1G49A

A carboxylic acid based inhibitor in complex with mmp3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
169
Chain Sequence
b'FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLOPROTEINASE 3
publication title Development of new hydroxamate matrix metalloproteinase inhibitors derived from functionalized 4-aminoprolines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1g49A00
1BSWA 3HBUP 1CK7A 1ROSA 1QIAA 1QJJA 1KUHA 1G05A 1IABA 1SRPA 4H30A 3V96B 5I43A 5D3CA 1KAPP 3HBVP 4H2EA 3I7GA 3LJTA 1JAOA 2WOAA 4XBHA 3EHXA 1I76A 3L0VA 1JJ9A 1PWUA 1CGEA 3ZUKA 3HYGA 1IAEA 2OW9A 2Z2DA 2YB9A 3WV2A 2SRTA 3G5CA 4GR0A 4PKVA 1A86A 3RTSA 4WKIA 2OW1A 3P1VA 2OXWA 4PKUA 3WV1A 3OHLA 4GWNA 2CLTA 4WZVA 2ERQA 3KRYA 4H3XA 1JKYA 2QPJA 1WNIA 1UTZA 3F17A 1GE7A 3AIGA 5I0LA 2DW1A 1GXDA 2OVZA 830CA 3BA0A 2DW2A 1BIWA 4PKQA 1D8MA 1XUDA 2FV5A 2L0RA 3TSKA 5JMYA 4FXYP 1HFCA 1R1IA 1QIBA 4GQLA 2MZIA 2JIHA 1BKCE 2W13A 3KMEA 3NX7A 3VTGA 1GE6A 1GO8P 3HY9A 3KWVC 2K9CA 966CA 4H82A 2E2DA 1B3DA 1BZSA 1DMTA 3LEAA 4GWMA 3O64A 1C3IA 2O3EA 2OVXA 1G9KA 3GBOA 1FLSA 1IAGA 1XUCA 3TT4A 2E3XA 2DW0A 5B5OA 5H8XA 1G4KA 2JNPA 2D1NA 1YP1A 1DTHA 1XFXA 4I03A 4A3WA 5B5PA 1QJIA 4PKWA 5CUHA 3EHYA 2J0TA 456CA 4XM7A 3OHOA 4JQGA 1USNA 1XFYA 2OW2A 1D7XA 4H84A 1MMBA 3KHIA 2OW0A 2X3CA 1ZS0A 2RJQA 2EROA 3ZVSA 4JIJA 4DF9A 4WK7A 2MZEA 1SU3A 2A8HA 3F18A 2J83A 1ZXVA 1ZP5A 3LKAA 2JT6A 3KMCA 1JAPA 2DDFA 4J4MA 3F15A 1OM6A 3LE9A 4IJOA 1O0TA 3DPFA 4HX3A 2W12A 1C7KA 2V4BA 4GR3A 3LK8A 1YQYA 3P24A 3I7IA 3KECA 5LABA 3L0TA 4AIGA 2K2GA 2AIGP 1PWVA 1OM7A 4FVLA 1XFZA 1KBCA 3LQBA 1IADA 1HOVA 4R3VA 3HB2P 4DD8A 1XURA 1MNCA 1BKCA 4Q1LA 1QICA 1UMTA 3B2ZA 1CQRA 2OI0A 2X7MA 4XCTA 1OS9A 3ZXHA 5I4OA 1QUAA 2HU6A 2MLRA 1OMJA 1MMPA 2AYKA 1SATA 4L6TA 1ND1A 4JA1A 2ERPA 4ZR5A 2PJTA 3K7NA 1SLMA 1Q3AA 2FV9A 3RTTA 4I35A 1BUVM 1R1JA 5L79A 2OXUA 4CTHA 1C8TA 1ZTQA 3B8ZA 1BQOA 1CAQA 1FM1A 1J7NA 1XFVA 1A85A 2OZRA 3HDBA 4QKZA 1JANA 1EUBA 3Q2HA 5BPAA 2X3BA 2WO8A 1JH1A 3HDAP 1R54A 4DV8A 5I3MA 3LIRA 4PKTA 3B92A 1GE5A 3TVCA 2Y6CA 1R55A 1BM6A 1MMRA 1G49A 1GKDA 3EDHA 4EFSA 2O36A 3LIKA 2JT5A 1PWPA 5BOYA 2WO9A 4ILWD 1ASTA 2CKIA 4H1QA 1AYKA 3KEJA 3E8RA 3G42A 3DSLA 1GKCA 2X3AA 4WF6A 2MLSA 1BQQM 1KUIA 1SMPA 1OM8A 3USNA 2N8RA 5D1SA 4G9LA 3SHIA 4A7BA 4GR8A 5D2BA 1ZXCA 3U1RA 2D1OA 2OXZA 1BUDA 3LUMA 1Y8JA 3EDZA 2MZHA 3EWJA 3F19A 1R1HA 3MA2A 5D7WA 3DNGA 5CXAA 1I1IP 4PKSA 1CGFA 4G0DA 1SLNA 1PWQA 4H76A 2OY2A 1YOUA 2W0DA 2XS4A 4AYKA 4AXQA 1GO7P 1K7QA 4JPAA 4JP4A 1Y0VA 5I2ZA 3LQ0A 1XFUA 2YIGA 1JIZA 1ZVXA 1D5JA 1BKCI 1CXVA 5CZMA 1K7GA 2Y6DA 4GF1A 3F16A 3TS4A 1KUGA 1ATLA 3F1AA 4AUOA 1AKLA 1UMSA 1JK3A 3LMCA 1Z3JA 3KEKA 4FU4A 4PKRA 2TCLA 4XM6A 1MMQA 3Q2GA 5D1UA 4IUWA 1UEAA 3DWBA 1JIWP 1KUFA 2OY4A 2JSDA 3K7LA 3LILA 