4I03A

Human mmp12 in complex with a peg-linked bifunctional l-glutamate motif inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Macrophage metalloelastase
publication title Crystallization of bi-functional ligand protein complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4i03A00
3I7GA 1GKDA 4ZR5A 3F17A 3AYUA 3LQBA 1G4KA 4AIGA 1XFWA 3LIKA 3ZUKA 1UMSA 1XFZA 5D7WA 4H82A 1CIZA 4DF9A 3UVCA 4FXQA 3K7LA 5BPAA 3K7NA 2DW2A 4WF6A 2OI0A 4GR0A 4H30A 4J4MA 3ZXHA 1HOVA 1MMRA 1EB6A 3B2ZA 2Z2DA 4FVLA 3HBUP 1JAQA 3LEAA 2W15A 1ZP5A 3G5CA 2OXUA 2O36A 2L0RA 1MMQA 3DWBA 1G9KA 1JAPA 2CLTA 2FV5A 5D3CA 3DPFA 3OHLA 2OVXA 1AKLA 4PKVA 2X3CA 2RJQA 3TS4A 2I47A 3EHXA 3EDGA 4H3XA 5CUHA 1KUFA 1XURA 5D1UA 3DSLA 3EDZA 3LUMA 1IAAA 1QIBA 4XM6A 1K7IA 2KRJA 3WV3A 2W0DA 1GE5A 1QUAA 2OZRA 2MZHA 2XS3A 5CXAA 3Q2HA 4PKQA 3LKAA 2POJA 2X3AA 3V96B 2OXZA 1GXDA 1GE6A 1GO8P 1YCMA 2CKIA 3Q2GA 2DDYA 3HY7A 1BQOA 830CA 1QICA 1R55A 2Y6CA 4PKWA 2MZIA 1HFCA 4PKUA 1UEAA 1OS2A 1BKCA 4G9LA 2JNPA 3OHOA 1ND1A 3B92A 3WV1A 1JANA 3F19A 1PWWA 3LMCA 4XM8A 3EDIA 4L6TA 1AF0A 1PWPA 4GWMA 1BQQM 4L19A 3LK8A 4AXQA 4IUWA 4IJOA 3G42A 1S4BP 5JMYA 2V4BA 1JAOA 1Y93A 4DD8A 1I76A 2PJTA 2USNA 3F16A 4EFSA 1ROSA 4AYKA 3LJTA 1CGFA 4I35A 3N2UA 3KEJA 2O3EA 1QJJA 1FBLA 1K7QA 3EDHA 3ELMA 1PWQA 1L6JA 4GF1A 4A7BA 3KEKA 2Y6DA 3P24A 4ON1A 1C8TA 2MLSA 4QKZA 3CKIA 1ZXVA 2SRTA 3MA2A 3KMCA 1PWVA 1USNA 2JIHA 3F15A 4JPAA 1ATLA 3VI1A 1D5JA 1CAQA 1SATA 1CXVA 4DV8A 1BKCE 1BUDA 2A8HA 4L63A 4A3WA 1CQRA 3HDAP 3LIRA 4GWNA 2OW0A 5I4OA 4H2EA 3RTTA 2JT5A 3AYKA 1OMJA 1IACA 1SRPA 2DW0A 3O64A 1WNIA 2W13A 4JQGA 1IAEA 4XM7A 1HFSA 3E8RA 2J83A 1SMPA 5LABA 1KUHA 2OW1A 2MLRA 1KUIA 1BM6A 3DNGA 2ERQA 5D2BA 4WKEA 3LQ0A 1I1IP 1JKYA 5D1TA 5I3MA 1C7KA 4CTHA 1BSWA 4WZVA 966CA 2X3BA 1GKCA 4DPEA 1G12A 2XS4A 456CA 3AIGA 1G49A 2WO8A 1IAGA 1IABA 3USNA 3LE9A 2RJPA 1RM8A 1SU3A 5B5OA 3HY9A 2N8RA 1HV5A 3HB2P 1B3DA 2W12A 2WOAA 1A86A 1IADA 1EUBA 2DDFA 1BKCI 2OW2A 5BOYA 1I73A 1CGLA 2OXWA 2TCLA 1GE7A 4XBHA 3TSKA 1UTTA 5D1SA 1C3IA 1UTZA 3I7IA 2D1OA 2HU6A 1BUVM 1JJ9A 3KRYA 3F1AA 1BIWA 1XFUA 2X7MA 4ILWD 1YP1A 2ERPA 5I2ZA 1BZSA 3RTSA 1B8YA 2OVZA 1Z3JA 2OY4A 1MMPA 1R1IA 4WK7A 3LJGA 4JIJA 3VTGA 1D7XA 2W14A 1KUKA 5I12A 1ZS0A 2K9CA 3HDBA 2EROA 2FV9A 1KBCA 4FU4A 4HX3A 1UMTA 4PKTA 2QPJA 4R3VA 1XFYA 1XFXA 3P1VA 2E3XA 4PKRA 1GO7P 1AYKA 5H8XA 4GUYA 3GBOA 1CK7A 4GR3A 1RMZA 5I0LA 1DTHA 1K7GA 1FM1A 3KECA 1Y0VA 1R1JA 1XUDA 4JA1A 3HYGA 2YIGA 1XFVA 3KHIA 3DL1A 2MZEA 3KMEA 3O2XA 2E2DA 3HBVP 2OW9A 4HMAA 1JIZA 4H49A 1Q3AA 1KAPP 3B8ZA 1CGEA 3KWVC 1R1HA 4GQLA 4H76A 3ZVSA 1R54A 1OM8A 3N2VA 3WV2A 2AYKA 1D8FA 1YQYA 1QIAA 3L0TA 1QJIA 2YB9A 4PKSA 4WKIA 1OO9A 1Y8JA 1XUCA 3TVCA 4FXYP 5BOTA 1SLNA 5L79A 1H71P 1MMBA 2J0TA 1O0TA 2AIGP 2JSDA 4H1QA 3EHYA 1OM6A 3BA0A 1ZXCA 1HY7A 4IN9A 4GR8A 4G0DA 1HTDA 4I03A 1OM7A 1FLSA 4H84A 3LILA 5L7FA 1JH1A 3U1RA 1DMTA 2JT6A 3L0VA 5CZMA 1ZVXA 2WO9A 1KUGA 3NX7A 1PWUA 1EAKA 3F18A 1SLMA 1ASTA 1J7NA 3DPEA 4XCTA 5B5PA 5I43A 4AUOA 3LUNA 2D1NA 1MNCA 1OS9A 3TT4A 1YOUA 1ZTQA 1A85A 1D8MA 4JP4A 2DW1A 3LJZA 3EWJA 1JIWP 1O0QA 3SHIA 3LGPA 2K2GA 4Q1LA 2OY2A 1JK3A 1G05A
