4AYKA

Catalytic fragment of human fibroblast collagenase complexed with cgs-27023a, nmr, 30 structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
169
structure length
169
Chain Sequence
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COLLAGENASE)
publication title NMR solution structure of the catalytic fragment of human fibroblast collagenase complexed with a sulfonamide derivative of a hydroxamic acid compound.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Matrix metalloproteinase
total genus 27
structure length 169
sequence length 169
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 1999-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4aykA00
1ZVXA 1FM1A 3G5CA 2Z2DA 2ERQA 2PJTA 3F15A 3LQ0A 3HYGA 1R1IA 1SLNA 4PKQA 2TCLA 3AIGA 1JK3A 4JPAA 3SHIA 4FVLA 4XM6A 2WO9A 3KECA 3I7IA 1OM7A 5L7FA 2DDYA 2KRJA 3TSKA 3WV3A 4L63A 4WK7A 1IACA 2A8HA 1EUBA 456CA 5B5OA 5D1SA 4JP4A 1XFUA 5CUHA 2Y6DA 1UTTA 1XFZA 2YIGA 4Q1LA 5D2BA 1B8YA 3DWBA 1IABA 1R1HA 1HV5A 2OI0A 2OY4A 1CQRA 3Q2HA 3DPFA 3WV1A 1HY7A 2OVXA 1D7XA 2OXUA 3TT4A 3LUNA 2SRTA 1ZP5A 966CA 2JSDA 1EAKA 3LE9A 3LMCA 4GWNA 1SLMA 1CK7A 2FV9A 4GWMA 4JA1A 2MLRA 2OW2A 4H30A 4WKIA 1I76A 1BUVM 1CGFA 3HDBA 1CAQA 3OHLA 3RTSA 1AF0A 4L6TA 3HY7A 1Y0VA 1ZXCA 2QPJA 1MMPA 4AUOA 5I4OA 1GE7A 2X3BA 3TVCA 2DW1A 1GE5A 3G42A 5I2ZA 3EDIA 4WZVA 2DW2A 4XM7A 3L0VA 1R1JA 3VI1A 2OW9A 3HBUP 4GR0A 1K7QA 4AIGA 1XFYA 1GKCA 4HMAA 5H8XA 3F18A 4AYKA 3KMEA 1Y93A 2USNA 4PKWA 1CGEA 4IUWA 1XUDA 2AYKA 2W15A 3P1VA 3TS4A 1A85A 3EDHA 1MMQA 3KHIA 3KEKA 3EHXA 4PKUA 4I03A 2MZIA 1D8FA 1GE6A 3OHOA 4WKEA 2W0DA 2DDFA 2MZEA 1C3IA 2N8RA 2L0RA 2JIHA 3F17A 3LJTA 2YB9A 2Y6CA 2W12A 1MMBA 3LIKA 1ZS0A 3K7NA 5LABA 4IJOA 1GO8P 1D5JA 1PWVA 3LQBA 1H71P 1WNIA 2POJA 5I12A 4G9LA 2X3AA 1BKCA 3CKIA 1BM6A 1KAPP 3N2UA 4DD8A 4DF9A 1HTDA 1PWQA 1ATLA 2CLTA 3DPEA 1BQQM 3LUMA 4ILWD 1QJJA 2JT5A 5D1TA 1OM8A 3F19A 4ZR5A 1EB6A 3Q2GA 1UMTA 5D3CA 2OVZA 4HX3A 3AYUA 1BKCI 3F16A 2WO8A 4GR3A 1G4KA 1DTHA 2X7MA 3HDAP 1PWPA 3P24A 3HBVP 1BIWA 1BUDA 1SRPA 1XURA 4A7BA 2OY2A 1KBCA 2K2GA 1IAEA 2RJQA 1BZSA 2OXWA 3HY9A 1B3DA 4H84A 2O3EA 2DW0A 4J4MA 4XM8A 2OW0A 4DV8A 2MLSA 1FLSA 2ERPA 3O64A 1C8TA 1Y8JA 2W14A 3ZVSA 3BA0A 1R55A 1GKDA 3ZUKA 1MNCA 1SMPA 1C7KA 5L79A 1ROSA 2RJPA 1HFSA 1MMRA 1G12A 1OM6A 2E3XA 3UVCA 4DPEA 2CKIA 1PWWA 1IAGA 1XUCA 3LJZA 3MA2A 1K7GA 3EDGA 4JQGA 1XFVA 1KUKA 3N2VA 4H1QA 1SU3A 1AKLA 1YQYA 2AIGP 1OO9A 2XS4A 5BOYA 1JAPA 5BOTA 3E8RA 1D8MA 3KMCA 2EROA 1JANA 1JIZA 1RM8A 4PKVA 1QIAA 1QUAA 5BPAA 1OS9A 1K7IA 4GQLA 1UMSA 1UTZA 3U1RA 3AYKA 3I7GA 3KRYA 2K9CA 3VTGA 1I73A 1YCMA 3O2XA 4FXQA 4L19A 4R3VA 4XBHA 4PKSA 5I3MA 1A86A 1HOVA 3DSLA 4H3XA 2FV5A 3USNA 1O0QA 1ASTA 1OS2A 1I1IP 2W13A 1KUHA 4IN9A 4H2EA 3L0TA 3LKAA 5D1UA 1KUFA 1ZXVA 4EFSA 3K7LA 3LIRA 