1IAAA 1RMZA 3WV3A 1EAKA 3AYUA 3LJZA 1HTDA 1AF0A 2DDYA 5I12A 2KRJA 1EB6A 1G12A 1O0QA 1YCMA 1Y93A 1FBLA 3LGPA 1I73A 2I47A 3EDGA 3EDIA 4L63A 1B8YA 1UTTA 5BOTA 1HY7A 1L6JA 4L19A 4ON1A 3N2UA 3DPEA 4WKEA 4H49A 1CIZA 4XM8A 1D8FA 2W14A 4IN9A 1JAQA 2USNA 1H71P 2POJA 3LJGA 4GUYA 3LUNA 2RJPA 1OO9A 5D1TA 1K7IA 5L7FA 2XS3A 3N2VA 4HMAA 1S4BP 1HFSA 1RM8A 3UVCA 1OS2A 4FXQA 3DL1A 1KUKA 3HY7A 3CKIA 1IACA 2W15A 3AYKA 1CGLA 4DPEA 1PWWA 1XFWA 3O2XA 3VI1A 1HV5A 3ELMA
chains in the Genus database with same CATH superfamily
1BSWA 3HBUP 1CK7A 1ROSA 1QIAA 1QJJA 1KUHA 1G05A 1IABA 1SRPA 4H30A 3V96B 5I43A 5D3CA 1KAPP 3HBVP 4H2EA 3I7GA 3LJTA 1JAOA 2WOAA 4XBHA 3EHXA 1I76A 3L0VA 1JJ9A 1PWUA 1CGEA 3ZUKA 3HYGA 1IAEA 2OW9A 2Z2DA 2YB9A 3WV2A 2SRTA 3G5CA 4GR0A 4PKVA 1A86A 3RTSA 4WKIA 2OW1A 3P1VA 2OXWA 4PKUA 3WV1A 3OHLA 4GWNA 2CLTA 4WZVA 2ERQA 3KRYA 4H3XA 1JKYA 2QPJA 1WNIA 1UTZA 3F17A 1GE7A 3AIGA 5I0LA 2DW1A 1GXDA 2OVZA 830CA 3BA0A 2DW2A 1BIWA 4PKQA 1D8MA 1XUDA 2FV5A 2L0RA 3TSKA 5JMYA 4FXYP 1HFCA 1R1IA 1QIBA 4GQLA 2MZIA 2JIHA 1BKCE 2W13A 3KMEA 3NX7A 3VTGA 1GE6A 1GO8P 3HY9A 3KWVC 2K9CA 966CA 4H82A 2E2DA 1B3DA 1BZSA 1DMTA 3LEAA 4GWMA 3O64A 1C3IA 2O3EA 2OVXA 1G9KA 3GBOA 1FLSA 1IAGA 1XUCA 3TT4A 2E3XA 2YUFA 2DW0A 5B5OA 5H8XA 1G4KA 2JNPA 1XAXA 2D1NA 1YP1A 1DTHA 1XFXA 4I03A 4A3WA 5B5PA 1QJIA 4PKWA 5CUHA 3EHYA 2J0TA 456CA 4XM7A 3OHOA 4JQGA 1USNA 1XFYA 2OW2A 1D7XA 4H84A 1MMBA 3KHIA 2OW0A 2X3CA 1ZS0A 2RJQA 2EROA 3ZVSA 4JIJA 4DF9A 4WK7A 2MZEA 1SU3A 2A8HA 3F18A 2J83A 1ZXVA 1ZP5A 3LKAA 2JT6A 3KMCA 1JAPA 2DDFA 4J4MA 3F15A 1OM6A 3LE9A 4IJOA 1O0TA 3DPFA 4HX3A 2W12A 1C7KA 2V4BA 4GR3A 3LK8A 1YQYA 3P24A 3I7IA 3KECA 5LABA 3L0TA 4AIGA 2K2GA 2AIGP 1PWVA 1OM7A 4FVLA 1XFZA 1KBCA 3LQBA 1IADA 1HOVA 4R3VA 3HB2P 4DD8A 1XURA 1MNCA 1BKCA 4Q1LA 1QICA 1UMTA 3B2ZA 1CQRA 2OI0A 2X7MA 4XCTA 1OS9A 3ZXHA 3DTEA 5I4OA 1QUAA 2HU6A 2MLRA 1OMJA 1MMPA 2AYKA 1SATA 4L6TA 1ND1A 4JA1A 2ERPA 4ZR5A 2PJTA 3K7NA 1SLMA 1Q3AA 2FV9A 3RTTA 4I35A 1BUVM 1R1JA 5L79A 2OXUA 4CTHA 1C8TA 1ZTQA 3B8ZA 1BQOA 1CAQA 1FM1A 1J7NA 1XFVA 1A85A 2OZRA 3HDBA 4QKZA 1JANA 4L7AA 1EUBA 3Q2HA 5BPAA 2X3BA 2WO8A 1JH1A 3HDAP 1R54A 4DV8A 5I3MA 3LIRA 4PKTA 3B92A 1GE5A 3TVCA 2Y6CA 1R55A 1BM6A 1MMRA 1G49A 1GKDA 3EDHA 4EFSA 2O36A 3LIKA 2JT5A 1PWPA 5BOYA 2WO9A 4ILWD 1ASTA 2CKIA 4H1QA 1AYKA 3KEJA 3E8RA 3G42A 3DSLA 1GKCA 2X3AA 4WF6A 2MLSA 1BQQM 1KUIA 1SMPA 1OM8A 3USNA 2N8RA 5D1SA 4G9LA 3SHIA 4A7BA 1OZ9A 4GR8A 5D2BA 1ZXCA 3U1RA 2D1OA 2OXZA 1BUDA 3LUMA 1Y8JA 3DTIA 3EDZA 2MZHA 3EWJA 3F19A 1R1HA 3MA2A 5D7WA 3DNGA 5CXAA 1I1IP 4PKSA 1CGFA 4G0DA 1SLNA 1PWQA 4H76A 2OY2A 1YOUA 2W0DA 2XS4A 4AYKA 4AXQA 1GO7P 1K7QA 4JPAA 4JP4A 1Y0VA 5I2ZA 3LQ0A 1XFUA 2YIGA 1JIZA 1ZVXA 3DTKA 1D5JA 1BKCI 1CXVA 5CZMA 1K7GA 2Y6DA 4GF1A 3F16A 3TS4A 1KUGA 