chains in the Genus database with same CATH superfamily
3I7GA 1GKDA 4ZR5A 3F17A 3AYUA 3LQBA 4L7AA 1G4KA 4AIGA 1XM5A 1XFWA 3LIKA 3ZUKA 1UMSA 1XFZA 5D7WA 4H82A 1CIZA 4DF9A 3UVCA 4FXQA 3K7LA 5BPAA 3K7NA 2DW2A 4WF6A 2OI0A 4GR0A 4H30A 4J4MA 3ZXHA 1HOVA 1MMRA 1EB6A 3B2ZA 2Z2DA 4FVLA 3HBUP 1JAQA 3LEAA 2W15A 1ZP5A 3G5CA 2OXUA 2O36A 2L0RA 1MMQA 3DWBA 1G9KA 1JAPA 2CLTA 2FV5A 5D3CA 3DPFA 3OHLA 2OVXA 1AKLA 4PKVA 2X3CA 2RJQA 3TS4A 2I47A 3EHXA 3EDGA 4H3XA 5CUHA 1KUFA 1XURA 5D1UA 3DSLA 3EDZA 3LUMA 1IAAA 1QIBA 4XM6A 1K7IA 2KRJA 3WV3A 2W0DA 1GE5A 1QUAA 2OZRA 2MZHA 2XS3A 5CXAA 3Q2HA 4PKQA 3LKAA 2POJA 2X3AA 3V96B 2OXZA 1GXDA 1GE6A 1GO8P 1YCMA 2CKIA 3Q2GA 2DDYA 3HY7A 1BQOA 830CA 1QICA 1R55A 2Y6CA 4PKWA 2MZIA 1HFCA 4PKUA 1UEAA 1OS2A 1BKCA 4G9LA 2JNPA 3OHOA 1ND1A 3B92A 3WV1A 1JANA 3F19A 1PWWA 3LMCA 4XM8A 3EDIA 4L6TA 1AF0A 1PWPA 4GWMA 1BQQM 4L19A 3LK8A 4AXQA 4IUWA 4IJOA 3G42A 1S4BP 5JMYA 2V4BA 1JAOA 1Y93A 4DD8A 1I76A 2PJTA 2USNA 3F16A 4EFSA 1ROSA 4AYKA 3LJTA 1CGFA 4I35A 3N2UA 3KEJA 2O3EA 1QJJA 1FBLA 1K7QA 3EDHA 3ELMA 1PWQA 1L6JA 4GF1A 4A7BA 3KEKA 2Y6DA 3P24A 4ON1A 1C8TA 2MLSA 4QKZA 3CKIA 1ZXVA 2SRTA 3MA2A 3KMCA 1PWVA 1USNA 2JIHA 3F15A 4JPAA 1XAXA 1ATLA 3VI1A 1D5JA 1CAQA 1SATA 1CXVA 4DV8A 1BKCE 1BUDA 2A8HA 4L63A 4A3WA 1CQRA 3HDAP 3LIRA 4GWNA 2OW0A 5I4OA 4H2EA 3RTTA 2JT5A 3AYKA 1OMJA 1IACA 1SRPA 2DW0A 3O64A 1WNIA 2W13A 4JQGA 1IAEA 4XM7A 1HFSA 1OZ9A 3E8RA 2J83A 1SMPA 5LABA 1KUHA 2OW1A 2MLRA 1KUIA 1BM6A 3DNGA 2ERQA 5D2BA 4WKEA 3DTEA 3LQ0A 1I1IP 1JKYA 5D1TA 5I3MA 1C7KA 4CTHA 1BSWA 4WZVA 966CA 2X3BA 1GKCA 4DPEA 1G12A 2XS4A 456CA 3AIGA 1G49A 2WO8A 1IAGA 1IABA 3USNA 3LE9A 2RJPA 1RM8A 1SU3A 5B5OA 3HY9A 2N8RA 1HV5A 3HB2P 1B3DA 2W12A 2WOAA 1A86A 1IADA 1EUBA 2DDFA 1BKCI 2OW2A 5BOYA 1I73A 1CGLA 2OXWA 2TCLA 1GE7A 4XBHA 3TSKA 1UTTA 5D1SA 1C3IA 1UTZA 3I7IA 2D1OA 2HU6A 1BUVM 1JJ9A 3KRYA 3F1AA 1BIWA 1XFUA 2X7MA 4ILWD 1YP1A 2ERPA 5I2ZA 1BZSA 3RTSA 1B8YA 2OVZA 1Z3JA 2OY4A 1MMPA 1R1IA 4WK7A 3LJGA 4JIJA 3VTGA 1D7XA 2W14A 1KUKA 3DTIA 5I12A 1ZS0A 2K9CA 3HDBA 2EROA 2FV9A 1KBCA 4FU4A 4HX3A 1UMTA 4PKTA 2QPJA 4R3VA 1XFYA 1XFXA 3P1VA 2E3XA 4PKRA 1GO7P 1AYKA 5H8XA 4GUYA 3GBOA 1CK7A 4GR3A 1RMZA 5I0LA 1DTHA 1K7GA 1FM1A 3KECA 1Y0VA 1R1JA 1XUDA 4JA1A 3HYGA 2YIGA 1XFVA 3KHIA 3DL1A 2MZEA 3KMEA 3O2XA 2E2DA 3HBVP 2OW9A 4HMAA 1JIZA 4H49A 1Q3AA 1KAPP 3B8ZA 1CGEA 3KWVC 1R1HA 4GQLA 4H76A 3ZVSA 