4I03A

Human mmp12 in complex with a peg-linked bifunctional l-glutamate motif inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
b'MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Crystallization of bi-functional ligand protein complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4i03A00
3LQ0A 2ERQA 2W13A 2AYKA 2QPJA 3DSLA 5H8XA 1H71P 2JSDA 1JK3A 2V4BA 830CA 1HOVA 4AXQA 5I0LA 1BKCE 4XM7A 4WKEA 2DW2A 1KUHA 1KAPP 456CA 1L6JA 5I2ZA 1R1JA 2X3CA 1QIAA 1IADA 1EUBA 3TSKA 3RTSA 1GE5A 2TCLA 3GBOA 3KECA 4PKSA 4QKZA 3P1VA 3UVCA 5D7WA 4I03A 5D1TA 1IACA 2L0RA 2KRJA 3LMCA 3ZVSA 4FXYP 1B3DA 3MA2A 3G5CA 3LIRA 3TT4A 1OS9A 2MZHA 5D3CA 4G9LA 1SRPA 2Y6CA 2MLRA 2USNA 3KEKA 2K2GA 2W14A 2A8HA 1R54A 966CA 4JP4A 1XURA 2E3XA 4HX3A 4JIJA 1SLNA 2PJTA 3O64A 2OY2A 3KHIA 4A7BA 3E8RA 3DNGA 1Y0VA 2WO9A 3LJTA 3I7IA 1D8FA 1C8TA 1HFSA 2DW0A 4FU4A 1O0QA 5L7FA 2D1NA 4GR8A 1JIWP 3Q2HA 1BUDA 2OXZA 5I4OA 2MZIA 1IAAA 3LILA 1MMRA 2WOAA 2DW1A 1JANA 1G9KA 3EDHA 2W15A 1PWUA 5I12A 3LEAA 3HB2P 1CGEA 1AKLA 1PWPA 4ILWD 1XFVA 3F19A 1RMZA 3ZUKA 4CTHA 1S4BP 1JJ9A 2CLTA 4JA1A 1R1IA 1BQOA 1DMTA 3LQBA 4J4MA 1YP1A 1GO7P 2N8RA 1YOUA 2OW2A 1FM1A 3HBVP 2W12A 3L0VA 3L0TA 1CIZA 1MMPA 3SHIA 3HYGA 3EDGA 3P24A 4JQGA 1BQQM 1GKDA 4PKTA 3F17A 4L6TA 2X7MA 3HDAP 4HMAA 5D1UA 2OW0A 2HU6A 2POJA 1CAQA 1CXVA 1K7GA 1G12A 2I47A 1BIWA 1BSWA 1JAPA 3DPFA 3HY9A 1XFXA 1KUIA 4H84A 1KUFA 5L79A 2Y6DA 2JT5A 4PKVA 1HY7A 5BOTA 4L19A 1CQRA 3BA0A 4GWMA 4GWNA 1KUGA 1UEAA 1SLMA 3V96B 1GE7A 1I1IP 1JH1A 3USNA 1G4KA 3F16A 1QICA 1ROSA 2K9CA 4H82A 1QUAA 4IN9A 3G42A 1FBLA 4WZVA 1UTZA 3HBUP 4JPAA 2FV9A 3OHOA 1Y8JA 3WV3A 1K7QA 3TVCA 1PWVA 1O0TA 1BKCA 1WNIA 4WKIA 3VI1A 3K7NA 1ZVXA 3K7LA 3B92A 1OM7A 5BOYA 1USNA 2RJPA 2WO8A 1ND1A 3EHYA 1JAQA 4L63A 3LKAA 1A85A 2X3AA 1BM6A 3LGPA 1OM6A 4WF6A 1IAEA 4ON1A 4DF9A 2O36A 1GO8P 1KBCA 2E2DA 4PKRA 1OM8A 1XFWA 2MZEA 3EDZA 3F15A 3LUNA 2DDYA 3AYUA 1BKCI 5BPAA 1MMBA 1XUDA 3EDIA 3LJGA 3AYKA 1PWWA 4AUOA 1D7XA 3RTTA 1GKCA 4GUYA 1ZTQA 1MNCA 3DL1A 4H1QA 1DTHA 1ZS0A 1Y93A 4ZR5A 4PKUA 5B5OA 4EFSA 1D8MA 5I3MA 1QIBA 1HV5A 2MLSA 1ZXVA 3CKIA 4FXQA 5JMYA 1JAOA 4G0DA 1UTTA 5CZMA 1J7NA 3WV1A 3I7GA 2YB9A 3LE9A 1XFZA 3F1AA 1SU3A 3KEJA 2OVXA 3N2UA 1MMQA 1HFCA 1SMPA 4Q1LA 1KUKA 2XS3A 2CKIA 3KRYA 2OZRA 4H30A 1G49A 5LABA 1BZSA 3DPEA 4DD8A 4I35A 3OHLA 3KWVC 3B8ZA 2OVZA 4GR0A 1AYKA 3TS4A 2OW1A 4XCTA 3HY7A 5CUHA 4GR3A 1OO9A 1UMTA 4XBHA 2Z2DA 4FVLA 5B5PA 2JIHA 2J0TA 4H76A 4GF1A 1CK7A 2YIGA 2EROA 3ELMA 3KMCA 3NX7A 1YCMA 1JIZA 2D1OA 4GQLA 1R1HA 5D2BA 2J83A 4PKQA 3ZXHA 1ATLA 1C3IA 1C7KA 4H2EA 3LUMA 1K7IA 2OY4A 3N2VA 1SATA 2OXUA 3O2XA 1FLSA 4WK7A 1CGLA 2X3BA 3F18A 2ERPA 2DDFA 1CGFA 2W0DA 5D1SA 1QJIA 1XFYA 3LK8A 2O3EA 1D5JA 3B2ZA 1A86A 1G05A 1I73A 3KMEA 1YQYA 1HTDA 3DWBA 1IABA 3LJZA 3HDBA 2OW9A 4R3VA 4PKWA 1GXDA 1EAKA 4IUWA 3U1RA 1IAGA 1OS2A 1PWQA 3EHXA 1QJJA 5I43A 1GE6A 4H49A 3Q2GA 3AIGA 5CXAA 3VTGA 4A3WA 3WV2A 1Q3AA 1XUCA 1OMJA 1UMSA 2OXWA 4H3XA 1R55A 4IJOA 4DPEA 3LIKA 1AF0A 2SRTA 4DV8A 1JKYA 2XS4A 1ZXCA 1ZP5A 1ASTA 1BUVM 3EWJA 4XM8A 2OI0A 2FV5A 1B8YA 1I76A 1Z3JA 4AYKA 4AIGA 1RM8A 4XM6A 2JNPA 2AIGP 2JT6A 1EB6A 1XFUA 2RJQA