1ATLA 3F1AA 4AUOA 1AKLA 1UMSA 1JK3A 3LMCA 1Z3JA 3KEKA 4FU4A 4PKRA 2TCLA 4XM6A 1MMQA 3Q2GA 5D1UA 4IUWA 1UEAA 3DWBA 1JIWP 1KUFA 2OY4A 2JSDA 3K7LA 3LILA 1IAAA 1RMZA 3WV3A 1EAKA 3AYUA 3LJZA 1HTDA 1AF0A 2DDYA 5I12A 2KRJA 1EB6A 1G12A 1O0QA 1YCMA 1Y93A 1FBLA 3LGPA 1I73A 2I47A 3EDGA 3EDIA 4L63A 1B8YA 1UTTA 5BOTA 1HY7A 1L6JA 4L19A 4ON1A 3N2UA 3DPEA 4WKEA 4H49A 1CIZA 4XM8A 1D8FA 2W14A 4IN9A 1JAQA 2USNA 1H71P 2POJA 1XM5A 3LJGA 4GUYA 3LUNA 2RJPA 1OO9A 5D1TA 1TVIA 1K7IA 5L7FA 2XS3A 3N2VA 4HMAA 1S4BP 1HFSA 1RM8A 3UVCA 1OS2A 4FXQA 3DL1A 1KUKA 3HY7A 3CKIA 1IACA 2W15A 3AYKA 1CGLA 4DPEA 1PWWA 1XFWA 3O2XA 3VI1A 1HV5A 3ELMA
chains in the Genus database with same CATH topology
1BSWA 3HBUP 1CK7A 1ROSA 1QIAA 1QJJA 1KUHA 1G05A 1IABA 1SRPA 4H30A 3V96B 5I43A 5D3CA 1KAPP 3HBVP 4H2EA 3I7GA 3LJTA 1JAOA 2WOAA 4XBHA 3EHXA 1I76A 3L0VA 1JJ9A 1PWUA 1CGEA 3ZUKA 3HYGA 1IAEA 2OW9A 2Z2DA 2YB9A 3WV2A 2SRTA 3G5CA 4GR0A 4PKVA 1A86A 3RTSA 4WKIA 2OW1A 3P1VA 2OXWA 4PKUA 3WV1A 3OHLA 4GWNA 2CLTA 4WZVA 2ERQA 3KRYA 4H3XA 1JKYA 2QPJA 1WNIA 1UTZA 3F17A 1GE7A 3AIGA 5I0LA 2DW1A 1GXDA 2OVZA 830CA 3BA0A 2DW2A 1BIWA 4PKQA 1D8MA 1XUDA 2FV5A 2L0RA 3TSKA 5JMYA 4FXYP 1HFCA 1R1IA 1QIBA 4GQLA 2MZIA 2JIHA 1BKCE 2W13A 3KMEA 3NX7A 3VTGA 1GE6A 1GO8P 3HY9A 3KWVC 2K9CA 966CA 4H82A 2E2DA 1B3DA 1BZSA 1DMTA 3LEAA 4GWMA 3O64A 1C3IA 2O3EA 2OVXA 1G9KA 3GBOA 1FLSA 1IAGA 1XUCA 3TT4A 2E3XA 2YUFA 2DW0A 5B5OA 5H8XA 1G4KA 2JNPA 2D1NA 1YP1A 1DTHA 1XFXA 4I03A 4A3WA 5B5PA 1QJIA 4PKWA 5CUHA 3EHYA 2J0TA 456CA 4XM7A 3OHOA 4JQGA 1USNA 1XFYA 2OW2A 1D7XA 4H84A 1MMBA 3KHIA 2OW0A 2X3CA 1ZS0A 2RJQA 2EROA 3ZVSA 4JIJA 4DF9A 4WK7A 2MZEA 1SU3A 2A8HA 3F18A 2J83A 1ZXVA 1ZP5A 3LKAA 2JT6A 3KMCA 1JAPA 2DDFA 4J4MA 3F15A 1OM6A 3LE9A 4IJOA 1O0TA 3DPFA 4HX3A 2W12A 1C7KA 2V4BA 4GR3A 3LK8A 1YQYA 3P24A 3I7IA 3KECA 5LABA 3L0TA 4AIGA 2K2GA 2AIGP 1PWVA 1OM7A 4FVLA 1XFZA 1KBCA 3LQBA 1IADA 1HOVA 4R3VA 3HB2P 4DD8A 1XURA 1MNCA 1BKCA 4Q1LA 1QICA 1UMTA 3B2ZA 1CQRA 2OI0A 2X7MA 4XCTA 1OS9A 3ZXHA 3DTEA 5I4OA 1QUAA 2HU6A 2MLRA 1OMJA 1MMPA 2AYKA 1SATA 4L6TA 1ND1A 4JA1A 2ERPA 4ZR5A 2PJTA 3K7NA 1SLMA 1Q3AA 2FV9A 3RTTA 4I35A 1BUVM 1R1JA 5L79A 2OXUA 4CTHA 1C8TA 1ZTQA 3B8ZA 1BQOA 1CAQA 1FM1A 1J7NA 1XFVA 1A85A 2OZRA 3HDBA 4QKZA 1JANA 4L7AA 1EUBA 3Q2HA 5BPAA 2X3BA 2WO8A 1JH1A 3HDAP 1R54A 4DV8A 5I3MA 3LIRA 4PKTA 3B92A 1GE5A 3TVCA 2Y6CA 1R55A 1BM6A 1MMRA 1G49A 1GKDA 3EDHA 4EFSA 2O36A 3LIKA 2JT5A 1PWPA 5BOYA 2WO9A 4ILWD 1ASTA 2CKIA 4H1QA 1AYKA 3KEJA 3E8RA 3G42A 3DSLA 1GKCA 2X3AA 4WF6A 2MLSA 1BQQM 1KUIA 1SMPA 1OM8A 3USNA 2N8RA 5D1SA 4G9LA 3SHIA 4A7BA 4GR8A 5D2BA 1ZXCA 3U1RA 2D1OA 2OXZA 1BUDA 3LUMA 1Y8JA 3DTIA 3EDZA 2MZHA 3EWJA 3F19A 1R1HA 3MA2A 5D7WA 3DNGA 5CXAA 1I1IP 4PKSA 1CGFA 4G0DA 1SLNA 1PWQA 4H76A 2OY2A 1YOUA 2W0DA 2XS4A 