1R54A 1OM8A 3N2VA 3WV2A 2AYKA 1D8FA 1YQYA 1QIAA 3L0TA 1QJIA 2YB9A 4PKSA 4WKIA 1OO9A 1Y8JA 1XUCA 3TVCA 4FXYP 5BOTA 1SLNA 5L79A 1H71P 1MMBA 2J0TA 1O0TA 2AIGP 2JSDA 4H1QA 3EHYA 1OM6A 3BA0A 1ZXCA 1HY7A 4IN9A 4GR8A 4G0DA 1HTDA 4I03A 1OM7A 1FLSA 4H84A 3LILA 5L7FA 1JH1A 3U1RA 1DMTA 2JT6A 3L0VA 3DTKA 5CZMA 1ZVXA 2WO9A 1KUGA 3NX7A 1PWUA 1EAKA 3F18A 1SLMA 1ASTA 1J7NA 3DPEA 4XCTA 5B5PA 5I43A 1TVIA 4AUOA 3LUNA 2D1NA 2YUFA 1MNCA 1OS9A 3TT4A 1YOUA 1ZTQA 1A85A 1D8MA 4JP4A 2DW1A 3LJZA 3EWJA 1JIWP 1O0QA 3SHIA 3LGPA 2K2GA 4Q1LA 2OY2A 1JK3A 1G05A
chains in the Genus database with same CATH topology
3I7GA 1GKDA 4ZR5A 3F17A 3AYUA 3LQBA 4L7AA 1G4KA 4AIGA 1XFWA 3LIKA 3ZUKA 1UMSA 1XFZA 5D7WA 4H82A 1CIZA 4DF9A 3UVCA 4FXQA 3K7LA 5BPAA 3K7NA 2DW2A 4WF6A 2OI0A 4GR0A 4H30A 4J4MA 3ZXHA 1HOVA 1MMRA 1EB6A 3B2ZA 2Z2DA 4FVLA 3HBUP 1JAQA 3LEAA 2W15A 1ZP5A 3G5CA 2OXUA 2O36A 2L0RA 1MMQA 3DWBA 1G9KA 1JAPA 2CLTA 2FV5A 5D3CA 3DPFA 3OHLA 2OVXA 1AKLA 4PKVA 2X3CA 2RJQA 3TS4A 2I47A 3EHXA 3EDGA 4H3XA 5CUHA 1KUFA 1XURA 5D1UA 3DSLA 3EDZA 3LUMA 1IAAA 1QIBA 4XM6A 1K7IA 2KRJA 3WV3A 2W0DA 1GE5A 1QUAA 2OZRA 2MZHA 2XS3A 5CXAA 3Q2HA 4PKQA 3LKAA 2POJA 2X3AA 3V96B 2OXZA 1GXDA 1GE6A 1GO8P 1YCMA 2CKIA 3Q2GA 2DDYA 3HY7A 1BQOA 830CA 1QICA 1R55A 2Y6CA 4PKWA 2MZIA 1HFCA 4PKUA 1UEAA 1OS2A 1BKCA 4G9LA 2JNPA 3OHOA 1ND1A 3B92A 3WV1A 1JANA 3F19A 1PWWA 3LMCA 4XM8A 3EDIA 4L6TA 1AF0A 1PWPA 4GWMA 1BQQM 4L19A 3LK8A 4AXQA 4IUWA 4IJOA 3G42A 1S4BP 5JMYA 2V4BA 1JAOA 1Y93A 4DD8A 1I76A 2PJTA 2USNA 3F16A 4EFSA 1ROSA 4AYKA 3LJTA 1CGFA 4I35A 3N2UA 3KEJA 2O3EA 1QJJA 1FBLA 1K7QA 3EDHA 3ELMA 1PWQA 1L6JA 4GF1A 4A7BA 3KEKA 2Y6DA 3P24A 4ON1A 1C8TA 2MLSA 4QKZA 3CKIA 1ZXVA 2SRTA 3MA2A 3KMCA 1PWVA 1USNA 2JIHA 3F15A 4JPAA 1ATLA 3VI1A 1D5JA 1CAQA 1SATA 1CXVA 4DV8A 1BKCE 1BUDA 2A8HA 4L63A 4A3WA 1CQRA 3HDAP 3LIRA 4GWNA 2OW0A 5I4OA 4H2EA 3RTTA 2JT5A 3AYKA 1OMJA 1IACA 1SRPA 2DW0A 3O64A 1WNIA 2W13A 4JQGA 1IAEA 4XM7A 1HFSA 3E8RA 2J83A 1SMPA 5LABA 1KUHA 2OW1A 2MLRA 1KUIA 1BM6A 3DNGA 2ERQA 5D2BA 4WKEA 3DTEA 3LQ0A 1I1IP 1JKYA 5D1TA 5I3MA 1C7KA 4CTHA 1BSWA 4WZVA 966CA 2X3BA 1GKCA 4DPEA 1G12A 2XS4A 456CA 3AIGA 1G49A 2WO8A 1IAGA 1IABA 3USNA 3LE9A 2RJPA 1RM8A 1SU3A 5B5OA 3HY9A 2N8RA 1HV5A 3HB2P 1B3DA 2W12A 2WOAA 1A86A 1IADA 1EUBA 2DDFA 1BKCI 2OW2A 5BOYA 1I73A 1CGLA 2OXWA 2TCLA 1GE7A 4XBHA 3TSKA 1UTTA 5D1SA 1C3IA 1UTZA 3I7IA 2D1OA 2HU6A 1BUVM 1JJ9A 3KRYA 3F1AA 1BIWA 1XFUA 2X7MA 4ILWD 1YP1A 2ERPA 5I2ZA 1BZSA 3RTSA 1B8YA 2OVZA 1Z3JA 2OY4A 1MMPA 1R1IA 4WK7A 3LJGA 4JIJA 3VTGA 1D7XA 2W14A 1KUKA 3DTIA 5I12A 1ZS0A 2K9CA 3HDBA 2EROA 2FV9A 1KBCA 4FU4A 4HX3A 1UMTA 4PKTA 2QPJA 4R3VA 1XFYA 1XFXA 3P1VA 2E3XA 4PKRA 1GO7P 1AYKA 5H8XA 4GUYA 3GBOA 1CK7A 4GR3A 1RMZA 5I0LA 1DTHA 1K7GA 1FM1A 3KECA 1Y0VA 