chains in the Genus database with same CATH superfamily
3LQ0A 2ERQA 2W13A 2AYKA 2QPJA 3DSLA 5H8XA 1H71P 2JSDA 1JK3A 2V4BA 830CA 1HOVA 4AXQA 5I0LA 1BKCE 4XM7A 4WKEA 2DW2A 1KUHA 1KAPP 456CA 1L6JA 5I2ZA 1R1JA 2X3CA 1QIAA 1IADA 1EUBA 3TSKA 3RTSA 1GE5A 2TCLA 3GBOA 3KECA 4PKSA 4QKZA 3P1VA 3UVCA 5D7WA 4I03A 5D1TA 1IACA 2L0RA 2KRJA 3LMCA 3ZVSA 4FXYP 1B3DA 3MA2A 3G5CA 3LIRA 3TT4A 1OS9A 2MZHA 5D3CA 4G9LA 1SRPA 2Y6CA 1XM5A 2MLRA 2USNA 3KEKA 2K2GA 2W14A 2A8HA 1R54A 966CA 4JP4A 1XURA 2E3XA 4HX3A 4JIJA 1SLNA 2PJTA 3O64A 2OY2A 3KHIA 4A7BA 3E8RA 3DNGA 1Y0VA 2WO9A 3LJTA 3I7IA 1D8FA 1C8TA 1HFSA 2DW0A 4FU4A 1O0QA 5L7FA 2D1NA 4GR8A 1JIWP 3Q2HA 1BUDA 2OXZA 5I4OA 2MZIA 1IAAA 3LILA 1MMRA 2WOAA 2DW1A 1JANA 1G9KA 3EDHA 2W15A 1PWUA 5I12A 3LEAA 3HB2P 1CGEA 1AKLA 1PWPA 4ILWD 1XFVA 3F19A 1RMZA 3ZUKA 4CTHA 1S4BP 3DTEA 1JJ9A 2CLTA 4JA1A 1R1IA 1OZ9A 1BQOA 2YUFA 1DMTA 3LQBA 4J4MA 1YP1A 1GO7P 2N8RA 1YOUA 2OW2A 1FM1A 3HBVP 2W12A 3L0VA 3L0TA 1CIZA 1MMPA 3SHIA 3HYGA 3EDGA 3P24A 4JQGA 1BQQM 1GKDA 4PKTA 3F17A 4L6TA 2X7MA 3HDAP 4HMAA 5D1UA 2OW0A 2HU6A 2POJA 1CAQA 1CXVA 1K7GA 1G12A 2I47A 1BIWA 1BSWA 1JAPA 3DPFA 3HY9A 1XFXA 1KUIA 4H84A 1KUFA 5L79A 2Y6DA 2JT5A 4PKVA 1HY7A 5BOTA 4L19A 1CQRA 3BA0A 4GWMA 4GWNA 1KUGA 1UEAA 1SLMA 3V96B 1GE7A 3DTKA 1I1IP 1JH1A 3USNA 1G4KA 3F16A 1QICA 1ROSA 2K9CA 4H82A 1QUAA 4IN9A 3G42A 1FBLA 4WZVA 1UTZA 3HBUP 4JPAA 2FV9A 3OHOA 1Y8JA 3WV3A 1K7QA 3TVCA 1PWVA 1O0TA 1BKCA 1WNIA 4WKIA 3VI1A 3K7NA 1ZVXA 3K7LA 3B92A 1OM7A 5BOYA 1USNA 2RJPA 2WO8A 1ND1A 3EHYA 1JAQA 4L63A 3LKAA 1A85A 2X3AA 1BM6A 3LGPA 1OM6A 4WF6A 1IAEA 4ON1A 4DF9A 2O36A 1GO8P 1KBCA 2E2DA 4PKRA 1OM8A 1XFWA 2MZEA 3EDZA 3F15A 3LUNA 2DDYA 3AYUA 1BKCI 5BPAA 1MMBA 1XUDA 3EDIA 3LJGA 3AYKA 1PWWA 4AUOA 1D7XA 3RTTA 1GKCA 1XAXA 4GUYA 1ZTQA 1MNCA 3DL1A 4H1QA 1DTHA 1ZS0A 1Y93A 4ZR5A 4PKUA 5B5OA 4EFSA 1D8MA 5I3MA 1QIBA 1HV5A 2MLSA 1ZXVA 3CKIA 4FXQA 5JMYA 1JAOA 4G0DA 1UTTA 5CZMA 1J7NA 3WV1A 3I7GA 2YB9A 3LE9A 1XFZA 3F1AA 1SU3A 3KEJA 2OVXA 3N2UA 1MMQA 1HFCA 1SMPA 4Q1LA 1KUKA 2XS3A 2CKIA 3KRYA 2OZRA 4H30A 1G49A 5LABA 1BZSA 3DPEA 4DD8A 4I35A 3OHLA 3KWVC 3B8ZA 2OVZA 4GR0A 1AYKA 3TS4A 2OW1A 4XCTA 3HY7A 5CUHA 4GR3A 1OO9A 1UMTA 4XBHA 2Z2DA 4FVLA 5B5PA 2JIHA 2J0TA 4H76A 4GF1A 1CK7A 2YIGA 2EROA 3ELMA 3KMCA 1TVIA 1YCMA 3NX7A 1JIZA 2D1OA 4GQLA 1R1HA 5D2BA 2J83A 4PKQA 3ZXHA 1ATLA 1C3IA 1C7KA 4H2EA 3LUMA 