830CA 1YP1A 3RTTA 3KEJA 3B8ZA 2OZRA 3ELMA 3LGPA 3NX7A 1DMTA 1KUIA 1JJ9A 3DNGA 3KWVC 1ZTQA 4ON1A 1BSWA 1JAOA 1QJIA 1CGLA 2E2DA 5I0LA 1J7NA 1HFCA 1SATA 2D1OA 1AYKA 1GO7P 1Q3AA 4PKRA 1XFWA 3ZXHA 3B2ZA 1YOUA 4GR8A 2J83A 1XFXA 2O36A 2D1NA 2J0TA 1GXDA 1BKCE 4XCTA 3GBOA 2JNPA 4I35A 1PWUA 5CXAA 5JMYA 2HU6A 4GF1A 2MZHA 4WF6A 2JT6A 3HB2P 1KUGA 1JKYA 1BQOA 4AXQA 1JAQA 2OW1A 3WV2A 3EWJA 1QIBA 4CTHA 3V96B 3F1AA 4G0DA 2XS3A 1S4BP 3DL1A 3LILA 1Z3JA 4H49A 1UEAA 4H82A 1IAAA 1CXVA 1JH1A 3B92A 1JIWP 3EDZA 1QICA 1R54A 5D7WA 5CZMA 3LJGA 1G9KA 4FU4A 1L6JA 2WOAA 1FBLA 1IADA 4QKZA 4JIJA 5B5PA 2OXZA 1CIZA 1G49A 2V4BA 4FXYP 1OMJA 4H76A 2I47A 3EHYA 1O0TA 1RMZA 2X3CA 3LK8A 1ND1A 5I43A 3LEAA 4GUYA 4A3WA 4PKTA 1G05A 1USNA
chains in the Genus database with same CATH superfamily
1ZVXA 1FM1A 3G5CA 2Z2DA 2ERQA 2PJTA 3F15A 3LQ0A 3HYGA 1R1IA 1SLNA 4PKQA 2TCLA 3AIGA 1JK3A 4JPAA 3SHIA 4FVLA 4XM6A 2WO9A 3KECA 3I7IA 1OM7A 5L7FA 2DDYA 2KRJA 3TSKA 3WV3A 4L63A 4WK7A 1IACA 2A8HA 1EUBA 456CA 5B5OA 5D1SA 4JP4A 1XFUA 5CUHA 2Y6DA 1UTTA 1XFZA 2YIGA 4Q1LA 5D2BA 1B8YA 3DWBA 1IABA 1R1HA 1HV5A 2OI0A 2OY4A 1CQRA 3Q2HA 3DPFA 3WV1A 1HY7A 2OVXA 1D7XA 2OXUA 3TT4A 3LUNA 2SRTA 1ZP5A 966CA 2JSDA 1EAKA 3LE9A 3LMCA 4GWNA 1SLMA 1CK7A 2FV9A 4GWMA 4JA1A 2MLRA 2OW2A 4H30A 4WKIA 1I76A 1BUVM 1CGFA 3HDBA 1CAQA 3OHLA 3RTSA 1AF0A 4L6TA 3HY7A 1Y0VA 1ZXCA 2QPJA 1MMPA 4AUOA 5I4OA 1GE7A 2X3BA 3TVCA 2DW1A 1GE5A 3G42A 5I2ZA 3EDIA 4WZVA 2DW2A 4XM7A 3L0VA 1R1JA 3VI1A 2OW9A 3HBUP 4GR0A 1K7QA 4AIGA 1XFYA 1GKCA 4HMAA 5H8XA 3F18A 3DTIA 4AYKA 3KMEA 1Y93A 2USNA 4PKWA 1CGEA 4IUWA 1XUDA 2AYKA 2W15A 3P1VA 3TS4A 1A85A 3EDHA 1MMQA 3KHIA 3KEKA 3EHXA 4PKUA 4I03A 2MZIA 1D8FA 1GE6A 3OHOA 4WKEA 2W0DA 2DDFA 2MZEA 1C3IA 2N8RA 2L0RA 2JIHA 3F17A 3LJTA 2YB9A 2Y6CA 2W12A 1MMBA 3LIKA 1ZS0A 3K7NA 5LABA 4IJOA 1GO8P 1D5JA 1PWVA 3LQBA 1H71P 1WNIA 2POJA 5I12A 4G9LA 1XAXA 2X3AA 1BKCA 3CKIA 1BM6A 1KAPP 3N2UA 4DD8A 4DF9A 1HTDA 1PWQA 1ATLA 2CLTA 3DPEA 4L7AA 1TVIA 1BQQM 3LUMA 4ILWD 1QJJA 2JT5A 5D1TA 1OM8A 3F19A 4ZR5A 1EB6A 3Q2GA 1UMTA 5D3CA 2OVZA 4HX3A 3AYUA 1BKCI 3F16A 2WO8A 4GR3A 1G4KA 1DTHA 2X7MA 3HDAP 1PWPA 3P24A 3HBVP 1BIWA 1BUDA 1SRPA 1XURA 4A7BA 2OY2A 1KBCA 2K2GA 1IAEA 2RJQA 1BZSA 2OXWA 3HY9A 1B3DA 4H84A 2O3EA 2DW0A 4J4MA 4XM8A 2OW0A 4DV8A 2MLSA 1FLSA 2ERPA 3O64A 1C8TA 1Y8JA 2W14A 3ZVSA 3BA0A 1R55A 1GKDA 3ZUKA 1MNCA 1SMPA 1C7KA 5L79A 1ROSA 2RJPA 3DTKA 1HFSA 1MMRA 1G12A 1OM6A 2E3XA 3UVCA 4DPEA 2CKIA 1PWWA 1IAGA 1XUCA 3DTEA 3LJZA 1K7GA 3MA2A 3EDGA 4JQGA 1XFVA 1KUKA 3N2VA 4H1QA 1SU3A 1AKLA 1YQYA 2AIGP 1OO9A 2XS4A 5BOYA 2YUFA 1JAPA 5BOTA 3E8RA 1D8MA 3KMCA 2EROA 1JANA 1JIZA 1RM8A 4PKVA 1QIAA 1QUAA 5BPAA 1OS9A 1K7IA 4GQLA 1UMSA 1UTZA 3U1RA 3AYKA 3I7GA 3KRYA 2K9CA 3VTGA 1I73A 1YCMA 3O2XA 4FXQA 4L19A 4R3VA 4XBHA 4PKSA 5I3MA 1A86A 1HOVA 3DSLA 