4AYKA 4AXQA 1GO7P 1K7QA 4JPAA 4JP4A 1Y0VA 5I2ZA 3LQ0A 1XFUA 2YIGA 1JIZA 1ZVXA 3DTKA 1D5JA 1BKCI 1CXVA 5CZMA 1K7GA 2Y6DA 4GF1A 3F16A 3TS4A 1KUGA 1ATLA 3F1AA 4AUOA 1AKLA 1UMSA 1JK3A 3LMCA 1Z3JA 3KEKA 4FU4A 4PKRA 2TCLA 4XM6A 1MMQA 3Q2GA 5D1UA 4IUWA 1UEAA 3DWBA 1JIWP 1KUFA 2OY4A 2JSDA 3K7LA 3LILA 1IAAA 1RMZA 3WV3A 1EAKA 3AYUA 3LJZA 1HTDA 1AF0A 2DDYA 5I12A 2KRJA 1EB6A 1G12A 1O0QA 1YCMA 1Y93A 1FBLA 3LGPA 1I73A 2I47A 3EDGA 3EDIA 4L63A 1B8YA 1UTTA 5BOTA 1HY7A 1L6JA 4L19A 4ON1A 3N2UA 3DPEA 4WKEA 4H49A 1CIZA 4XM8A 1D8FA 2W14A 4IN9A 1JAQA 2USNA 1H71P 2POJA 3LJGA 4GUYA 3LUNA 2RJPA 1OO9A 5D1TA 1K7IA 5L7FA 2XS3A 3N2VA 4HMAA 1S4BP 1HFSA 1RM8A 3UVCA 1OS2A 4FXQA 3DL1A 1KUKA 3HY7A 3CKIA 1IACA 2W15A 3AYKA 1CGLA 4DPEA 1PWWA 1XFWA 3O2XA 3VI1A 1HV5A 3ELMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSW A;  3HBU P;  1CK7 A;  1ROS A;  1QIA A;  1QJJ A;  1KUH A;  1G05 A;  1IAB A;  1SRP A;  4H30 A;  3V96 B;  5I43 A;  5D3C A;  1KAP P;  3HBV P;  4H2E A;  3I7G A;  3LJT A;  1JAO A;  2WOA A;  4XBH A;  3EHX A;  1I76 A;  3L0V A;  1JJ9 A;  1PWU A;  1CGE A;  3ZUK A;  3HYG A;  1IAE A;  2OW9 A;  2Z2D A;  2YB9 A;  3WV2 A;  2SRT A;  3G5C A;  4GR0 A;  4PKV A;  1A86 A;  3RTS A;  4WKI A;  2OW1 A;  3P1V A;  2OXW A;  4PKU A;  3WV1 A;  3OHL A;  4GWN A;  2CLT A;  4WZV A;  2ERQ A;  3KRY A;  4H3X A;  1JKY A;  2QPJ A;  1WNI A;  1UTZ A;  3F17 A;  1GE7 A;  3AIG A;  5I0L A;  2DW1 A;  1GXD A;  2OVZ A;  830C A;  3BA0 A;  2DW2 A;  1BIW A;  4PKQ A;  1D8M A;  1XUD A;  2FV5 A;  2L0R A;  3TSK A;  5JMY A;  4FXY P;  1HFC A;  1R1I A;  1QIB A;  4GQL A;  2MZI A;  2JIH A;  1BKC E;  2W13 A;  3KME A;  3NX7 A;  3VTG A;  1GE6 A;  1GO8 P;  3HY9 A;  3KWV C;  2K9C A;  966C A;  4H82 A;  2E2D A;  1B3D A;  1BZS A;  1DMT A;  3LEA A;  4GWM A;  3O64 A;  1C3I A;  2O3E A;  2OVX A;  1G9K A;  3GBO A;  1FLS A;  1IAG A;  1XUC A;  3TT4 A;  2E3X A;  2DW0 A;  5B5O A;  5H8X A;  1G4K A;  2JNP A;  2D1N A;  1YP1 A;  1DTH A;  1XFX A;  4I03 A;  4A3W A;  5B5P A;  1QJI A;  4PKW A;  5CUH A;  3EHY A;  2J0T A;  456C A;  4XM7 A;  3OHO A;  4JQG A;  1USN A;  1XFY A;  2OW2 A;  1D7X A;  4H84 A;  1MMB A;  3KHI A;  2OW0 A;  2X3C A;  1ZS0 A;  2RJQ A;  2ERO A;  3ZVS A;  4JIJ A;  4DF9 A;  4WK7 A;  2MZE A;  1SU3 A;  2A8H A;  3F18 A;  2J83 A;  1ZXV A;  1ZP5 A;  3LKA A;  2JT6 A;  3KMC A;  1JAP A;  2DDF A;  4J4M A;  3F15 A;  1OM6 A;  3LE9 A;  4IJO A;  1O0T A;  3DPF A;  4HX3 A;  2W12 A;  1C7K A;  2V4B A;  4GR3 A;  3LK8 A;  1YQY A;  3P24 A;  3I7I A;  3KEC A;  5LAB A;  3L0T A;  4AIG A;  2K2G A;  2AIG P;  1PWV A;  1OM7 A;  4FVL A;  1XFZ A;  1KBC A;  3LQB A;  1IAD A;  1HOV A;  4R3V A;  3HB2 P;  4DD8 A;  1XUR A;  1MNC A;  1BKC A;  4Q1L A;  1QIC A;  1UMT A;  3B2Z A;  1CQR A;  2OI0 A;  2X7M A;  4XCT A;  