1G49A

A carboxylic acid based inhibitor in complex with mmp3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
169
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of new hydroxamate matrix metalloproteinase inhibitors derived from functionalized 4-aminoprolines.
pubmed doi rcsb
molecule keywords MATRIX METALLOPROTEINASE 3
molecule tags Hydrolase
source organism Homo sapiens
total genus 44
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1g49A00
3EDIA 3ZUKA 1PWUA 4L6TA 2YB9A 4JQGA 1CGFA 3AIGA 4XBHA 1AF0A 1SLMA 3DSLA 1O0QA 3KWVC 1FBLA 3LUMA 1BZSA 1B3DA 1D7XA 3LK8A 4A7BA 1RMZA 2A8HA 3K7LA 1Y93A 4H49A 1GO7P 2J83A 1XFWA 5JMYA 4H2EA 1CIZA 4IN9A 4H82A 3CKIA 5I43A 3LJZA 5L7FA 1IAGA 5H8XA 1KAPP 4WKEA 1GE6A 2OXZA 3K7NA 1HTDA 1YCMA 2MLRA 1BQOA 1JK3A 1S4BP 1C3IA 1GE7A 1K7GA 2OVZA 1KBCA 1O0TA 4JA1A 4JPAA 2WO9A 4XM7A 2MZEA 2DDYA 1BQQM 3E8RA 2OY2A 1PWWA 4PKSA 2POJA 3F19A 5CUHA 3U1RA 3VTGA 2OW1A 2W13A 3EHYA 1GKCA 2OXUA 1UTTA 1Q3AA 830CA 1G05A 4FVLA 3KEJA 1IACA 1KUIA 2SRTA 3F17A 3LILA 3KMEA 2O3EA 2TCLA 4H30A 1SRPA 2AIGP 4FXYP 3RTTA 1PWVA 2Z2DA 3HB2P 4ILWD 1I1IP 2CLTA 3KRYA 4ZR5A 4AIGA 1YQYA 1QJJA 2D1NA 1HV5A 1I73A 1K7QA 2DW2A 3MA2A 3HYGA 3LMCA 1XFYA 1XURA 2E2DA 1G12A 4HX3A 5I12A 1SMPA 4PKVA 2OW0A 3VI1A 4GR0A 4I03A 4GR3A 3B92A 3HY7A 4FXQA 2CKIA 5I4OA 2OZRA 5I2ZA 3DL1A 3P24A 3GBOA 1BIWA 456CA 1ASTA 2HU6A 1HFCA 2OW9A 5I0LA 2MZIA 5B5OA 1EAKA 3LUNA 1GE5A 3L0VA 1OM7A 2Y6DA 2ERPA 4WF6A 4IJOA 1JANA 1CAQA 4H3XA 3P1VA 3AYKA 4WZVA 5D1TA 3NX7A 1OM8A 1KUFA 3DWBA 5BOTA 1ROSA 2X3CA 1RM8A 1XFXA 1BM6A 2Y6CA 2V4BA 4G9LA 3EDHA 1D8MA 3TSKA 5D2BA 4EFSA 1OS9A 3LQ0A 2X7MA 1DMTA 2AYKA 1R1JA 3DPEA 1L6JA 4IUWA 1BUDA 1QJIA 3DNGA 1KUKA 1JAPA 1GO8P 4L19A 5D3CA 1C8TA 1BUVM 5I3MA 1JKYA 4WKIA 2JT5A 1JH1A 4CTHA 2QPJA 1C7KA 1PWPA 2JIHA 2RJPA 2OXWA 3TVCA 4XCTA 1JAQA 2I47A 4AYKA 1I76A 3O2XA 5B5PA 1Y8JA 