1K7IA 2OY4A 3N2VA 1SATA 2OXUA 3O2XA 1FLSA 4WK7A 1CGLA 2X3BA 3F18A 2ERPA 2DDFA 1CGFA 2W0DA 5D1SA 3DTIA 1QJIA 1XFYA 3LK8A 2O3EA 1D5JA 3B2ZA 1A86A 1G05A 1I73A 3KMEA 1YQYA 4L7AA 1HTDA 3DWBA 1IABA 3LJZA 3HDBA 2OW9A 4R3VA 4PKWA 1GXDA 1EAKA 4IUWA 3U1RA 1IAGA 1OS2A 1PWQA 3EHXA 1QJJA 5I43A 1GE6A 4H49A 3Q2GA 3AIGA 5CXAA 3VTGA 4A3WA 3WV2A 1Q3AA 1XUCA 1OMJA 1UMSA 2OXWA 4H3XA 1R55A 4IJOA 4DPEA 3LIKA 1AF0A 2SRTA 4DV8A 1JKYA 2XS4A 1ZXCA 1ZP5A 1ASTA 1BUVM 3EWJA 4XM8A 2OI0A 2FV5A 1B8YA 1I76A 1Z3JA 4AYKA 4AIGA 1RM8A 4XM6A 2JNPA 2AIGP 2JT6A 1EB6A 1XFUA 2RJQA
chains in the Genus database with same CATH topology
3LQ0A 2ERQA 2W13A 2AYKA 2QPJA 3DSLA 5H8XA 1H71P 2JSDA 1JK3A 2V4BA 830CA 1HOVA 4AXQA 5I0LA 1BKCE 4XM7A 4WKEA 2DW2A 1KUHA 1KAPP 456CA 1L6JA 5I2ZA 1R1JA 2X3CA 1QIAA 1IADA 1EUBA 3TSKA 3RTSA 1GE5A 2TCLA 3GBOA 3KECA 4PKSA 4QKZA 3P1VA 3UVCA 5D7WA 4I03A 5D1TA 1IACA 2L0RA 2KRJA 3LMCA 3ZVSA 4FXYP 1B3DA 3MA2A 3G5CA 3LIRA 3TT4A 1OS9A 2MZHA 5D3CA 4G9LA 1SRPA 2Y6CA 2MLRA 2USNA 3KEKA 2K2GA 2W14A 2A8HA 1R54A 966CA 4JP4A 1XURA 2E3XA 4HX3A 4JIJA 1SLNA 2PJTA 3O64A 2OY2A 3KHIA 4A7BA 3E8RA 3DNGA 1Y0VA 2WO9A 3LJTA 3I7IA 1D8FA 1C8TA 1HFSA 2DW0A 4FU4A 1O0QA 5L7FA 2D1NA 4GR8A 1JIWP 3Q2HA 1BUDA 2OXZA 5I4OA 2MZIA 1IAAA 3LILA 1MMRA 2WOAA 2DW1A 1JANA 1G9KA 3EDHA 2W15A 1PWUA 5I12A 3LEAA 3HB2P 1CGEA 1AKLA 1PWPA 4ILWD 1XFVA 3F19A 1RMZA 3ZUKA 4CTHA 1S4BP 3DTEA 1JJ9A 2CLTA 4JA1A 1R1IA 1BQOA 2YUFA 1DMTA 3LQBA 4J4MA 1YP1A 1GO7P 2N8RA 1YOUA 2OW2A 1FM1A 3HBVP 2W12A 3L0VA 3L0TA 1CIZA 1MMPA 3SHIA 3HYGA 3EDGA 3P24A 4JQGA 1BQQM 1GKDA 4PKTA 3F17A 4L6TA 2X7MA 3HDAP 4HMAA 5D1UA 2OW0A 2HU6A 2POJA 1CAQA 1CXVA 1K7GA 1G12A 2I47A 1BIWA 1BSWA 1JAPA 3DPFA 3HY9A 1XFXA 1KUIA 4H84A 1KUFA 5L79A 2Y6DA 2JT5A 4PKVA 1HY7A 5BOTA 4L19A 1CQRA 3BA0A 4GWMA 4GWNA 1KUGA 1UEAA 1SLMA 3V96B 1GE7A 3DTKA 1I1IP 1JH1A 3USNA 1G4KA 3F16A 1QICA 1ROSA 2K9CA 4H82A 1QUAA 4IN9A 3G42A 1FBLA 4WZVA 1UTZA 3HBUP 4JPAA 2FV9A 3OHOA 1Y8JA 3WV3A 1K7QA 3TVCA 1PWVA 1O0TA 1BKCA 1WNIA 4WKIA 3VI1A 3K7NA 1ZVXA 3K7LA 3B92A 1OM7A 5BOYA 1USNA 2RJPA 2WO8A 1ND1A 3EHYA 1JAQA 4L63A 3LKAA 1A85A 2X3AA 1BM6A 3LGPA 1OM6A 4WF6A 1IAEA 4ON1A 4DF9A 2O36A 1GO8P 1KBCA 2E2DA 4PKRA 1OM8A 1XFWA 2MZEA 3EDZA 3F15A 3LUNA 2DDYA 3AYUA 1BKCI 5BPAA 1MMBA 1XUDA 3EDIA 3LJGA 3AYKA 1PWWA 4AUOA 1D7XA 3RTTA 1GKCA 4GUYA 1ZTQA 1MNCA 3DL1A 4H1QA 1DTHA 1ZS0A 1Y93A 4ZR5A 4PKUA 5B5OA 4EFSA 1D8MA 5I3MA 1QIBA 1HV5A 2MLSA 1ZXVA 3CKIA 4FXQA 5JMYA 1JAOA 4G0DA 1UTTA 5CZMA 1J7NA 3WV1A 3I7GA 2YB9A 3LE9A 1XFZA 3F1AA 1SU3A 3KEJA 2OVXA 3N2UA 1MMQA 1HFCA 1SMPA 4Q1LA 1KUKA 2XS3A 2CKIA 3KRYA 2OZRA 4H30A 1G49A 5LABA 1BZSA 3DPEA 4DD8A 4I35A 3OHLA 3KWVC 3B8ZA 2OVZA 4GR0A 1AYKA 3TS4A 2OW1A 4XCTA 3HY7A 5CUHA 4GR3A 1OO9A 1UMTA 4XBHA 2Z2DA 4FVLA 5B5PA 