1R1JA 1XUDA 4JA1A 3HYGA 2YIGA 1XFVA 3KHIA 3DL1A 2MZEA 3KMEA 3O2XA 2E2DA 3HBVP 2OW9A 4HMAA 1JIZA 4H49A 1Q3AA 1KAPP 3B8ZA 1CGEA 3KWVC 1R1HA 4GQLA 4H76A 3ZVSA 1R54A 1OM8A 3N2VA 3WV2A 2AYKA 1D8FA 1YQYA 1QIAA 3L0TA 1QJIA 2YB9A 4PKSA 4WKIA 1OO9A 1Y8JA 1XUCA 3TVCA 4FXYP 5BOTA 1SLNA 5L79A 1H71P 1MMBA 2J0TA 1O0TA 2AIGP 2JSDA 4H1QA 3EHYA 1OM6A 3BA0A 1ZXCA 1HY7A 4IN9A 4GR8A 4G0DA 1HTDA 4I03A 1OM7A 1FLSA 4H84A 3LILA 5L7FA 1JH1A 3U1RA 1DMTA 2JT6A 3L0VA 3DTKA 5CZMA 1ZVXA 2WO9A 1KUGA 3NX7A 1PWUA 1EAKA 3F18A 1SLMA 1ASTA 1J7NA 3DPEA 4XCTA 5B5PA 5I43A 4AUOA 3LUNA 2D1NA 2YUFA 1MNCA 1OS9A 3TT4A 1YOUA 1ZTQA 1A85A 1D8MA 4JP4A 2DW1A 3LJZA 3EWJA 1JIWP 1O0QA 3SHIA 3LGPA 2K2GA 4Q1LA 2OY2A 1JK3A 1G05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7G A;  1GKD A;  4ZR5 A;  3F17 A;  3AYU A;  3LQB A;  1G4K A;  4AIG A;  1XFW A;  3LIK A;  3ZUK A;  1UMS A;  1XFZ A;  5D7W A;  4H82 A;  1CIZ A;  4DF9 A;  3UVC A;  4FXQ A;  3K7L A;  5BPA A;  3K7N A;  2DW2 A;  4WF6 A;  2OI0 A;  4GR0 A;  4H30 A;  4J4M A;  3ZXH A;  1HOV A;  1MMR A;  1EB6 A;  3B2Z A;  2Z2D A;  4FVL A;  3HBU P;  1JAQ A;  3LEA A;  2W15 A;  1ZP5 A;  3G5C A;  2OXU A;  2O36 A;  2L0R A;  1MMQ A;  3DWB A;  1G9K A;  1JAP A;  2CLT A;  2FV5 A;  5D3C A;  3DPF A;  3OHL A;  2OVX A;  1AKL A;  4PKV A;  2X3C A;  2RJQ A;  3TS4 A;  2I47 A;  3EHX A;  3EDG A;  4H3X A;  5CUH A;  1KUF A;  1XUR A;  5D1U A;  3DSL A;  3EDZ A;  3LUM A;  1IAA A;  1QIB A;  4XM6 A;  1K7I A;  2KRJ A;  3WV3 A;  2W0D A;  1GE5 A;  1QUA A;  2OZR A;  2MZH A;  2XS3 A;  5CXA A;  3Q2H A;  4PKQ A;  3LKA A;  2POJ A;  2X3A A;  3V96 B;  2OXZ A;  1GXD A;  1GE6 A;  1GO8 P;  1YCM A;  2CKI A;  3Q2G A;  2DDY A;  3HY7 A;  1BQO A;  830C A;  1QIC A;  1R55 A;  2Y6C A;  4PKW A;  2MZI A;  1HFC A;  4PKU A;  1UEA A;  1OS2 A;  1BKC A;  4G9L A;  2JNP A;  3OHO A;  1ND1 A;  3B92 A;  3WV1 A;  1JAN A;  3F19 A;  1PWW A;  3LMC A;  4XM8 A;  3EDI A;  4L6T A;  1AF0 A;  1PWP A;  4GWM A;  1BQQ M;  4L19 A;  3LK8 A;  4AXQ A;  4IUW A;  4IJO A;  3G42 A;  1S4B P;  5JMY A;  2V4B A;  1JAO A;  1Y93 A;  4DD8 A;  1I76 A;  2PJT A;  2USN A;  3F16 A;  4EFS A;  1ROS A;  4AYK A;  3LJT A;  1CGF A;  4I35 A;  3N2U A;  3KEJ A;  2O3E A;  1QJJ A;  1FBL A;  1K7Q A;  3EDH A;  3ELM A;  1PWQ A;  1L6J A;  4GF1 A;  4A7B A;  3KEK A;  2Y6D A;  3P24 A;  4ON1 A;  1C8T A;  2MLS A;  4QKZ A;  3CKI A;  1ZXV A;  2SRT A;  3MA2 A;  3KMC A;  1PWV A;  1USN A;  2JIH A;  3F15 A;  4JPA A;  1ATL A;  3VI1 A;  1D5J A;  1CAQ A;  1SAT A;  1CXV A;  4DV8 A;  1BKC E;  1BUD A;  2A8H A;  4L63 A;  4A3W A;  1CQR A;  3HDA P;  3LIR A;  4GWN A;  2OW0 A;  5I4O A;  4H2E A;  3RTT A;  2JT5 A;  3AYK A;  1OMJ A;  1IAC A;  1SRP A;  2DW0 A;  3O64 A;  1WNI A;  2W13 A;  4JQG A;  1IAE A;  4XM7 A;  1HFS