4H3XA 2FV5A 3USNA 1O0QA 1ASTA 1OS2A 1I1IP 2W13A 1KUHA 4IN9A 4H2EA 3L0TA 3LKAA 5D1UA 1KUFA 1ZXVA 4EFSA 3K7LA 3LIRA 830CA 1OZ9A 1YP1A 3RTTA 3KEJA 3B8ZA 2OZRA 3ELMA 3LGPA 3NX7A 1DMTA 1KUIA 1JJ9A 3DNGA 3KWVC 1ZTQA 4ON1A 1BSWA 1JAOA 1QJIA 1CGLA 2E2DA 5I0LA 1J7NA 1HFCA 1SATA 2D1OA 1AYKA 1GO7P 1Q3AA 4PKRA 1XFWA 3ZXHA 3B2ZA 1YOUA 4GR8A 2J83A 1XFXA 2O36A 2D1NA 2J0TA 1GXDA 1BKCE 4XCTA 3GBOA 2JNPA 4I35A 1PWUA 5CXAA 5JMYA 2HU6A 4GF1A 2MZHA 4WF6A 2JT6A 3HB2P 1KUGA 1JKYA 1BQOA 4AXQA 1JAQA 2OW1A 3WV2A 3EWJA 1QIBA 4CTHA 3V96B 3F1AA 4G0DA 2XS3A 1S4BP 3DL1A 3LILA 1Z3JA 4H49A 1UEAA 4H82A 1IAAA 1CXVA 1JH1A 3B92A 1XM5A 1JIWP 3EDZA 1QICA 1R54A 5D7WA 5CZMA 3LJGA 1G9KA 4FU4A 1L6JA 2WOAA 1FBLA 1IADA 4QKZA 4JIJA 5B5PA 2OXZA 1CIZA 1G49A 2V4BA 4FXYP 1OMJA 4H76A 2I47A 3EHYA 1O0TA 1RMZA 2X3CA 3LK8A 1ND1A 5I43A 3LEAA 4GUYA 4A3WA 4PKTA 1G05A 1USNA
chains in the Genus database with same CATH topology
1ZVXA 1FM1A 3G5CA 2Z2DA 2ERQA 2PJTA 3F15A 3LQ0A 3HYGA 1R1IA 1SLNA 4PKQA 2TCLA 3AIGA 1JK3A 4JPAA 3SHIA 4FVLA 4XM6A 2WO9A 3KECA 3I7IA 1OM7A 5L7FA 2DDYA 2KRJA 3TSKA 3WV3A 4L63A 4WK7A 1IACA 2A8HA 1EUBA 456CA 5B5OA 5D1SA 4JP4A 1XFUA 5CUHA 2Y6DA 1UTTA 1XFZA 2YIGA 4Q1LA 5D2BA 1B8YA 3DWBA 1IABA 1R1HA 1HV5A 2OI0A 2OY4A 1CQRA 3Q2HA 3DPFA 3WV1A 1HY7A 2OVXA 1D7XA 2OXUA 3TT4A 3LUNA 2SRTA 1ZP5A 966CA 2JSDA 1EAKA 3LE9A 3LMCA 4GWNA 1SLMA 1CK7A 2FV9A 4GWMA 4JA1A 2MLRA 2OW2A 4H30A 4WKIA 1I76A 1BUVM 1CGFA 3HDBA 1CAQA 3OHLA 3RTSA 1AF0A 4L6TA 3HY7A 1Y0VA 1ZXCA 2QPJA 1MMPA 4AUOA 5I4OA 1GE7A 2X3BA 3TVCA 2DW1A 1GE5A 3G42A 5I2ZA 3EDIA 4WZVA 2DW2A 4XM7A 3L0VA 1R1JA 3VI1A 2OW9A 3HBUP 4GR0A 1K7QA 4AIGA 1XFYA 1GKCA 4HMAA 5H8XA 3F18A 3DTIA 4AYKA 3KMEA 1Y93A 2USNA 4PKWA 1CGEA 4IUWA 1XUDA 2AYKA 2W15A 3P1VA 3TS4A 1A85A 3EDHA 1MMQA 3KHIA 3KEKA 3EHXA 4PKUA 4I03A 2MZIA 1D8FA 1GE6A 3OHOA 4WKEA 2W0DA 2DDFA 2MZEA 1C3IA 2N8RA 2L0RA 2JIHA 3F17A 3LJTA 2YB9A 2Y6CA 2W12A 1MMBA 3LIKA 1ZS0A 3K7NA 5LABA 4IJOA 1GO8P 1D5JA 1PWVA 3LQBA 1H71P 1WNIA 2POJA 5I12A 4G9LA 2X3AA 1BKCA 3CKIA 1BM6A 1KAPP 3N2UA 4DD8A 4DF9A 1HTDA 1PWQA 1ATLA 2CLTA 3DPEA 4L7AA 1BQQM 3LUMA 4ILWD 1QJJA 2JT5A 5D1TA 1OM8A 3F19A 4ZR5A 1EB6A 3Q2GA 1UMTA 5D3CA 2OVZA 4HX3A 3AYUA 1BKCI 3F16A 2WO8A 4GR3A 1G4KA 1DTHA 2X7MA 3HDAP 1PWPA 3P24A 3HBVP 1BIWA 1BUDA 1SRPA 1XURA 4A7BA 2OY2A 1KBCA 2K2GA 1IAEA 2RJQA 1BZSA 2OXWA 3HY9A 1B3DA 4H84A 2O3EA 2DW0A 4J4MA 4XM8A 2OW0A 4DV8A 2MLSA 1FLSA 2ERPA 3O64A 1C8TA 1Y8JA 2W14A 3ZVSA 3BA0A 1R55A 1GKDA 3ZUKA 1MNCA 1SMPA 1C7KA 5L79A 1ROSA 2RJPA 3DTKA 1HFSA 1MMRA 1G12A 1OM6A 2E3XA 3UVCA 4DPEA 2CKIA 1PWWA 1IAGA 1XUCA 3DTEA 3LJZA 1K7GA 3MA2A 3EDGA 4JQGA 1XFVA 1KUKA 3N2VA 4H1QA 1SU3A 1AKLA 1YQYA 2AIGP 1OO9A 2XS4A 5BOYA 2YUFA 1JAPA 5BOTA 3E8RA 1D8MA 3KMCA 2EROA 1JANA 1JIZA 1RM8A 4PKVA 1QIAA 1QUAA 5BPAA 1OS9A 1K7IA 4GQLA 1UMSA 1UTZA 