2JIHA 2J0TA 4H76A 4GF1A 1CK7A 2YIGA 2EROA 3ELMA 3KMCA 3NX7A 1YCMA 1JIZA 2D1OA 4GQLA 1R1HA 5D2BA 2J83A 4PKQA 3ZXHA 1ATLA 1C3IA 1C7KA 4H2EA 3LUMA 1K7IA 2OY4A 3N2VA 1SATA 2OXUA 3O2XA 1FLSA 4WK7A 1CGLA 2X3BA 3F18A 2ERPA 2DDFA 1CGFA 2W0DA 5D1SA 3DTIA 1QJIA 1XFYA 3LK8A 2O3EA 1D5JA 3B2ZA 1A86A 1G05A 1I73A 3KMEA 1YQYA 4L7AA 1HTDA 3DWBA 1IABA 3LJZA 3HDBA 2OW9A 4R3VA 4PKWA 1GXDA 1EAKA 4IUWA 3U1RA 1IAGA 1OS2A 1PWQA 3EHXA 1QJJA 5I43A 1GE6A 4H49A 3Q2GA 3AIGA 5CXAA 3VTGA 4A3WA 3WV2A 1Q3AA 1XUCA 1OMJA 1UMSA 2OXWA 4H3XA 1R55A 4IJOA 4DPEA 3LIKA 1AF0A 2SRTA 4DV8A 1JKYA 2XS4A 1ZXCA 1ZP5A 1ASTA 1BUVM 3EWJA 4XM8A 2OI0A 2FV5A 1B8YA 1I76A 1Z3JA 4AYKA 4AIGA 1RM8A 4XM6A 2JNPA 2AIGP 2JT6A 1EB6A 1XFUA 2RJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQ0 A;  2ERQ A;  2W13 A;  2AYK A;  2QPJ A;  3DSL A;  5H8X A;  1H71 P;  2JSD A;  1JK3 A;  2V4B A;  830C A;  1HOV A;  4AXQ A;  5I0L A;  1BKC E;  4XM7 A;  4WKE A;  2DW2 A;  1KUH A;  1KAP P;  456C A;  1L6J A;  5I2Z A;  1R1J A;  2X3C A;  1QIA A;  1IAD A;  1EUB A;  3TSK A;  3RTS A;  1GE5 A;  2TCL A;  3GBO A;  3KEC A;  4PKS A;  4QKZ A;  3P1V A;  3UVC A;  5D7W A;  4I03 A;  5D1T A;  1IAC A;  2L0R A;  2KRJ A;  3LMC A;  3ZVS A;  4FXY P;  1B3D A;  3MA2 A;  3G5C A;  3LIR A;  3TT4 A;  1OS9 A;  2MZH A;  5D3C A;  4G9L A;  1SRP A;  2Y6C A;  2MLR A;  2USN A;  3KEK A;  2K2G A;  2W14 A;  2A8H A;  1R54 A;  966C A;  4JP4 A;  1XUR A;  2E3X A;  4HX3 A;  4JIJ A;  1SLN A;  2PJT A;  3O64 A;  2OY2 A;  3KHI A;  4A7B A;  3E8R A;  3DNG A;  1Y0V A;  2WO9 A;  3LJT A;  3I7I A;  1D8F A;  1C8T A;  1HFS A;  2DW0 A;  4FU4 A;  1O0Q A;  5L7F A;  2D1N A;  4GR8 A;  1JIW P;  3Q2H A;  1BUD A;  2OXZ A;  5I4O A;  2MZI A;  1IAA A;  3LIL A;  1MMR A;  2WOA A;  2DW1 A;  1JAN A;  1G9K A;  3EDH A;  2W15 A;  1PWU A;  5I12 A;  3LEA A;  3HB2 P;  1CGE A;  1AKL A;  1PWP A;  4ILW D;  1XFV A;  3F19 A;  1RMZ A;  3ZUK A;  4CTH A;  1S4B P;  1JJ9 A;  2CLT A;  4JA1 A;  1R1I A;  1BQO A;  1DMT A;  3LQB A;  4J4M A;  1YP1 A;  1GO7 P;  2N8R A;  1YOU A;  2OW2 A;  1FM1 A;  3HBV P;  2W12 A;  3L0V A;  3L0T A;  1CIZ A;  1MMP A;  3SHI A;  3HYG A;  3EDG A;  3P24 A;  4JQG A;  1BQQ M;  1GKD A;  4PKT A;  3F17 A;  4L6T A;  2X7M A;  3HDA P;  4HMA A;  5D1U A;  2OW0 A;  2HU6 A;  2POJ A;  1CAQ A;  1CXV A;  1K7G A;  1G12 A;  2I47 A;  1BIW A;  1BSW A;  1JAP A;  3DPF A;  3HY9 A;  1XFX A;  1KUI A;  4H84 A;  1KUF A;  5L79 A;  2Y6D A;  2JT5 A;  4PKV A;  1HY7 A;  5BOT A;  4L19 A;  1CQR A;  3BA0 A;  4GWM A;  4GWN A;  1KUG A;  1UEA A;  1SLM A;  3V96 B;  1GE7 A;  1I1I P;  1JH1 A;  3USN A;  1G4K A;  3F16 A;  1QIC A;  1ROS A;  2K9C A;  4H82 A;  1QUA A;  4IN9 A;  3G42 A;  1FBL A;  4WZV A;  1UTZ A;  3HBU P;  4JPA A;  2FV9 A;  3OHO A;  1Y8J A;  3WV3 A;  