1OS9 A;  3ZXH A;  5I4O A;  1QUA A;  2HU6 A;  2MLR A;  1OMJ A;  1MMP A;  2AYK A;  1SAT A;  4L6T A;  1ND1 A;  4JA1 A;  2ERP A;  4ZR5 A;  2PJT A;  3K7N A;  1SLM A;  1Q3A A;  2FV9 A;  3RTT A;  4I35 A;  1BUV M;  1R1J A;  5L79 A;  2OXU A;  4CTH A;  1C8T A;  1ZTQ A;  3B8Z A;  1BQO A;  1CAQ A;  1FM1 A;  1J7N A;  1XFV A;  1A85 A;  2OZR A;  3HDB A;  4QKZ A;  1JAN A;  1EUB A;  3Q2H A;  5BPA A;  2X3B A;  2WO8 A;  1JH1 A;  3HDA P;  1R54 A;  4DV8 A;  5I3M A;  3LIR A;  4PKT A;  3B92 A;  1GE5 A;  3TVC A;  2Y6C A;  1R55 A;  1BM6 A;  1MMR A;  1G49 A;  1GKD A;  3EDH A;  4EFS A;  2O36 A;  3LIK A;  2JT5 A;  1PWP A;  5BOY A;  2WO9 A;  4ILW D;  1AST A;  2CKI A;  4H1Q A;  1AYK A;  3KEJ A;  3E8R A;  3G42 A;  3DSL A;  1GKC A;  2X3A A;  4WF6 A;  2MLS A;  1BQQ M;  1KUI A;  1SMP A;  1OM8 A;  3USN A;  2N8R A;  5D1S A;  4G9L A;  3SHI A;  4A7B A;  4GR8 A;  5D2B A;  1ZXC A;  3U1R A;  2D1O A;  2OXZ A;  1BUD A;  3LUM A;  1Y8J A;  3EDZ A;  2MZH A;  3EWJ A;  3F19 A;  1R1H A;  3MA2 A;  5D7W A;  3DNG A;  5CXA A;  1I1I P;  4PKS A;  1CGF A;  4G0D A;  1SLN A;  1PWQ A;  4H76 A;  2OY2 A;  1YOU A;  2W0D A;  2XS4 A;  4AYK A;  4AXQ A;  1GO7 P;  1K7Q A;  4JPA A;  4JP4 A;  1Y0V A;  5I2Z A;  3LQ0 A;  1XFU A;  2YIG A;  1JIZ A;  1ZVX A;  1D5J A;  1BKC I;  1CXV A;  5CZM A;  1K7G A;  2Y6D A;  4GF1 A;  3F16 A;  3TS4 A;  1KUG A;  1ATL A;  3F1A A;  4AUO A;  1AKL A;  1UMS A;  1JK3 A;  3LMC A;  1Z3J A;  3KEK A;  4FU4 A;  4PKR A;  2TCL A;  4XM6 A;  1MMQ A;  3Q2G A;  5D1U A;  4IUW A;  1UEA A;  3DWB A;  1JIW P;  1KUF A;  2OY4 A;  2JSD A;  3K7L A;  3LIL A;  1IAA A;  1RMZ A;  3WV3 A;  1EAK A;  3AYU A;  3LJZ A;  1HTD A;  1AF0 A;  2DDY A;  5I12 A;  2KRJ A;  1EB6 A;  1G12 A;  1O0Q A;  1YCM A;  1Y93 A;  1FBL A;  3LGP A;  1I73 A;  2I47 A;  3EDG A;  3EDI A;  4L63 A;  1B8Y A;  1UTT A;  5BOT A;  1HY7 A;  1L6J A;  4L19 A;  4ON1 A;  3N2U A;  3DPE A;  4WKE A;  4H49 A;  1CIZ A;  4XM8 A;  1D8F A;  2W14 A;  4IN9 A;  1JAQ A;  2USN A;  1H71 P;  2POJ A;  3LJG A;  4GUY A;  3LUN A;  2RJP A;  1OO9 A;  5D1T A;  1K7I A;  5L7F A;  2XS3 A;  3N2V A;  4HMA A;  1S4B P;  1HFS A;  1RM8 A;  3UVC A;  1OS2 A;  4FXQ A;  3DL1 A;  1KUK A;  3HY7 A;  3CKI A;  1IAC A;  2W15 A;  3AYK A;  1CGL A;  4DPE A;  1PWW A;  1XFW A;  3O2X A;  3VI1 A;  1HV5 A;  3ELM A; 
#chains in the Genus database with same CATH topology