A;  3E8R A;  2J83 A;  1SMP A;  5LAB A;  1KUH A;  2OW1 A;  2MLR A;  1KUI A;  1BM6 A;  3DNG A;  2ERQ A;  5D2B A;  4WKE A;  3LQ0 A;  1I1I P;  1JKY A;  5D1T A;  5I3M A;  1C7K A;  4CTH A;  1BSW A;  4WZV A;  966C A;  2X3B A;  1GKC A;  4DPE A;  1G12 A;  2XS4 A;  456C A;  3AIG A;  1G49 A;  2WO8 A;  1IAG A;  1IAB A;  3USN A;  3LE9 A;  2RJP A;  1RM8 A;  1SU3 A;  5B5O A;  3HY9 A;  2N8R A;  1HV5 A;  3HB2 P;  1B3D A;  2W12 A;  2WOA A;  1A86 A;  1IAD A;  1EUB A;  2DDF A;  1BKC I;  2OW2 A;  5BOY A;  1I73 A;  1CGL A;  2OXW A;  2TCL A;  1GE7 A;  4XBH A;  3TSK A;  1UTT A;  5D1S A;  1C3I A;  1UTZ A;  3I7I A;  2D1O A;  2HU6 A;  1BUV M;  1JJ9 A;  3KRY A;  3F1A A;  1BIW A;  1XFU A;  2X7M A;  4ILW D;  1YP1 A;  2ERP A;  5I2Z A;  1BZS A;  3RTS A;  1B8Y A;  2OVZ A;  1Z3J A;  2OY4 A;  1MMP A;  1R1I A;  4WK7 A;  3LJG A;  4JIJ A;  3VTG A;  1D7X A;  2W14 A;  1KUK A;  5I12 A;  1ZS0 A;  2K9C A;  3HDB A;  2ERO A;  2FV9 A;  1KBC A;  4FU4 A;  4HX3 A;  1UMT A;  4PKT A;  2QPJ A;  4R3V A;  1XFY A;  1XFX A;  3P1V A;  2E3X A;  4PKR A;  1GO7 P;  1AYK A;  5H8X A;  4GUY A;  3GBO A;  1CK7 A;  4GR3 A;  1RMZ A;  5I0L A;  1DTH A;  1K7G A;  1FM1 A;  3KEC A;  1Y0V A;  1R1J A;  1XUD A;  4JA1 A;  3HYG A;  2YIG A;  1XFV A;  3KHI A;  3DL1 A;  2MZE A;  3KME A;  3O2X A;  2E2D A;  3HBV P;  2OW9 A;  4HMA A;  1JIZ A;  4H49 A;  1Q3A A;  1KAP P;  3B8Z A;  1CGE A;  3KWV C;  1R1H A;  4GQL A;  4H76 A;  3ZVS A;  1R54 A;  1OM8 A;  3N2V A;  3WV2 A;  2AYK A;  1D8F A;  1YQY A;  1QIA A;  3L0T A;  1QJI A;  2YB9 A;  4PKS A;  4WKI A;  1OO9 A;  1Y8J A;  1XUC A;  3TVC A;  4FXY P;  5BOT A;  1SLN A;  5L79 A;  1H71 P;  1MMB A;  2J0T A;  1O0T A;  2AIG P;  2JSD A;  4H1Q A;  3EHY A;  1OM6 A;  3BA0 A;  1ZXC A;  1HY7 A;  4IN9 A;  4GR8 A;  4G0D A;  1HTD A;  4I03 A;  1OM7 A;  1FLS A;  4H84 A;  3LIL A;  5L7F A;  1JH1 A;  3U1R A;  1DMT A;  2JT6 A;  3L0V A;  5CZM A;  1ZVX A;  2WO9 A;  1KUG A;  3NX7 A;  1PWU A;  1EAK A;  3F18 A;  1SLM A;  1AST A;  1J7N A;  3DPE A;  4XCT A;  5B5P A;  5I43 A;  4AUO A;  3LUN A;  2D1N A;  1MNC A;  1OS9 A;  3TT4 A;  1YOU A;  1ZTQ A;  1A85 A;  1D8M A;  4JP4 A;  2DW1 A;  3LJZ A;  3EWJ A;  1JIW P;  1O0Q A;  3SHI A;  3LGP A;  2K2G A;  4Q1L A;  2OY2 A;  1JK3 A;  1G05 A; 
#chains in the Genus database with same CATH topology
 3I7G A;  1GKD A;  4ZR5 A;  3F17 A;  3AYU A;  3LQB A;  4L7A A;  1G4K A;  4AIG A;  1XM5 A;  1XFW A;  3LIK A;  3ZUK A;  1UMS A;  1XFZ A;  5D7W A;  4H82 A;  1CIZ A;  4DF9 A;  3UVC A;  4FXQ A;  3K7L A;  5BPA A;  3K7N A;  2DW2 A;  4WF6 A;  2OI0 A;  4GR0 A;  4H30 A;  4J4M A;  3ZXH A;  1HOV A;  1MMR A;  1EB6 A;  3B2Z A;  2Z2D A;  4FVL A;  3HBU P;  1JAQ A;  3LEA A;  2W15 A;  1ZP5 A;  3G5C A;  2OXU A;  2O36 A;  2L0R A;  1MMQ A;  3DWB