1K7Q A;  3TVC A;  1PWV A;  1O0T A;  1BKC A;  1WNI A;  4WKI A;  3VI1 A;  3K7N A;  1ZVX A;  3K7L A;  3B92 A;  1OM7 A;  5BOY A;  1USN A;  2RJP A;  2WO8 A;  1ND1 A;  3EHY A;  1JAQ A;  4L63 A;  3LKA A;  1A85 A;  2X3A A;  1BM6 A;  3LGP A;  1OM6 A;  4WF6 A;  1IAE A;  4ON1 A;  4DF9 A;  2O36 A;  1GO8 P;  1KBC A;  2E2D A;  4PKR A;  1OM8 A;  1XFW A;  2MZE A;  3EDZ A;  3F15 A;  3LUN A;  2DDY A;  3AYU A;  1BKC I;  5BPA A;  1MMB A;  1XUD A;  3EDI A;  3LJG A;  3AYK A;  1PWW A;  4AUO A;  1D7X A;  3RTT A;  1GKC A;  4GUY A;  1ZTQ A;  1MNC A;  3DL1 A;  4H1Q A;  1DTH A;  1ZS0 A;  1Y93 A;  4ZR5 A;  4PKU A;  5B5O A;  4EFS A;  1D8M A;  5I3M A;  1QIB A;  1HV5 A;  2MLS A;  1ZXV A;  3CKI A;  4FXQ A;  5JMY A;  1JAO A;  4G0D A;  1UTT A;  5CZM A;  1J7N A;  3WV1 A;  3I7G A;  2YB9 A;  3LE9 A;  1XFZ A;  3F1A A;  1SU3 A;  3KEJ A;  2OVX A;  3N2U A;  1MMQ A;  1HFC A;  1SMP A;  4Q1L A;  1KUK A;  2XS3 A;  2CKI A;  3KRY A;  2OZR A;  4H30 A;  1G49 A;  5LAB A;  1BZS A;  3DPE A;  4DD8 A;  4I35 A;  3OHL A;  3KWV C;  3B8Z A;  2OVZ A;  4GR0 A;  1AYK A;  3TS4 A;  2OW1 A;  4XCT A;  3HY7 A;  5CUH A;  4GR3 A;  1OO9 A;  1UMT A;  4XBH A;  2Z2D A;  4FVL A;  5B5P A;  2JIH A;  2J0T A;  4H76 A;  4GF1 A;  1CK7 A;  2YIG A;  2ERO A;  3ELM A;  3KMC A;  3NX7 A;  1YCM A;  1JIZ A;  2D1O A;  4GQL A;  1R1H A;  5D2B A;  2J83 A;  4PKQ A;  3ZXH A;  1ATL A;  1C3I A;  1C7K A;  4H2E A;  3LUM A;  1K7I A;  2OY4 A;  3N2V A;  1SAT A;  2OXU A;  3O2X A;  1FLS A;  4WK7 A;  1CGL A;  2X3B A;  3F18 A;  2ERP A;  2DDF A;  1CGF A;  2W0D A;  5D1S A;  1QJI A;  1XFY A;  3LK8 A;  2O3E A;  1D5J A;  3B2Z A;  1A86 A;  1G05 A;  1I73 A;  3KME A;  1YQY A;  1HTD A;  3DWB A;  1IAB A;  3LJZ A;  3HDB A;  2OW9 A;  4R3V A;  4PKW A;  1GXD A;  1EAK A;  4IUW A;  3U1R A;  1IAG A;  1OS2 A;  1PWQ A;  3EHX A;  1QJJ A;  5I43 A;  1GE6 A;  4H49 A;  3Q2G A;  3AIG A;  5CXA A;  3VTG A;  4A3W A;  3WV2 A;  1Q3A A;  1XUC A;  1OMJ A;  1UMS A;  2OXW A;  4H3X A;  1R55 A;  4IJO A;  4DPE A;  3LIK A;  1AF0 A;  2SRT A;  4DV8 A;  1JKY A;  2XS4 A;  1ZXC A;  1ZP5 A;  1AST A;  1BUV M;  3EWJ A;  4XM8 A;  2OI0 A;  2FV5 A;  1B8Y A;  1I76 A;  1Z3J A;  4AYK A;  4AIG A;  1RM8 A;  4XM6 A;  2JNP A;  2AIG P;  2JT6 A;  1EB6 A;  1XFU A;  2RJQ A; 
#chains in the Genus database with same CATH topology
 3LQ0 A;  2ERQ A;  2W13 A;  2AYK A;  2QPJ A;  3DSL A;  5H8X A;  1H71 P;  2JSD A;  1JK3 A;  2V4B A;  830C A;  1HOV A;  4AXQ A;  5I0L A;  1BKC E;  4XM7 A;  4WKE A;  2DW2 A;  1KUH A;  1KAP P;  456C A;  1L6J A;  5I2Z A;  1R1J A;  2X3C A;  1QIA A;  1IAD A;  1EUB A;  3TSK A;  3RTS A;  1GE5 A;  2TCL A;  3GBO A;  3KEC A;  4PKS A;  4QKZ A;  3P1V A;  3UVC A;  5D7W A;  4I03 A;  5D1T A;  1IAC A;  2L0R A;  2KRJ A;  3LMC A;  3ZVS A;  