 1BSW A;  3HBU P;  1CK7 A;  1ROS A;  1QIA A;  1QJJ A;  1KUH A;  1G05 A;  1IAB A;  1SRP A;  4H30 A;  3V96 B;  5I43 A;  5D3C A;  1KAP P;  3HBV P;  4H2E A;  3I7G A;  3LJT A;  1JAO A;  2WOA A;  4XBH A;  3EHX A;  1I76 A;  3L0V A;  1JJ9 A;  1PWU A;  1CGE A;  3ZUK A;  3HYG A;  1IAE A;  2OW9 A;  2Z2D A;  2YB9 A;  3WV2 A;  2SRT A;  3G5C A;  4GR0 A;  4PKV A;  1A86 A;  3RTS A;  4WKI A;  2OW1 A;  3P1V A;  2OXW A;  4PKU A;  3WV1 A;  3OHL A;  4GWN A;  2CLT A;  4WZV A;  2ERQ A;  3KRY A;  4H3X A;  1JKY A;  2QPJ A;  1WNI A;  1UTZ A;  3F17 A;  1GE7 A;  3AIG A;  5I0L A;  2DW1 A;  1GXD A;  2OVZ A;  830C A;  3BA0 A;  2DW2 A;  1BIW A;  4PKQ A;  1D8M A;  1XUD A;  2FV5 A;  2L0R A;  3TSK A;  5JMY A;  4FXY P;  1HFC A;  1R1I A;  1QIB A;  4GQL A;  2MZI A;  2JIH A;  1BKC E;  2W13 A;  3KME A;  3NX7 A;  3VTG A;  1GE6 A;  1GO8 P;  3HY9 A;  3KWV C;  2K9C A;  966C A;  4H82 A;  2E2D A;  1B3D A;  1BZS A;  1DMT A;  3LEA A;  4GWM A;  3O64 A;  1C3I A;  2O3E A;  2OVX A;  1G9K A;  3GBO A;  1FLS A;  1IAG A;  1XUC A;  3TT4 A;  2E3X A;  2YUF A;  2DW0 A;  5B5O A;  5H8X A;  1G4K A;  2JNP A;  1XAX A;  2D1N A;  1YP1 A;  1DTH A;  1XFX A;  4I03 A;  4A3W A;  5B5P A;  1QJI A;  4PKW A;  5CUH A;  3EHY A;  2J0T A;  456C A;  4XM7 A;  3OHO A;  4JQG A;  1USN A;  1XFY A;  2OW2 A;  1D7X A;  4H84 A;  1MMB A;  3KHI A;  2OW0 A;  2X3C A;  1ZS0 A;  2RJQ A;  2ERO A;  3ZVS A;  4JIJ A;  4DF9 A;  4WK7 A;  2MZE A;  1SU3 A;  2A8H A;  3F18 A;  2J83 A;  1ZXV A;  1ZP5 A;  3LKA A;  2JT6 A;  3KMC A;  1JAP A;  2DDF A;  4J4M A;  3F15 A;  1OM6 A;  3LE9 A;  4IJO A;  1O0T A;  3DPF A;  4HX3 A;  2W12 A;  1C7K A;  2V4B A;  4GR3 A;  3LK8 A;  1YQY A;  3P24 A;  3I7I A;  3KEC A;  5LAB A;  3L0T A;  4AIG A;  2K2G A;  2AIG P;  1PWV A;  1OM7 A;  4FVL A;  1XFZ A;  1KBC A;  3LQB A;  1IAD A;  1HOV A;  4R3V A;  3HB2 P;  4DD8 A;  1XUR A;  1MNC A;  1BKC A;  4Q1L A;  1QIC A;  1UMT A;  3B2Z A;  1CQR A;  2OI0 A;  2X7M A;  4XCT A;  1OS9 A;  3ZXH A;  3DTE A;  5I4O A;  1QUA A;  2HU6 A;  2MLR A;  1OMJ A;  1MMP A;  2AYK A;  1SAT A;  4L6T A;  1ND1 A;  4JA1 A;  2ERP A;  4ZR5 A;  2PJT A;  3K7N A;  1SLM A;  1Q3A A;  2FV9 A;  3RTT A;  4I35 A;  1BUV M;  1R1J A;  5L79 A;  2OXU A;  4CTH A;  1C8T A;  1ZTQ A;  3B8Z A;  1BQO A;  1CAQ A;  1FM1 A;  1J7N A;  1XFV A;  1A85 A;  2OZR A;  3HDB A;  4QKZ A;  1JAN A;  4L7A A;  1EUB A;  3Q2H A;  5BPA A;  2X3B A;  2WO8 A;  1JH1 A;  3HDA P;  1R54 A;  4DV8 A;  5I3M A;  3LIR A;  4PKT A;  3B92 A;  1GE5 A;  3TVC A;  2Y6C A;  1R55 A;  1BM6 A;  1MMR A;  1G49 A;  1GKD A;  3EDH A;  4EFS A;  2O36 A;  3LIK A;  2JT5 A;  1PWP A;  5BOY A;  2WO9 A;  4ILW D;  1AST A;  2CKI A;  4H1Q A;  1AYK A;  3KEJ A;  3E8R A;  3G42 A;  3DSL A;  1GKC A;  2X3A A;  4WF6 A;  2MLS A;  1BQQ M;  1KUI A;  1SMP A;  1OM8 A;  3USN A;  2N8R A;  5D1S A;  4G9L A;  3SHI A;  4A7B A;  1OZ9 A;  4GR8 A;  5D2B A;  1ZXC A;  3U1R A;  2D1O A;  2OXZ A;  1BUD A;  3LUM A;  1Y8J A;  3DTI A;  3EDZ A;  2MZH A;  3EWJ A;  3F19 A;  1R1H A;  3MA2 A;  5D7W A;  3DNG A;  5CXA A;  1I1I P;  4PKS A;  1CGF A;  4G0D A;  1SLN A;  1PWQ A;  4H76 A;  2OY2 A;  1YOU A;  2W0D A;  2XS4 A;  4AYK A;  4AXQ A;  1GO7 P;  1K7Q A;  4JPA A;  