A;  1G9K A;  1JAP A;  2CLT A;  2FV5 A;  5D3C A;  3DPF A;  3OHL A;  2OVX A;  1AKL A;  4PKV A;  2X3C A;  2RJQ A;  3TS4 A;  2I47 A;  3EHX A;  3EDG A;  4H3X A;  5CUH A;  1KUF A;  1XUR A;  5D1U A;  3DSL A;  3EDZ A;  3LUM A;  1IAA A;  1QIB A;  4XM6 A;  1K7I A;  2KRJ A;  3WV3 A;  2W0D A;  1GE5 A;  1QUA A;  2OZR A;  2MZH A;  2XS3 A;  5CXA A;  3Q2H A;  4PKQ A;  3LKA A;  2POJ A;  2X3A A;  3V96 B;  2OXZ A;  1GXD A;  1GE6 A;  1GO8 P;  1YCM A;  2CKI A;  3Q2G A;  2DDY A;  3HY7 A;  1BQO A;  830C A;  1QIC A;  1R55 A;  2Y6C A;  4PKW A;  2MZI A;  1HFC A;  4PKU A;  1UEA A;  1OS2 A;  1BKC A;  4G9L A;  2JNP A;  3OHO A;  1ND1 A;  3B92 A;  3WV1 A;  1JAN A;  3F19 A;  1PWW A;  3LMC A;  4XM8 A;  3EDI A;  4L6T A;  1AF0 A;  1PWP A;  4GWM A;  1BQQ M;  4L19 A;  3LK8 A;  4AXQ A;  4IUW A;  4IJO A;  3G42 A;  1S4B P;  5JMY A;  2V4B A;  1JAO A;  1Y93 A;  4DD8 A;  1I76 A;  2PJT A;  2USN A;  3F16 A;  4EFS A;  1ROS A;  4AYK A;  3LJT A;  1CGF A;  4I35 A;  3N2U A;  3KEJ A;  2O3E A;  1QJJ A;  1FBL A;  1K7Q A;  3EDH A;  3ELM A;  1PWQ A;  1L6J A;  4GF1 A;  4A7B A;  3KEK A;  2Y6D A;  3P24 A;  4ON1 A;  1C8T A;  2MLS A;  4QKZ A;  3CKI A;  1ZXV A;  2SRT A;  3MA2 A;  3KMC A;  1PWV A;  1USN A;  2JIH A;  3F15 A;  4JPA A;  1XAX A;  1ATL A;  3VI1 A;  1D5J A;  1CAQ A;  1SAT A;  1CXV A;  4DV8 A;  1BKC E;  1BUD A;  2A8H A;  4L63 A;  4A3W A;  1CQR A;  3HDA P;  3LIR A;  4GWN A;  2OW0 A;  5I4O A;  4H2E A;  3RTT A;  2JT5 A;  3AYK A;  1OMJ A;  1IAC A;  1SRP A;  2DW0 A;  3O64 A;  1WNI A;  2W13 A;  4JQG A;  1IAE A;  4XM7 A;  1HFS A;  1OZ9 A;  3E8R A;  2J83 A;  1SMP A;  5LAB A;  1KUH A;  2OW1 A;  2MLR A;  1KUI A;  1BM6 A;  3DNG A;  2ERQ A;  5D2B A;  4WKE A;  3DTE A;  3LQ0 A;  1I1I P;  1JKY A;  5D1T A;  5I3M A;  1C7K A;  4CTH A;  1BSW A;  4WZV A;  966C A;  2X3B A;  1GKC A;  4DPE A;  1G12 A;  2XS4 A;  456C A;  3AIG A;  1G49 A;  2WO8 A;  1IAG A;  1IAB A;  3USN A;  3LE9 A;  2RJP A;  1RM8 A;  1SU3 A;  5B5O A;  3HY9 A;  2N8R A;  1HV5 A;  3HB2 P;  1B3D A;  2W12 A;  2WOA A;  1A86 A;  1IAD A;  1EUB A;  2DDF A;  1BKC I;  2OW2 A;  5BOY A;  1I73 A;  1CGL A;  2OXW A;  2TCL A;  1GE7 A;  4XBH A;  3TSK A;  1UTT A;  5D1S A;  1C3I A;  1UTZ A;  3I7I A;  2D1O A;  2HU6 A;  1BUV M;  1JJ9 A;  3KRY A;  3F1A A;  1BIW A;  1XFU A;  2X7M A;  4ILW D;  1YP1 A;  2ERP A;  5I2Z A;  1BZS A;  3RTS A;  1B8Y A;  2OVZ A;  1Z3J A;  2OY4 A;  1MMP A;  1R1I A;  4WK7 A;  3LJG A;  4JIJ A;  3VTG A;  1D7X A;  2W14 A;  1KUK A;  3DTI A;  5I12 A;  1ZS0 A;  2K9C A;  3HDB A;  2ERO A;  2FV9 A;  1KBC A;  4FU4 A;  4HX3 A;  1UMT A;  4PKT A;  2QPJ A;  4R3V A;  1XFY A;  1XFX A;  3P1V A;  2E3X A;  4PKR A;  1GO7 P;  1AYK A;  5H8X A;  4GUY A;  3GBO A;  1CK7 A;  4GR3 A;  1RMZ A;  5I0L A;  1DTH A;  1K7G