4FXY P;  1B3D A;  3MA2 A;  3G5C A;  3LIR A;  3TT4 A;  1OS9 A;  2MZH A;  5D3C A;  4G9L A;  1SRP A;  2Y6C A;  1XM5 A;  2MLR A;  2USN A;  3KEK A;  2K2G A;  2W14 A;  2A8H A;  1R54 A;  966C A;  4JP4 A;  1XUR A;  2E3X A;  4HX3 A;  4JIJ A;  1SLN A;  2PJT A;  3O64 A;  2OY2 A;  3KHI A;  4A7B A;  3E8R A;  3DNG A;  1Y0V A;  2WO9 A;  3LJT A;  3I7I A;  1D8F A;  1C8T A;  1HFS A;  2DW0 A;  4FU4 A;  1O0Q A;  5L7F A;  2D1N A;  4GR8 A;  1JIW P;  3Q2H A;  1BUD A;  2OXZ A;  5I4O A;  2MZI A;  1IAA A;  3LIL A;  1MMR A;  2WOA A;  2DW1 A;  1JAN A;  1G9K A;  3EDH A;  2W15 A;  1PWU A;  5I12 A;  3LEA A;  3HB2 P;  1CGE A;  1AKL A;  1PWP A;  4ILW D;  1XFV A;  3F19 A;  1RMZ A;  3ZUK A;  4CTH A;  1S4B P;  3DTE A;  1JJ9 A;  2CLT A;  4JA1 A;  1R1I A;  1OZ9 A;  1BQO A;  2YUF A;  1DMT A;  3LQB A;  4J4M A;  1YP1 A;  1GO7 P;  2N8R A;  1YOU A;  2OW2 A;  1FM1 A;  3HBV P;  2W12 A;  3L0V A;  3L0T A;  1CIZ A;  1MMP A;  3SHI A;  3HYG A;  3EDG A;  3P24 A;  4JQG A;  1BQQ M;  1GKD A;  4PKT A;  3F17 A;  4L6T A;  2X7M A;  3HDA P;  4HMA A;  5D1U A;  2OW0 A;  2HU6 A;  2POJ A;  1CAQ A;  1CXV A;  1K7G A;  1G12 A;  2I47 A;  1BIW A;  1BSW A;  1JAP A;  3DPF A;  3HY9 A;  1XFX A;  1KUI A;  4H84 A;  1KUF A;  5L79 A;  2Y6D A;  2JT5 A;  4PKV A;  1HY7 A;  5BOT A;  4L19 A;  1CQR A;  3BA0 A;  4GWM A;  4GWN A;  1KUG A;  1UEA A;  1SLM A;  3V96 B;  1GE7 A;  3DTK A;  1I1I P;  1JH1 A;  3USN A;  1G4K A;  3F16 A;  1QIC A;  1ROS A;  2K9C A;  4H82 A;  1QUA A;  4IN9 A;  3G42 A;  1FBL A;  4WZV A;  1UTZ A;  3HBU P;  4JPA A;  2FV9 A;  3OHO A;  1Y8J A;  3WV3 A;  1K7Q A;  3TVC A;  1PWV A;  1O0T A;  1BKC A;  1WNI A;  4WKI A;  3VI1 A;  3K7N A;  1ZVX A;  3K7L A;  3B92 A;  1OM7 A;  5BOY A;  1USN A;  2RJP A;  2WO8 A;  1ND1 A;  3EHY A;  1JAQ A;  4L63 A;  3LKA A;  1A85 A;  2X3A A;  1BM6 A;  3LGP A;  1OM6 A;  4WF6 A;  1IAE A;  4ON1 A;  4DF9 A;  2O36 A;  1GO8 P;  1KBC A;  2E2D A;  4PKR A;  1OM8 A;  1XFW A;  2MZE A;  3EDZ A;  3F15 A;  3LUN A;  2DDY A;  3AYU A;  1BKC I;  5BPA A;  1MMB A;  1XUD A;  3EDI A;  3LJG A;  3AYK A;  1PWW A;  4AUO A;  1D7X A;  3RTT A;  1GKC A;  1XAX A;  4GUY A;  1ZTQ A;  1MNC A;  3DL1 A;  4H1Q A;  1DTH A;  1ZS0 A;  1Y93 A;  4ZR5 A;  4PKU A;  5B5O A;  4EFS A;  1D8M A;  5I3M A;  1QIB A;  1HV5 A;  2MLS A;  1ZXV A;  3CKI A;  4FXQ A;  5JMY A;  1JAO A;  4G0D A;  1UTT A;  5CZM A;  1J7N A;  3WV1 A;  3I7G A;  2YB9 A;  3LE9 A;  1XFZ A;  3F1A A;  1SU3 A;  3KEJ A;  2OVX A;  3N2U A;  1MMQ A;  1HFC A;  1SMP A;  4Q1L A;  1KUK A;  2XS3 A;  2CKI A;  3KRY A;  2OZR A;  4H30 A;  1G49 A;  5LAB A;  1BZS A;  3DPE A;  4DD8 A;  4I35 A;  3OHL A;  3KWV C;  3B8Z A;  2OVZ A;  4GR0 A;  1AYK A;  3TS4 A;  2OW1 A;  4XCT A;  3HY7 A;  5CUH A;  4GR3 A;  1OO9 A;  1UMT A;  4XBH A;  2Z2D