4JP4 A;  1Y0V A;  5I2Z A;  3LQ0 A;  1XFU A;  2YIG A;  1JIZ A;  1ZVX A;  3DTK A;  1D5J A;  1BKC I;  1CXV A;  5CZM A;  1K7G A;  2Y6D A;  4GF1 A;  3F16 A;  3TS4 A;  1KUG A;  1ATL A;  3F1A A;  4AUO A;  1AKL A;  1UMS A;  1JK3 A;  3LMC A;  1Z3J A;  3KEK A;  4FU4 A;  4PKR A;  2TCL A;  4XM6 A;  1MMQ A;  3Q2G A;  5D1U A;  4IUW A;  1UEA A;  3DWB A;  1JIW P;  1KUF A;  2OY4 A;  2JSD A;  3K7L A;  3LIL A;  1IAA A;  1RMZ A;  3WV3 A;  1EAK A;  3AYU A;  3LJZ A;  1HTD A;  1AF0 A;  2DDY A;  5I12 A;  2KRJ A;  1EB6 A;  1G12 A;  1O0Q A;  1YCM A;  1Y93 A;  1FBL A;  3LGP A;  1I73 A;  2I47 A;  3EDG A;  3EDI A;  4L63 A;  1B8Y A;  1UTT A;  5BOT A;  1HY7 A;  1L6J A;  4L19 A;  4ON1 A;  3N2U A;  3DPE A;  4WKE A;  4H49 A;  1CIZ A;  4XM8 A;  1D8F A;  2W14 A;  4IN9 A;  1JAQ A;  2USN A;  1H71 P;  2POJ A;  1XM5 A;  3LJG A;  4GUY A;  3LUN A;  2RJP A;  1OO9 A;  5D1T A;  1TVI A;  1K7I A;  5L7F A;  2XS3 A;  3N2V A;  4HMA A;  1S4B P;  1HFS A;  1RM8 A;  3UVC A;  1OS2 A;  4FXQ A;  3DL1 A;  1KUK A;  3HY7 A;  3CKI A;  1IAC A;  2W15 A;  3AYK A;  1CGL A;  4DPE A;  1PWW A;  1XFW A;  3O2X A;  3VI1 A;  1HV5 A;  3ELM A; 
#chains in the Genus database with same CATH homology
 1BSW A;  3HBU P;  1CK7 A;  1ROS A;  1QIA A;  1QJJ A;  1KUH A;  1G05 A;  1IAB A;  1SRP A;  4H30 A;  3V96 B;  5I43 A;  5D3C A;  1KAP P;  3HBV P;  4H2E A;  3I7G A;  3LJT A;  1JAO A;  2WOA A;  4XBH A;  3EHX A;  1I76 A;  3L0V A;  1JJ9 A;  1PWU A;  1CGE A;  3ZUK A;  3HYG A;  1IAE A;  2OW9 A;  2Z2D A;  2YB9 A;  3WV2 A;  2SRT A;  3G5C A;  4GR0 A;  4PKV A;  1A86 A;  3RTS A;  4WKI A;  2OW1 A;  3P1V A;  2OXW A;  4PKU A;  3WV1 A;  3OHL A;  4GWN A;  2CLT A;  4WZV A;  2ERQ A;  3KRY A;  4H3X A;  1JKY A;  2QPJ A;  1WNI A;  1UTZ A;  3F17 A;  1GE7 A;  3AIG A;  5I0L A;  2DW1 A;  1GXD A;  2OVZ A;  830C A;  3BA0 A;  2DW2 A;  1BIW A;  4PKQ A;  1D8M A;  1XUD A;  2FV5 A;  2L0R A;  3TSK A;  5JMY A;  4FXY P;  1HFC A;  1R1I A;  1QIB A;  4GQL A;  2MZI A;  2JIH A;  1BKC E;  2W13 A;  3KME A;  3NX7 A;  3VTG A;  1GE6 A;  1GO8 P;  3HY9 A;  3KWV C;  2K9C A;  966C A;  4H82 A;  2E2D A;  1B3D A;  1BZS A;  1DMT A;  3LEA A;  4GWM A;  3O64 A;  1C3I A;  2O3E A;  2OVX A;  1G9K A;  3GBO A;  1FLS A;  1IAG A;  1XUC A;  3TT4 A;  2E3X A;  2YUF A;  2DW0 A;  5B5O A;  5H8X A;  1G4K A;  2JNP A;  2D1N A;  1YP1 A;  1DTH A;  1XFX A;  4I03 A;  4A3W A;  5B5P A;  1QJI A;  4PKW A;  5CUH A;  3EHY A;  2J0T A;  456C A;  4XM7 A;  3OHO A;  4JQG A;  1USN A;  1XFY A;  2OW2 A;  1D7X A;  4H84 A;  1MMB A;  3KHI A;  2OW0 A;  2X3C A;  1ZS0 A;  2RJQ A;  2ERO A;  3ZVS A;  4JIJ A;  4DF9 A;  4WK7 A;  2MZE A;  1SU3 A;  2A8H A;  3F18 A;  2J83 A;  1ZXV A;  1ZP5 A;  3LKA A;  2JT6 A;  3KMC A;  1JAP A;  2DDF A;  4J4M A;  3F15 A;  1OM6 A;  3LE9 A;  