3U1RA 3AYKA 3I7GA 3KRYA 2K9CA 3VTGA 1I73A 1YCMA 3O2XA 4FXQA 4L19A 4R3VA 4XBHA 4PKSA 5I3MA 1A86A 1HOVA 3DSLA 4H3XA 2FV5A 3USNA 1O0QA 1ASTA 1OS2A 1I1IP 2W13A 1KUHA 4IN9A 4H2EA 3L0TA 3LKAA 5D1UA 1KUFA 1ZXVA 4EFSA 3K7LA 3LIRA 830CA 1YP1A 3RTTA 3KEJA 3B8ZA 2OZRA 3ELMA 3LGPA 3NX7A 1DMTA 1KUIA 1JJ9A 3DNGA 3KWVC 1ZTQA 4ON1A 1BSWA 1JAOA 1QJIA 1CGLA 2E2DA 5I0LA 1J7NA 1HFCA 1SATA 2D1OA 1AYKA 1GO7P 1Q3AA 4PKRA 1XFWA 3ZXHA 3B2ZA 1YOUA 4GR8A 2J83A 1XFXA 2O36A 2D1NA 2J0TA 1GXDA 1BKCE 4XCTA 3GBOA 2JNPA 4I35A 1PWUA 5CXAA 5JMYA 2HU6A 4GF1A 2MZHA 4WF6A 2JT6A 3HB2P 1KUGA 1JKYA 1BQOA 4AXQA 1JAQA 2OW1A 3WV2A 3EWJA 1QIBA 4CTHA 3V96B 3F1AA 4G0DA 2XS3A 1S4BP 3DL1A 3LILA 1Z3JA 4H49A 1UEAA 4H82A 1IAAA 1CXVA 1JH1A 3B92A 1JIWP 3EDZA 1QICA 1R54A 5D7WA 5CZMA 3LJGA 1G9KA 4FU4A 1L6JA 2WOAA 1FBLA 1IADA 4QKZA 4JIJA 5B5PA 2OXZA 1CIZA 1G49A 2V4BA 4FXYP 1OMJA 4H76A 2I47A 3EHYA 1O0TA 1RMZA 2X3CA 3LK8A 1ND1A 5I43A 3LEAA 4GUYA 4A3WA 4PKTA 1G05A 1USNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVX A;  1FM1 A;  3G5C A;  2Z2D A;  2ERQ A;  2PJT A;  3F15 A;  3LQ0 A;  3HYG A;  1R1I A;  1SLN A;  4PKQ A;  2TCL A;  3AIG A;  1JK3 A;  4JPA A;  3SHI A;  4FVL A;  4XM6 A;  2WO9 A;  3KEC A;  3I7I A;  1OM7 A;  5L7F A;  2DDY A;  2KRJ A;  3TSK A;  3WV3 A;  4L63 A;  4WK7 A;  1IAC A;  2A8H A;  1EUB A;  456C A;  5B5O A;  5D1S A;  4JP4 A;  1XFU A;  5CUH A;  2Y6D A;  1UTT A;  1XFZ A;  2YIG A;  4Q1L A;  5D2B A;  1B8Y A;  3DWB A;  1IAB A;  1R1H A;  1HV5 A;  2OI0 A;  2OY4 A;  1CQR A;  3Q2H A;  3DPF A;  3WV1 A;  1HY7 A;  2OVX A;  1D7X A;  2OXU A;  3TT4 A;  3LUN A;  2SRT A;  1ZP5 A;  966C A;  2JSD A;  1EAK A;  3LE9 A;  3LMC A;  4GWN A;  1SLM A;  1CK7 A;  2FV9 A;  4GWM A;  4JA1 A;  2MLR A;  2OW2 A;  4H30 A;  4WKI A;  1I76 A;  1BUV M;  1CGF A;  3HDB A;  1CAQ A;  3OHL A;  3RTS A;  1AF0 A;  4L6T A;  3HY7 A;  1Y0V A;  1ZXC A;  2QPJ A;  1MMP A;  4AUO A;  5I4O A;  1GE7 A;  2X3B A;  3TVC A;  2DW1 A;  1GE5 A;  3G42 A;  5I2Z A;  3EDI A;  4WZV A;  2DW2 A;  4XM7 A;  3L0V A;  1R1J A;  3VI1 A;  2OW9 A;  3HBU P;  4GR0 A;  1K7Q A;  4AIG A;  1XFY A;  1GKC A;  4HMA A;  5H8X A;  3F18 A;  4AYK A;  3KME A;  1Y93 A;  2USN A;  4PKW A;  1CGE A;  4IUW A;  1XUD A;  2AYK A;  2W15 A;  3P1V A;  3TS4 A;  1A85 A;  3EDH A;  1MMQ A;  3KHI A;  3KEK A;  3EHX A;  4PKU A;  4I03 A;  2MZI A;  1D8F A;  1GE6 A;  3OHO A;  4WKE A;  2W0D A;  2DDF A;  2MZE A;  1C3I A;  2N8R A;  2L0R A;  2JIH A;  3F17 A;  3LJT A;  2YB9 A;  2Y6C A;  2W12 A;  1MMB A;  3LIK A;  1ZS0 A;  3K7N A;  5LAB A;  4IJO A;  1GO8 P;  1D5J A;  1PWV A;  3LQB A;  1H71 P;  1WNI A;  2POJ A;  5I12 A;  4G9L A;  2X3A A;  1BKC A;  3CKI A;  1BM6 A;  1KAP P;  3N2U A;  4DD8 A;  4DF9 A;  1HTD A;  1PWQ A;  1ATL A;  2CLT A;  3DPE A;  1BQQ M;  3LUM A;  4ILW D;  1QJJ A;  2JT5 A;  