A;  4FVL A;  5B5P A;  2JIH A;  2J0T A;  4H76 A;  4GF1 A;  1CK7 A;  2YIG A;  2ERO A;  3ELM A;  3KMC A;  1TVI A;  1YCM A;  3NX7 A;  1JIZ A;  2D1O A;  4GQL A;  1R1H A;  5D2B A;  2J83 A;  4PKQ A;  3ZXH A;  1ATL A;  1C3I A;  1C7K A;  4H2E A;  3LUM A;  1K7I A;  2OY4 A;  3N2V A;  1SAT A;  2OXU A;  3O2X A;  1FLS A;  4WK7 A;  1CGL A;  2X3B A;  3F18 A;  2ERP A;  2DDF A;  1CGF A;  2W0D A;  5D1S A;  3DTI A;  1QJI A;  1XFY A;  3LK8 A;  2O3E A;  1D5J A;  3B2Z A;  1A86 A;  1G05 A;  1I73 A;  3KME A;  1YQY A;  4L7A A;  1HTD A;  3DWB A;  1IAB A;  3LJZ A;  3HDB A;  2OW9 A;  4R3V A;  4PKW A;  1GXD A;  1EAK A;  4IUW A;  3U1R A;  1IAG A;  1OS2 A;  1PWQ A;  3EHX A;  1QJJ A;  5I43 A;  1GE6 A;  4H49 A;  3Q2G A;  3AIG A;  5CXA A;  3VTG A;  4A3W A;  3WV2 A;  1Q3A A;  1XUC A;  1OMJ A;  1UMS A;  2OXW A;  4H3X A;  1R55 A;  4IJO A;  4DPE A;  3LIK A;  1AF0 A;  2SRT A;  4DV8 A;  1JKY A;  2XS4 A;  1ZXC A;  1ZP5 A;  1AST A;  1BUV M;  3EWJ A;  4XM8 A;  2OI0 A;  2FV5 A;  1B8Y A;  1I76 A;  1Z3J A;  4AYK A;  4AIG A;  1RM8 A;  4XM6 A;  2JNP A;  2AIG P;  2JT6 A;  1EB6 A;  1XFU A;  2RJQ A; 
#chains in the Genus database with same CATH homology
 3LQ0 A;  2ERQ A;  2W13 A;  2AYK A;  2QPJ A;  3DSL A;  5H8X A;  1H71 P;  2JSD A;  1JK3 A;  2V4B A;  830C A;  1HOV A;  4AXQ A;  5I0L A;  1BKC E;  4XM7 A;  4WKE A;  2DW2 A;  1KUH A;  1KAP P;  456C A;  1L6J A;  5I2Z A;  1R1J A;  2X3C A;  1QIA A;  1IAD A;  1EUB A;  3TSK A;  3RTS A;  1GE5 A;  2TCL A;  3GBO A;  3KEC A;  4PKS A;  4QKZ A;  3P1V A;  3UVC A;  5D7W A;  4I03 A;  5D1T A;  1IAC A;  2L0R A;  2KRJ A;  3LMC A;  3ZVS A;  4FXY P;  1B3D A;  3MA2 A;  3G5C A;  3LIR A;  3TT4 A;  1OS9 A;  2MZH A;  5D3C A;  4G9L A;  1SRP A;  2Y6C A;  2MLR A;  2USN A;  3KEK A;  2K2G A;  2W14 A;  2A8H A;  1R54 A;  966C A;  4JP4 A;  1XUR A;  2E3X A;  4HX3 A;  4JIJ A;  1SLN A;  2PJT A;  3O64 A;  2OY2 A;  3KHI A;  4A7B A;  3E8R A;  3DNG A;  1Y0V A;  2WO9 A;  3LJT A;  3I7I A;  1D8F A;  1C8T A;  1HFS A;  2DW0 A;  4FU4 A;  1O0Q A;  5L7F A;  2D1N A;  4GR8 A;  1JIW P;  3Q2H A;  1BUD A;  2OXZ A;  5I4O A;  2MZI A;  1IAA A;  3LIL A;  1MMR A;  2WOA A;  2DW1 A;  1JAN A;  1G9K A;  3EDH A;  2W15 A;  1PWU A;  5I12 A;  3LEA A;  3HB2 P;  1CGE A;  1AKL A;  1PWP A;  4ILW D;  1XFV A;  3F19 A;  1RMZ A;  3ZUK A;  4CTH A;  1S4B P;  3DTE A;  1JJ9 A;  2CLT A;  4JA1 A;  1R1I A;  1BQO A;  2YUF A;  1DMT A;  3LQB A;  4J4M A;  1YP1 A;  1GO7 P;  2N8R A;  1YOU A;  2OW2 A;  1FM1 A;  3HBV P;  2W12 A;  3L0V A;  3L0T A;  1CIZ A;  1MMP A;  3SHI A;  3HYG A;  3EDG A;  3P24 A;  4JQG A;  1BQQ M;  1GKD A;  4PKT A;  3F17 A;  4L6T A;  2X7M A;  3HDA P;  4HMA A;  5D1U A;  2OW0 A;  2HU6 A;  2POJ A;  1CAQ A;  1CXV A;  1K7G A;  1G12 A;  2I47 A;  1BIW A;  1BSW