A;  1FM1 A;  3KEC A;  1Y0V A;  1R1J A;  1XUD A;  4JA1 A;  3HYG A;  2YIG A;  1XFV A;  3KHI A;  3DL1 A;  2MZE A;  3KME A;  3O2X A;  2E2D A;  3HBV P;  2OW9 A;  4HMA A;  1JIZ A;  4H49 A;  1Q3A A;  1KAP P;  3B8Z A;  1CGE A;  3KWV C;  1R1H A;  4GQL A;  4H76 A;  3ZVS A;  1R54 A;  1OM8 A;  3N2V A;  3WV2 A;  2AYK A;  1D8F A;  1YQY A;  1QIA A;  3L0T A;  1QJI A;  2YB9 A;  4PKS A;  4WKI A;  1OO9 A;  1Y8J A;  1XUC A;  3TVC A;  4FXY P;  5BOT A;  1SLN A;  5L79 A;  1H71 P;  1MMB A;  2J0T A;  1O0T A;  2AIG P;  2JSD A;  4H1Q A;  3EHY A;  1OM6 A;  3BA0 A;  1ZXC A;  1HY7 A;  4IN9 A;  4GR8 A;  4G0D A;  1HTD A;  4I03 A;  1OM7 A;  1FLS A;  4H84 A;  3LIL A;  5L7F A;  1JH1 A;  3U1R A;  1DMT A;  2JT6 A;  3L0V A;  3DTK A;  5CZM A;  1ZVX A;  2WO9 A;  1KUG A;  3NX7 A;  1PWU A;  1EAK A;  3F18 A;  1SLM A;  1AST A;  1J7N A;  3DPE A;  4XCT A;  5B5P A;  5I43 A;  1TVI A;  4AUO A;  3LUN A;  2D1N A;  2YUF A;  1MNC A;  1OS9 A;  3TT4 A;  1YOU A;  1ZTQ A;  1A85 A;  1D8M A;  4JP4 A;  2DW1 A;  3LJZ A;  3EWJ A;  1JIW P;  1O0Q A;  3SHI A;  3LGP A;  2K2G A;  4Q1L A;  2OY2 A;  1JK3 A;  1G05 A; 
#chains in the Genus database with same CATH homology
 3I7G A;  1GKD A;  4ZR5 A;  3F17 A;  3AYU A;  3LQB A;  4L7A A;  1G4K A;  4AIG A;  1XFW A;  3LIK A;  3ZUK A;  1UMS A;  1XFZ A;  5D7W A;  4H82 A;  1CIZ A;  4DF9 A;  3UVC A;  4FXQ A;  3K7L A;  5BPA A;  3K7N A;  2DW2 A;  4WF6 A;  2OI0 A;  4GR0 A;  4H30 A;  4J4M A;  3ZXH A;  1HOV A;  1MMR A;  1EB6 A;  3B2Z A;  2Z2D A;  4FVL A;  3HBU P;  1JAQ A;  3LEA A;  2W15 A;  1ZP5 A;  3G5C A;  2OXU A;  2O36 A;  2L0R A;  1MMQ A;  3DWB A;  1G9K A;  1JAP A;  2CLT A;  2FV5 A;  5D3C A;  3DPF A;  3OHL A;  2OVX A;  1AKL A;  4PKV A;  2X3C A;  2RJQ A;  3TS4 A;  2I47 A;  3EHX A;  3EDG A;  4H3X A;  5CUH A;  1KUF A;  1XUR A;  5D1U A;  3DSL A;  3EDZ A;  3LUM A;  1IAA A;  1QIB A;  4XM6 A;  1K7I A;  2KRJ A;  3WV3 A;  2W0D A;  1GE5 A;  1QUA A;  2OZR A;  2MZH A;  2XS3 A;  5CXA A;  3Q2H A;  4PKQ A;  3LKA A;  2POJ A;  2X3A A;  3V96 B;  2OXZ A;  1GXD A;  1GE6 A;  1GO8 P;  1YCM A;  2CKI A;  3Q2G A;  2DDY A;  3HY7 A;  1BQO A;  830C A;  1QIC A;  1R55 A;  2Y6C A;  4PKW A;  2MZI A;  1HFC A;  4PKU A;  1UEA A;  1OS2 A;  1BKC A;  4G9L A;  2JNP A;  3OHO A;  1ND1 A;  3B92 A;  3WV1 A;  1JAN A;  3F19 A;  1PWW A;  3LMC A;  4XM8 A;  3EDI A;  4L6T A;  1AF0 A;  1PWP A;  4GWM A;  1BQQ M;  4L19 A;  3LK8 A;  4AXQ A;  4IUW A;  4IJO A;  3G42 A;  1S4B P;  5JMY A;  2V4B A;  1JAO A;  1Y93 A;  4DD8 A;  1I76 A;  2PJT A;  2USN A;  3F16 A;  4EFS A;  1ROS A;  4AYK A;  3LJT A;  1CGF A;  4I35 A;  3N2U A;  3KEJ A;  2O3E A;  1QJJ A;  1FBL A;  1K7Q A;  3EDH A;  3ELM A;  1PWQ A;  1L6J A;  4GF1 A;  4A7B A;  3KEK A;  2Y6D A;  3P24 A;  4ON1 A;  1C8T A;  2MLS