5D1T A;  1OM8 A;  3F19 A;  4ZR5 A;  1EB6 A;  3Q2G A;  1UMT A;  5D3C A;  2OVZ A;  4HX3 A;  3AYU A;  1BKC I;  3F16 A;  2WO8 A;  4GR3 A;  1G4K A;  1DTH A;  2X7M A;  3HDA P;  1PWP A;  3P24 A;  3HBV P;  1BIW A;  1BUD A;  1SRP A;  1XUR A;  4A7B A;  2OY2 A;  1KBC A;  2K2G A;  1IAE A;  2RJQ A;  1BZS A;  2OXW A;  3HY9 A;  1B3D A;  4H84 A;  2O3E A;  2DW0 A;  4J4M A;  4XM8 A;  2OW0 A;  4DV8 A;  2MLS A;  1FLS A;  2ERP A;  3O64 A;  1C8T A;  1Y8J A;  2W14 A;  3ZVS A;  3BA0 A;  1R55 A;  1GKD A;  3ZUK A;  1MNC A;  1SMP A;  1C7K A;  5L79 A;  1ROS A;  2RJP A;  1HFS A;  1MMR A;  1G12 A;  1OM6 A;  2E3X A;  3UVC A;  4DPE A;  2CKI A;  1PWW A;  1IAG A;  1XUC A;  3LJZ A;  3MA2 A;  1K7G A;  3EDG A;  4JQG A;  1XFV A;  1KUK A;  3N2V A;  4H1Q A;  1SU3 A;  1AKL A;  1YQY A;  2AIG P;  1OO9 A;  2XS4 A;  5BOY A;  1JAP A;  5BOT A;  3E8R A;  1D8M A;  3KMC A;  2ERO A;  1JAN A;  1JIZ A;  1RM8 A;  4PKV A;  1QIA A;  1QUA A;  5BPA A;  1OS9 A;  1K7I A;  4GQL A;  1UMS A;  1UTZ A;  3U1R A;  3AYK A;  3I7G A;  3KRY A;  2K9C A;  3VTG A;  1I73 A;  1YCM A;  3O2X A;  4FXQ A;  4L19 A;  4R3V A;  4XBH A;  4PKS A;  5I3M A;  1A86 A;  1HOV A;  3DSL A;  4H3X A;  2FV5 A;  3USN A;  1O0Q A;  1AST A;  1OS2 A;  1I1I P;  2W13 A;  1KUH A;  4IN9 A;  4H2E A;  3L0T A;  3LKA A;  5D1U A;  1KUF A;  1ZXV A;  4EFS A;  3K7L A;  3LIR A;  830C A;  1YP1 A;  3RTT A;  3KEJ A;  3B8Z A;  2OZR A;  3ELM A;  3LGP A;  3NX7 A;  1DMT A;  1KUI A;  1JJ9 A;  3DNG A;  3KWV C;  1ZTQ A;  4ON1 A;  1BSW A;  1JAO A;  1QJI A;  1CGL A;  2E2D A;  5I0L A;  1J7N A;  1HFC A;  1SAT A;  2D1O A;  1AYK A;  1GO7 P;  1Q3A A;  4PKR A;  1XFW A;  3ZXH A;  3B2Z A;  1YOU A;  4GR8 A;  2J83 A;  1XFX A;  2O36 A;  2D1N A;  2J0T A;  1GXD A;  1BKC E;  4XCT A;  3GBO A;  2JNP A;  4I35 A;  1PWU A;  5CXA A;  5JMY A;  2HU6 A;  4GF1 A;  2MZH A;  4WF6 A;  2JT6 A;  3HB2 P;  1KUG A;  1JKY A;  1BQO A;  4AXQ A;  1JAQ A;  2OW1 A;  3WV2 A;  3EWJ A;  1QIB A;  4CTH A;  3V96 B;  3F1A A;  4G0D A;  2XS3 A;  1S4B P;  3DL1 A;  3LIL A;  1Z3J A;  4H49 A;  1UEA A;  4H82 A;  1IAA A;  1CXV A;  1JH1 A;  3B92 A;  1JIW P;  3EDZ A;  1QIC A;  1R54 A;  5D7W A;  5CZM A;  3LJG A;  1G9K A;  4FU4 A;  1L6J A;  2WOA A;  1FBL A;  1IAD A;  4QKZ A;  4JIJ A;  5B5P A;  2OXZ A;  1CIZ A;  1G49 A;  2V4B A;  4FXY P;  1OMJ A;  4H76 A;  2I47 A;  3EHY A;  1O0T A;  1RMZ A;  2X3C A;  3LK8 A;  1ND1 A;  5I43 A;  3LEA A;  4GUY A;  4A3W A;  4PKT A;  1G05 A;  1USN A; 
#chains in the Genus database with same CATH topology