A;  1JAP A;  3DPF A;  3HY9 A;  1XFX A;  1KUI A;  4H84 A;  1KUF A;  5L79 A;  2Y6D A;  2JT5 A;  4PKV A;  1HY7 A;  5BOT A;  4L19 A;  1CQR A;  3BA0 A;  4GWM A;  4GWN A;  1KUG A;  1UEA A;  1SLM A;  3V96 B;  1GE7 A;  3DTK A;  1I1I P;  1JH1 A;  3USN A;  1G4K A;  3F16 A;  1QIC A;  1ROS A;  2K9C A;  4H82 A;  1QUA A;  4IN9 A;  3G42 A;  1FBL A;  4WZV A;  1UTZ A;  3HBU P;  4JPA A;  2FV9 A;  3OHO A;  1Y8J A;  3WV3 A;  1K7Q A;  3TVC A;  1PWV A;  1O0T A;  1BKC A;  1WNI A;  4WKI A;  3VI1 A;  3K7N A;  1ZVX A;  3K7L A;  3B92 A;  1OM7 A;  5BOY A;  1USN A;  2RJP A;  2WO8 A;  1ND1 A;  3EHY A;  1JAQ A;  4L63 A;  3LKA A;  1A85 A;  2X3A A;  1BM6 A;  3LGP A;  1OM6 A;  4WF6 A;  1IAE A;  4ON1 A;  4DF9 A;  2O36 A;  1GO8 P;  1KBC A;  2E2D A;  4PKR A;  1OM8 A;  1XFW A;  2MZE A;  3EDZ A;  3F15 A;  3LUN A;  2DDY A;  3AYU A;  1BKC I;  5BPA A;  1MMB A;  1XUD A;  3EDI A;  3LJG A;  3AYK A;  1PWW A;  4AUO A;  1D7X A;  3RTT A;  1GKC A;  4GUY A;  1ZTQ A;  1MNC A;  3DL1 A;  4H1Q A;  1DTH A;  1ZS0 A;  1Y93 A;  4ZR5 A;  4PKU A;  5B5O A;  4EFS A;  1D8M A;  5I3M A;  1QIB A;  1HV5 A;  2MLS A;  1ZXV A;  3CKI A;  4FXQ A;  5JMY A;  1JAO A;  4G0D A;  1UTT A;  5CZM A;  1J7N A;  3WV1 A;  3I7G A;  2YB9 A;  3LE9 A;  1XFZ A;  3F1A A;  1SU3 A;  3KEJ A;  2OVX A;  3N2U A;  1MMQ A;  1HFC A;  1SMP A;  4Q1L A;  1KUK A;  2XS3 A;  2CKI A;  3KRY A;  2OZR A;  4H30 A;  1G49 A;  5LAB A;  1BZS A;  3DPE A;  4DD8 A;  4I35 A;  3OHL A;  3KWV C;  3B8Z A;  2OVZ A;  4GR0 A;  1AYK A;  3TS4 A;  2OW1 A;  4XCT A;  3HY7 A;  5CUH A;  4GR3 A;  1OO9 A;  1UMT A;  4XBH A;  2Z2D A;  4FVL A;  5B5P A;  2JIH A;  2J0T A;  4H76 A;  4GF1 A;  1CK7 A;  2YIG A;  2ERO A;  3ELM A;  3KMC A;  3NX7 A;  1YCM A;  1JIZ A;  2D1O A;  4GQL A;  1R1H A;  5D2B A;  2J83 A;  4PKQ A;  3ZXH A;  1ATL A;  1C3I A;  1C7K A;  4H2E A;  3LUM A;  1K7I A;  2OY4 A;  3N2V A;  1SAT A;  2OXU A;  3O2X A;  1FLS A;  4WK7 A;  1CGL A;  2X3B A;  3F18 A;  2ERP A;  2DDF A;  1CGF A;  2W0D A;  5D1S A;  3DTI A;  1QJI A;  1XFY A;  3LK8 A;  2O3E A;  1D5J A;  3B2Z A;  1A86 A;  1G05 A;  1I73 A;  3KME A;  1YQY A;  4L7A A;  1HTD A;  3DWB A;  1IAB A;  3LJZ A;  3HDB A;  2OW9 A;  4R3V A;  4PKW A;  1GXD A;  1EAK A;  4IUW A;  3U1R A;  1IAG A;  1OS2 A;  1PWQ A;  3EHX A;  1QJJ A;  5I43 A;  1GE6 A;  4H49 A;  3Q2G A;  3AIG A;  5CXA A;  3VTG A;  4A3W A;  3WV2 A;  1Q3A A;  1XUC A;  1OMJ A;  1UMS A;  2OXW A;  4H3X A;  1R55 A;  4IJO A;  4DPE A;  3LIK A;  1AF0 A;  2SRT A;  4DV8 A;  1JKY A;  2XS4 A;  1ZXC A;  1ZP5 A;  1AST A;  1BUV M;  3EWJ A;  4XM8 A;  2OI0 A;  2FV5 A;  1B8Y A;  1I76 A;  1Z3J A;  4AYK A;  4AIG A;  1RM8 A;  4XM6 A;  2JNP A;  2AIG P;  2JT6 A;  1EB6 A;  1XFU A;  2RJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...