A;  4QKZ A;  3CKI A;  1ZXV A;  2SRT A;  3MA2 A;  3KMC A;  1PWV A;  1USN A;  2JIH A;  3F15 A;  4JPA A;  1ATL A;  3VI1 A;  1D5J A;  1CAQ A;  1SAT A;  1CXV A;  4DV8 A;  1BKC E;  1BUD A;  2A8H A;  4L63 A;  4A3W A;  1CQR A;  3HDA P;  3LIR A;  4GWN A;  2OW0 A;  5I4O A;  4H2E A;  3RTT A;  2JT5 A;  3AYK A;  1OMJ A;  1IAC A;  1SRP A;  2DW0 A;  3O64 A;  1WNI A;  2W13 A;  4JQG A;  1IAE A;  4XM7 A;  1HFS A;  3E8R A;  2J83 A;  1SMP A;  5LAB A;  1KUH A;  2OW1 A;  2MLR A;  1KUI A;  1BM6 A;  3DNG A;  2ERQ A;  5D2B A;  4WKE A;  3DTE A;  3LQ0 A;  1I1I P;  1JKY A;  5D1T A;  5I3M A;  1C7K A;  4CTH A;  1BSW A;  4WZV A;  966C A;  2X3B A;  1GKC A;  4DPE A;  1G12 A;  2XS4 A;  456C A;  3AIG A;  1G49 A;  2WO8 A;  1IAG A;  1IAB A;  3USN A;  3LE9 A;  2RJP A;  1RM8 A;  1SU3 A;  5B5O A;  3HY9 A;  2N8R A;  1HV5 A;  3HB2 P;  1B3D A;  2W12 A;  2WOA A;  1A86 A;  1IAD A;  1EUB A;  2DDF A;  1BKC I;  2OW2 A;  5BOY A;  1I73 A;  1CGL A;  2OXW A;  2TCL A;  1GE7 A;  4XBH A;  3TSK A;  1UTT A;  5D1S A;  1C3I A;  1UTZ A;  3I7I A;  2D1O A;  2HU6 A;  1BUV M;  1JJ9 A;  3KRY A;  3F1A A;  1BIW A;  1XFU A;  2X7M A;  4ILW D;  1YP1 A;  2ERP A;  5I2Z A;  1BZS A;  3RTS A;  1B8Y A;  2OVZ A;  1Z3J A;  2OY4 A;  1MMP A;  1R1I A;  4WK7 A;  3LJG A;  4JIJ A;  3VTG A;  1D7X A;  2W14 A;  1KUK A;  3DTI A;  5I12 A;  1ZS0 A;  2K9C A;  3HDB A;  2ERO A;  2FV9 A;  1KBC A;  4FU4 A;  4HX3 A;  1UMT A;  4PKT A;  2QPJ A;  4R3V A;  1XFY A;  1XFX A;  3P1V A;  2E3X A;  4PKR A;  1GO7 P;  1AYK A;  5H8X A;  4GUY A;  3GBO A;  1CK7 A;  4GR3 A;  1RMZ A;  5I0L A;  1DTH A;  1K7G A;  1FM1 A;  3KEC A;  1Y0V A;  1R1J A;  1XUD A;  4JA1 A;  3HYG A;  2YIG A;  1XFV A;  3KHI A;  3DL1 A;  2MZE A;  3KME A;  3O2X A;  2E2D A;  3HBV P;  2OW9 A;  4HMA A;  1JIZ A;  4H49 A;  1Q3A A;  1KAP P;  3B8Z A;  1CGE A;  3KWV C;  1R1H A;  4GQL A;  4H76 A;  3ZVS A;  1R54 A;  1OM8 A;  3N2V A;  3WV2 A;  2AYK A;  1D8F A;  1YQY A;  1QIA A;  3L0T A;  1QJI A;  2YB9 A;  4PKS A;  4WKI A;  1OO9 A;  1Y8J A;  1XUC A;  3TVC A;  4FXY P;  5BOT A;  1SLN A;  5L79 A;  1H71 P;  1MMB A;  2J0T A;  1O0T A;  2AIG P;  2JSD A;  4H1Q A;  3EHY A;  1OM6 A;  3BA0 A;  1ZXC A;  1HY7 A;  4IN9 A;  4GR8 A;  4G0D A;  1HTD A;  4I03 A;  1OM7 A;  1FLS A;  4H84 A;  3LIL A;  5L7F A;  1JH1 A;  3U1R A;  1DMT A;  2JT6 A;  3L0V A;  3DTK A;  5CZM A;  1ZVX A;  2WO9 A;  1KUG A;  3NX7 A;  1PWU A;  1EAK A;  3F18 A;  1SLM A;  1AST A;  1J7N A;  3DPE A;  4XCT A;  5B5P A;  5I43 A;  4AUO A;  3LUN A;  2D1N A;  2YUF A;  1MNC A;  1OS9 A;  3TT4 A;  1YOU A;  1ZTQ A;  1A85 A;  1D8M A;  4JP4 A;  2DW1 A;  3LJZ A;  3EWJ A;  1JIW P;  1O0Q A;  3SHI A;  3LGP A;  2K2G A;  4Q1L A;  2OY2 A;  1JK3 A;  1G05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...