 1ZVX A;  1FM1 A;  3G5C A;  2Z2D A;  2ERQ A;  2PJT A;  3F15 A;  3LQ0 A;  3HYG A;  1R1I A;  1SLN A;  4PKQ A;  2TCL A;  3AIG A;  1JK3 A;  4JPA A;  3SHI A;  4FVL A;  4XM6 A;  2WO9 A;  3KEC A;  3I7I A;  1OM7 A;  5L7F A;  2DDY A;  2KRJ A;  3TSK A;  3WV3 A;  4L63 A;  4WK7 A;  1IAC A;  2A8H A;  1EUB A;  456C A;  5B5O A;  5D1S A;  4JP4 A;  1XFU A;  5CUH A;  2Y6D A;  1UTT A;  1XFZ A;  2YIG A;  4Q1L A;  5D2B A;  1B8Y A;  3DWB A;  1IAB A;  1R1H A;  1HV5 A;  2OI0 A;  2OY4 A;  1CQR A;  3Q2H A;  3DPF A;  3WV1 A;  1HY7 A;  2OVX A;  1D7X A;  2OXU A;  3TT4 A;  3LUN A;  2SRT A;  1ZP5 A;  966C A;  2JSD A;  1EAK A;  3LE9 A;  3LMC A;  4GWN A;  1SLM A;  1CK7 A;  2FV9 A;  4GWM A;  4JA1 A;  2MLR A;  2OW2 A;  4H30 A;  4WKI A;  1I76 A;  1BUV M;  1CGF A;  3HDB A;  1CAQ A;  3OHL A;  3RTS A;  1AF0 A;  4L6T A;  3HY7 A;  1Y0V A;  1ZXC A;  2QPJ A;  1MMP A;  4AUO A;  5I4O A;  1GE7 A;  2X3B A;  3TVC A;  2DW1 A;  1GE5 A;  3G42 A;  5I2Z A;  3EDI A;  4WZV A;  2DW2 A;  4XM7 A;  3L0V A;  1R1J A;  3VI1 A;  2OW9 A;  3HBU P;  4GR0 A;  1K7Q A;  4AIG A;  1XFY A;  1GKC A;  4HMA A;  5H8X A;  3F18 A;  3DTI A;  4AYK A;  3KME A;  1Y93 A;  2USN A;  4PKW A;  1CGE A;  4IUW A;  1XUD A;  2AYK A;  2W15 A;  3P1V A;  3TS4 A;  1A85 A;  3EDH A;  1MMQ A;  3KHI A;  3KEK A;  3EHX A;  4PKU A;  4I03 A;  2MZI A;  1D8F A;  1GE6 A;  3OHO A;  4WKE A;  2W0D A;  2DDF A;  2MZE A;  1C3I A;  2N8R A;  2L0R A;  2JIH A;  3F17 A;  3LJT A;  2YB9 A;  2Y6C A;  2W12 A;  1MMB A;  3LIK A;  1ZS0 A;  3K7N A;  5LAB A;  4IJO A;  1GO8 P;  1D5J A;  1PWV A;  3LQB A;  1H71 P;  1WNI A;  2POJ A;  5I12 A;  4G9L A;  1XAX A;  2X3A A;  1BKC A;  3CKI A;  1BM6 A;  1KAP P;  3N2U A;  4DD8 A;  4DF9 A;  1HTD A;  1PWQ A;  1ATL A;  2CLT A;  3DPE A;  4L7A A;  1TVI A;  1BQQ M;  3LUM A;  4ILW D;  1QJJ A;  2JT5 A;  5D1T A;  1OM8 A;  3F19 A;  4ZR5 A;  1EB6 A;  3Q2G A;  1UMT A;  5D3C A;  2OVZ A;  4HX3 A;  3AYU A;  1BKC I;  3F16 A;  2WO8 A;  4GR3 A;  1G4K A;  1DTH A;  2X7M A;  3HDA P;  1PWP A;  3P24 A;  3HBV P;  1BIW A;  1BUD A;  1SRP A;  1XUR A;  4A7B A;  2OY2 A;  1KBC A;  2K2G A;  1IAE A;  2RJQ A;  1BZS A;  2OXW A;  3HY9 A;  1B3D A;  4H84 A;  2O3E A;  2DW0 A;  4J4M A;  4XM8 A;  2OW0 A;  4DV8 A;  2MLS A;  1FLS A;  2ERP A;  3O64 A;  1C8T A;  1Y8J A;  2W14 A;  3ZVS A;  3BA0 A;  1R55 A;  1GKD A;  3ZUK A;  1MNC A;  1SMP A;  1C7K A;  5L79 A;  1ROS A;  2RJP A;  3DTK A;  1HFS A;  1MMR A;  1G12 A;  1OM6 A;  2E3X A;  3UVC A;  4DPE A;  2CKI A;  1PWW A;  1IAG A;  1XUC A;  3DTE A;  3LJZ A;  1K7G A;  3MA2 A;  3EDG A;  4JQG A;  1XFV A;  1KUK A;  3N2V A;  4H1Q A;  1SU3 A;  1AKL A;  1YQY A;  2AIG P;  1OO9 A;  2XS4 A;  5BOY A;  2YUF A;  1JAP A;  5BOT A;  3E8R A;  1D8M A;  3KMC A;  2ERO A;  1JAN A;  1JIZ A;  1RM8 A;  4PKV A;  1QIA A;  1QUA A;  5BPA A;  1OS9 A;  1K7I A;  4GQL A;  1UMS A;  1UTZ A;  3U1R A;  3AYK A;  3I7G A;  3KRY A;  2K9C A;  3VTG A;  1I73 A;  1YCM A;  3O2X A;  4FXQ A;  4L19 A;  4R3V A;  4XBH A;  4PKS A;  5I3M A;  1A86 A;  1HOV A;  3DSL A;  4H3X A;  2FV5 A;  3USN A;  1O0Q A;  1AST A;  1OS2 A;  1I1I P;  2W13 A;  1KUH A;  