4IJO A;  1O0T A;  3DPF A;  4HX3 A;  2W12 A;  1C7K A;  2V4B A;  4GR3 A;  3LK8 A;  1YQY A;  3P24 A;  3I7I A;  3KEC A;  5LAB A;  3L0T A;  4AIG A;  2K2G A;  2AIG P;  1PWV A;  1OM7 A;  4FVL A;  1XFZ A;  1KBC A;  3LQB A;  1IAD A;  1HOV A;  4R3V A;  3HB2 P;  4DD8 A;  1XUR A;  1MNC A;  1BKC A;  4Q1L A;  1QIC A;  1UMT A;  3B2Z A;  1CQR A;  2OI0 A;  2X7M A;  4XCT A;  1OS9 A;  3ZXH A;  3DTE A;  5I4O A;  1QUA A;  2HU6 A;  2MLR A;  1OMJ A;  1MMP A;  2AYK A;  1SAT A;  4L6T A;  1ND1 A;  4JA1 A;  2ERP A;  4ZR5 A;  2PJT A;  3K7N A;  1SLM A;  1Q3A A;  2FV9 A;  3RTT A;  4I35 A;  1BUV M;  1R1J A;  5L79 A;  2OXU A;  4CTH A;  1C8T A;  1ZTQ A;  3B8Z A;  1BQO A;  1CAQ A;  1FM1 A;  1J7N A;  1XFV A;  1A85 A;  2OZR A;  3HDB A;  4QKZ A;  1JAN A;  4L7A A;  1EUB A;  3Q2H A;  5BPA A;  2X3B A;  2WO8 A;  1JH1 A;  3HDA P;  1R54 A;  4DV8 A;  5I3M A;  3LIR A;  4PKT A;  3B92 A;  1GE5 A;  3TVC A;  2Y6C A;  1R55 A;  1BM6 A;  1MMR A;  1G49 A;  1GKD A;  3EDH A;  4EFS A;  2O36 A;  3LIK A;  2JT5 A;  1PWP A;  5BOY A;  2WO9 A;  4ILW D;  1AST A;  2CKI A;  4H1Q A;  1AYK A;  3KEJ A;  3E8R A;  3G42 A;  3DSL A;  1GKC A;  2X3A A;  4WF6 A;  2MLS A;  1BQQ M;  1KUI A;  1SMP A;  1OM8 A;  3USN A;  2N8R A;  5D1S A;  4G9L A;  3SHI A;  4A7B A;  4GR8 A;  5D2B A;  1ZXC A;  3U1R A;  2D1O A;  2OXZ A;  1BUD A;  3LUM A;  1Y8J A;  3DTI A;  3EDZ A;  2MZH A;  3EWJ A;  3F19 A;  1R1H A;  3MA2 A;  5D7W A;  3DNG A;  5CXA A;  1I1I P;  4PKS A;  1CGF A;  4G0D A;  1SLN A;  1PWQ A;  4H76 A;  2OY2 A;  1YOU A;  2W0D A;  2XS4 A;  4AYK A;  4AXQ A;  1GO7 P;  1K7Q A;  4JPA A;  4JP4 A;  1Y0V A;  5I2Z A;  3LQ0 A;  1XFU A;  2YIG A;  1JIZ A;  1ZVX A;  3DTK A;  1D5J A;  1BKC I;  1CXV A;  5CZM A;  1K7G A;  2Y6D A;  4GF1 A;  3F16 A;  3TS4 A;  1KUG A;  1ATL A;  3F1A A;  4AUO A;  1AKL A;  1UMS A;  1JK3 A;  3LMC A;  1Z3J A;  3KEK A;  4FU4 A;  4PKR A;  2TCL A;  4XM6 A;  1MMQ A;  3Q2G A;  5D1U A;  4IUW A;  1UEA A;  3DWB A;  1JIW P;  1KUF A;  2OY4 A;  2JSD A;  3K7L A;  3LIL A;  1IAA A;  1RMZ A;  3WV3 A;  1EAK A;  3AYU A;  3LJZ A;  1HTD A;  1AF0 A;  2DDY A;  5I12 A;  2KRJ A;  1EB6 A;  1G12 A;  1O0Q A;  1YCM A;  1Y93 A;  1FBL A;  3LGP A;  1I73 A;  2I47 A;  3EDG A;  3EDI A;  4L63 A;  1B8Y A;  1UTT A;  5BOT A;  1HY7 A;  1L6J A;  4L19 A;  4ON1 A;  3N2U A;  3DPE A;  4WKE A;  4H49 A;  1CIZ A;  4XM8 A;  1D8F A;  2W14 A;  4IN9 A;  1JAQ A;  2USN A;  1H71 P;  2POJ A;  3LJG A;  4GUY A;  3LUN A;  2RJP A;  1OO9 A;  5D1T A;  1K7I A;  5L7F A;  2XS3 A;  3N2V A;  4HMA A;  1S4B P;  1HFS A;  1RM8 A;  3UVC A;  1OS2 A;  4FXQ A;  3DL1 A;  1KUK A;  3HY7 A;  3CKI A;  1IAC A;  2W15 A;  3AYK A;  1CGL A;  4DPE A;  1PWW A;  1XFW A;  3O2X A;  3VI1 A;  1HV5 A;  3ELM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...