM1 A;  5I0L A;  3MA2 A;  1C3I A;  5I43 A;  4AUO A;  1BKC I;  1ZVX A;  3EWJ A;  2XS3 A;  3KHI A;  1YCM A;  4HMA A;  1ATL A;  1QIC A;  1SLM A;  3DTK A;  5D1T A;  4JP4 A;  1R1H A;  3HY7 A;  3LE9 A;  1ZS0 A;  1C8T A;  2J0T A;  3B92 A;  1KBC A;  4IN9 A;  1AF0 A;  2DDF A;  3EDZ A;  3AYU A;  5H8X A;  1IAD A;  5I12 A;  456C A;  1R1I A;  3TSK A;  4FXY P;  1FBL A;  1OM7 A;  966C A;  4XM7 A;  4WF6 A;  3KME A;  5I4O A;  2Y6D A;  5D7W A;  1OS2 A;  1D8M A;  4JA1 A;  4GWM A;  5L79 A;  1SLN A;  1MMR A;  4WKE A;  1CXV A;  1HV5 A;  2OW2 A;  2I47 A;  1QJI A;  3KEK A;  1USN A;  4IJO A;  3EHY A;  4PKQ A;  1XFW A;  4GUY A;  1GE7 A;  3Q2H A;  1PWP A;  1I73 A;  4JPA A;  1DTH A;  3RTS A;  3F17 A;  3DPF A;  3G5C A;  3HB2 P;  3HBU P;  5I2Z A;  3KMC A;  1O0Q A;  1JK3 A;  3HDA P;  4WK7 A;  3ELM A;  4G9L A;  1I76 A;  1RMZ A;  1D8F A;  1HFS A;  4ON1 A;  2JT5 A;  1EUB A;  1JAP A;  3TT4 A;  1D5J A;  3F19 A;  1EAK A;  1JIZ A;  2CKI A;  4CTH A;  2MZI A;  3G42 A;  1D7X A;  2N8R A;  1GO8 P;  4H1Q A;  2AIG P;  1J7N A;  3N2V A;  1G4K A;  1AKL A;  3RTT A;  4PKS A;  3KRY A;  3HBV P;  1CAQ A;  5B5P A;  3I7G A;  4PKR A;  4DPE A;  1WNI A;  1QIB A;  1XUC A;  3O2X A;  1HY7 A;  1OS9 A;  3LJG A;  1ZTQ A;  4H84 A;  1IAC A;  3LKA A;  1JAO A;  3EDH A;  3E8R A;  2RJP A;  3LJZ A;  2ERQ A;  1BKC E;  1PWU A;  1CGE A;  2JT6 A;  2OI0 A;  3F15 A;  3DTI A;  2OZR A;  2WO8 A;  3LMC A;  2TCL A;  1YQY A;  3LIL A;  1YP1 A;  2W15 A;  3U1R A;  2A8H A;  5BPA A;  1L6J A;  1JIW P;  5D3C A;  1A85 A;  5D2B A;  2Z2D A;  3KEJ A;  2DDY A;  2K2G A;  3P1V A;  3CKI A;  2E3X A;  2MZE A;  1B3D A;  1A86 A;  3HY9 A;  1KAP P;  1FLS A;  1OMJ A;  4XM6 A;  2OVZ A;  3DWB A;  1Y0V A;  2X3A A;  2SRT A;  1QJJ A;  830C A;  4IUW A;  1AST A;  3B8Z A;  1GE6 A;  1XFX A;  2RJQ A;  2JSD A;  1MNC A;  1ZXV A;  5L7F A;  1Q3A A;  2YIG A;  3HYG A;  5B5O A;  3LQB A;  5JMY A;  1KUH A;  1ND1 A;  3ZVS A;  1XFV A;  4R3V A;  3ZXH A;  1KUG A;  4A3W A;  1I1I P;  3LUN A;  1BUV M;  1CK7 A;  1G05 A;  3GBO A;  3LQ0 A;  2DW2 A;  3LGP A;  3WV3 A;  3BA0 A;  1RM8 A;  4GQL A;  4AIG A;  4H3X A;  4AYK A;  1Y8J A;  1QUA A;  1IAG A;  3DPE A;  4GF1 A;  1KUF A;  2ERO A;  2HU6 A;  3LIK A;  1GKC A;  2OY4 A;  2W13 A;  2JIH A;  4XCT A;  4JQG A;  1XUR A;  1JKY A;  2PJT A;  5LAB A;  1OO9 A;  2DW1 A;  1ROS A;  3DSL A;  5D1U A;  3DNG A;  1B8Y A;  3UVC A;  5D1S A;  3F18 A;  4I35 A;  3P24 A;  5CZM A;  2YUF A;  1K7Q A;  4WKI A;  4ZR5 A;  3B2Z A;  3DTE A;  4PKU A;  1CIZ A;  3LUM A;  5BOT A;  2V4B A;  1PWV A;  2Y6C A;  2MLS A;  2OW1 A;  1C7K A;  1OM6 A;  1K7G A;  3OHO A;  2OW0 A;  5CUH A;  1OM8 A;  1KUI A;  3KEC A;  1UEA A;  3OHL A;  2K9C A;  4WZV A;  2YB9 A;  1EB6 A;  3K7L A;  1SAT A;  1XFZ A;  1BM6 A;  4GR3 A;  2OY2 A;  1UMS A;  3LK8 A;  1UTT A;  3SHI A;  2WOA A;  4GR0 A;  2W12 A;  1MMB A;  2E2D A;  3VI1 A;  1G9K A;  4G0D A;  4ILW D;  5CXA A;  3AIG A;  4H76 A;  2W0D A;  1IAB A;  3L0V A;  1YOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...