4IN9 A;  4H2E A;  3L0T A;  3LKA A;  5D1U A;  1KUF A;  1ZXV A;  4EFS A;  3K7L A;  3LIR A;  830C A;  1OZ9 A;  1YP1 A;  3RTT A;  3KEJ A;  3B8Z A;  2OZR A;  3ELM A;  3LGP A;  3NX7 A;  1DMT A;  1KUI A;  1JJ9 A;  3DNG A;  3KWV C;  1ZTQ A;  4ON1 A;  1BSW A;  1JAO A;  1QJI A;  1CGL A;  2E2D A;  5I0L A;  1J7N A;  1HFC A;  1SAT A;  2D1O A;  1AYK A;  1GO7 P;  1Q3A A;  4PKR A;  1XFW A;  3ZXH A;  3B2Z A;  1YOU A;  4GR8 A;  2J83 A;  1XFX A;  2O36 A;  2D1N A;  2J0T A;  1GXD A;  1BKC E;  4XCT A;  3GBO A;  2JNP A;  4I35 A;  1PWU A;  5CXA A;  5JMY A;  2HU6 A;  4GF1 A;  2MZH A;  4WF6 A;  2JT6 A;  3HB2 P;  1KUG A;  1JKY A;  1BQO A;  4AXQ A;  1JAQ A;  2OW1 A;  3WV2 A;  3EWJ A;  1QIB A;  4CTH A;  3V96 B;  3F1A A;  4G0D A;  2XS3 A;  1S4B P;  3DL1 A;  3LIL A;  1Z3J A;  4H49 A;  1UEA A;  4H82 A;  1IAA A;  1CXV A;  1JH1 A;  3B92 A;  1XM5 A;  1JIW P;  3EDZ A;  1QIC A;  1R54 A;  5D7W A;  5CZM A;  3LJG A;  1G9K A;  4FU4 A;  1L6J A;  2WOA A;  1FBL A;  1IAD A;  4QKZ A;  4JIJ A;  5B5P A;  2OXZ A;  1CIZ A;  1G49 A;  2V4B A;  4FXY P;  1OMJ A;  4H76 A;  2I47 A;  3EHY A;  1O0T A;  1RMZ A;  2X3C A;  3LK8 A;  1ND1 A;  5I43 A;  3LEA A;  4GUY A;  4A3W A;  4PKT A;  1G05 A;  1USN A; 
#chains in the Genus database with same CATH homology
 1ZVX A;  1FM1 A;  3G5C A;  2Z2D A;  2ERQ A;  2PJT A;  3F15 A;  3LQ0 A;  3HYG A;  1R1I A;  1SLN A;  4PKQ A;  2TCL A;  3AIG A;  1JK3 A;  4JPA A;  3SHI A;  4FVL A;  4XM6 A;  2WO9 A;  3KEC A;  3I7I A;  1OM7 A;  5L7F A;  2DDY A;  2KRJ A;  3TSK A;  3WV3 A;  4L63 A;  4WK7 A;  1IAC A;  2A8H A;  1EUB A;  456C A;  5B5O A;  5D1S A;  4JP4 A;  1XFU A;  5CUH A;  2Y6D A;  1UTT A;  1XFZ A;  2YIG A;  4Q1L A;  5D2B A;  1B8Y A;  3DWB A;  1IAB A;  1R1H A;  1HV5 A;  2OI0 A;  2OY4 A;  1CQR A;  3Q2H A;  3DPF A;  3WV1 A;  1HY7 A;  2OVX A;  1D7X A;  2OXU A;  3TT4 A;  3LUN A;  2SRT A;  1ZP5 A;  966C A;  2JSD A;  1EAK A;  3LE9 A;  3LMC A;  4GWN A;  1SLM A;  1CK7 A;  2FV9 A;  4GWM A;  4JA1 A;  2MLR A;  2OW2 A;  4H30 A;  4WKI A;  1I76 A;  1BUV M;  1CGF A;  3HDB A;  1CAQ A;  3OHL A;  3RTS A;  1AF0 A;  4L6T A;  3HY7 A;  1Y0V A;  1ZXC A;  2QPJ A;  1MMP A;  4AUO A;  5I4O A;  1GE7 A;  2X3B A;  3TVC A;  2DW1 A;  1GE5 A;  3G42 A;  5I2Z A;  3EDI A;  4WZV A;  2DW2 A;  4XM7 A;  3L0V A;  1R1J A;  3VI1 A;  2OW9 A;  3HBU P;  4GR0 A;  1K7Q A;  4AIG A;  1XFY A;  1GKC A;  4HMA A;  5H8X A;  3F18 A;  3DTI A;  4AYK A;  3KME A;  1Y93 A;  2USN A;  4PKW A;  1CGE A;  4IUW A;  1XUD A;  2AYK A;  2W15 A;  3P1V A;  3TS4 A;  1A85 A;  3EDH A;  1MMQ A;  3KHI A;  3KEK A;  3EHX A;  4PKU A;  4I03 A;  2MZI A;  1D8F A;  1GE6 A;  3OHO A;  4WKE A;  2W0D A;  2DDF A;  2MZE A;  1C3I A;  2N8R A;  2L0R A;  2JIH A;  3F17 A;  3LJT A;  2YB9 A;  2Y6C A;  2W12 A;  1MMB A;  3LIK A;  1ZS0 A;  3K7N A;  5LAB A;  4IJO A;  1GO8 P;  1D5J A;  1PWV A;  3LQB A;  1H71 P;  1WNI A;  2POJ A;  5I12 A;  4G9L A;  2X3A A;  1BKC A;  3CKI A;  1BM6 A;  1KAP P;  3N2U A;  4DD8 A;  4DF9 A;  1HTD A;  1PWQ A;  1ATL A;  2CLT A;  3DPE A;  4L7A A;  1BQQ M;  3LUM A;  4ILW D;  1QJJ A;  2JT5 A;  5D1T A;  1OM8 A;  3F19 A;  4ZR5 A;  1EB6 A;  3Q2G A;  1UMT A;  5D3C A;  2OVZ A;  4HX3 A;  3AYU A;  1BKC I;  3F16 A;  2WO8 A;  4GR3 A;  1G4K A;  1DTH A;  2X7M A;  3HDA P;  1PWP A;  3P24 A;  3HBV P;  1BIW A;  1BUD A;  1SRP A;  1XUR A;  4A7B A;  2OY2 A;  1KBC A;  2K2G A;  1IAE A;  2RJQ A;  1BZS A;  2OXW A;  3HY9 A;  1B3D A;  4H84 A;  2O3E A;  2DW0 A;  4J4M A;  4XM8 A;  2OW0 A;  4DV8 A;  2MLS A;  1FLS A;  2ERP A;  3O64 A;  1C8T A;  1Y8J A;  2W14 A;  3ZVS A;  3BA0 A;  1R55 A;  1GKD A;  3ZUK A;  1MNC A;  1SMP A;  1C7K A;  5L79 A;  1ROS A;  2RJP A;  3DTK A;  1HFS A;  1MMR A;  1G12 A;  1OM6 A;  2E3X A;  3UVC A;  4DPE A;  2CKI A;  1PWW A;  1IAG A;  1XUC A;  3DTE A;  3LJZ A;  1K7G A;  3MA2 A;  3EDG A;  4JQG A;  1XFV A;  1KUK A;  3N2V A;  4H1Q A;  1SU3 A;  1AKL A;  1YQY A;  2AIG P;  1OO9 A;  2XS4 A;  5BOY A;  2YUF A;  1JAP A;  5BOT A;  3E8R A;  1D8M A;  3KMC A;  2ERO A;  1JAN A;  1JIZ A;  1RM8 A;  4PKV A;  1QIA A;  1QUA A;  5BPA A;  1OS9 A;  1K7I A;  4GQL A;  1UMS A;  1UTZ A;  3U1R A;  3AYK A;  3I7G A;  3KRY A;  2K9C A;  3VTG A;  1I73 A;  1YCM A;  3O2X A;  4FXQ A;  4L19 A;  4R3V A;  4XBH A;  4PKS A;  5I3M A;  1A86 A;  1HOV A;  3DSL A;  4H3X A;  2FV5 A;  3USN A;  1O0Q A;  1AST A;  1OS2 A;  1I1I P;  2W13 A;  1KUH A;  4IN9 A;  4H2E A;  3L0T A;  3LKA A;  5D1U A;  1KUF A;  1ZXV A;  4EFS A;  3K7L A;  3LIR A;  830C A;  1YP1 A;  3RTT A;  3KEJ A;  3B8Z A;  2OZR A;  3ELM A;  3LGP A;  3NX7 A;  1DMT A;  1KUI A;  1JJ9 A;  3DNG A;  3KWV C;  1ZTQ A;  4ON1 A;  1BSW A;  1JAO A;  1QJI A;  1CGL A;  2E2D A;  5I0L A;  1J7N A;  1HFC A;  1SAT A;  2D1O A;  1AYK A;  1GO7 P;  1Q3A A;  4PKR A;  1XFW A;  3ZXH A;  3B2Z A;  1YOU A;  4GR8 A;  2J83 A;  1XFX A;  2O36 A;  2D1N A;  2J0T A;  1GXD A;  1BKC E;  4XCT A;  3GBO A;  2JNP A;  4I35 A;  1PWU A;  5CXA A;  5JMY A;  2HU6 A;  4GF1 A;  2MZH A;  4WF6 A;  2JT6 A;  3HB2 P;  1KUG A;  1JKY A;  1BQO A;  4AXQ A;  1JAQ A;  2OW1 A;  3WV2 A;  3EWJ A;  1QIB A;  4CTH A;  3V96 B;  3F1A A;  4G0D A;  2XS3 A;  1S4B P;  3DL1 A;  3LIL A;  1Z3J A;  4H49 A;  1UEA A;  4H82 A;  1IAA A;  1CXV A;  1JH1 A;  3B92 A;  1JIW P;  3EDZ A;  1QIC A;  1R54 A;  5D7W A;  5CZM A;  3LJG A;  1G9K A;  4FU4 A;  1L6J A;  2WOA A;  1FBL A;  1IAD A;  4QKZ A;  4JIJ A;  5B5P A;  2OXZ A;  1CIZ A;  1G49 A;  2V4B A;  4FXY P;  1OMJ A;  4H76 A;  2I47 A;  3EHY A;  1O0T A;  1RMZ A;  2X3C A;  3LK8 A;  1ND1 A;  5I43 A;  3LEA A;  4GUY A;  4A3W A;  4PKT A;  1G05 A;  1USN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...