1HFSA 1JIZA 2DW1A 5D1UA 2JNPA 3LE9A 2XS3A 4DPEA 1YOUA 4WK7A 1BKCI 1QUAA 3AYUA 3F18A 1G4KA 4R3VA 2JSDA 2OVXA 2EROA 2XS4A 1XFVA 2X3AA 4FU4A 5CXAA 1BKCE 1J7NA 4J4MA 4L63A 1ZS0A 1CGLA 1UEAA 1FM1A 3B8ZA 3KMCA 3LIKA 2E3XA 5BOYA 2O36A 966CA 1QIAA 3KHIA 3G5CA 3LGPA 1SLNA 1IABA 2JT6A 4QKZA 4G0DA 1ATLA 2D1OA 3ELMA 1WNIA 4AXQA 2X3BA 1JJ9A 1CQRA 1D8FA 1XUDA 1HOVA 1IAEA 2OW2A 4GWMA 1BKCA 1JIWP 1R55A 2W14A 1QIBA 1MMQA 3KECA 1OMJA 5D7WA 1MMRA 2USNA 5LABA 3EHXA 3HDAP 1CXVA 1G9KA 1YP1A 1IADA 1R1HA 2YIGA 4JIJA 1EUBA 3Q2HA 1EB6A 3ZXHA 2DW0A 4I35A 4XM6A 2ERQA 1ZTQA 1R1IA 5L79A 3B2ZA 4XM8A 2W12A 4PKRA 5BPAA 3N2VA 3WV1A 1MMPA 3EDGA 1ZXVA 4AUOA 1ZP5A 1A86A 3LEAA 2K2GA 4GWNA 1PWQA 3F16A 1XUCA 3F15A 3N2UA 1DTHA 3LKAA 3TS4A 1USNA 4H1QA 4DF9A 1ND1A 1UMTA 2MZHA 4Q1LA 3G42A 4JP4A 1B8YA 2PJTA 4PKTA 2DDFA 3V96B 1OO9A 3LJGA 1AKLA 2K9CA 1OS2A 4ON1A 4GUYA 3DPFA 1KUGA 3HBVP 3OHLA 2W15A 4DV8A 3L0TA 4GR8A 3UVCA 2RJQA 3WV3A 4GQLA 1MNCA 3WV2A 3LQBA 5CZMA 1A85A 3KEKA 1ZVXA 1HY7A 3LIRA 1R54A 1K7IA 1MMBA 2OY4A 2FV9A 2L0RA 4A3WA 4DD8A 3EDZA 1GXDA 2W0DA 1XFUA 4PKUA 3HY9A 1Z3JA 5D1SA 1Y0VA 2N8RA 1SATA 3SHIA 3Q2GA 3OHOA 3LJTA 4H76A 3O64A 3HDBA 1FLSA 1D5JA 1IAAA 3I7GA 3TT4A 4HMAA 3I7IA 1CK7A 1ZXCA 1CGEA 2WO8A 1JAOA 1SU3A 1GKDA 3ZVSA 3USNA 1UTZA 1UMSA 2MLSA 3RTSA 2FV5A 3F1AA 1KUHA 1XFZA 3HBUP 1AYKA 1G49A 4PKQA 2J0TA 1QICA 3BA0A 1BSWA 3EWJA 4H84A 2WOAA 2KRJA 2OI0A 1OM6A 1H71P 4GF1A 4PKWA
chains in the Genus database with same CATH superfamily
3EDIA 3ZUKA 1PWUA 4L6TA 2YB9A 4JQGA 1CGFA 3AIGA 4XBHA 1AF0A 1SLMA 3DSLA 1O0QA 3KWVC 1FBLA 3LUMA 1BZSA 1B3DA 1D7XA 3LK8A 4A7BA 1RMZA 2A8HA 3K7LA 1Y93A 4H49A 1GO7P 2J83A 1XFWA 5JMYA 4H2EA 1CIZA 4IN9A 4H82A 3CKIA 5I43A 3LJZA 5L7FA 1IAGA 5H8XA 1KAPP 4WKEA 1GE6A 2OXZA 3DTIA 3K7NA 1HTDA 1YCMA 2MLRA 1BQOA 1JK3A 1S4BP 1C3IA 1GE7A 1K7GA 2OVZA 1KBCA 1O0TA 4JA1A 4JPAA 2WO9A 4XM7A 2MZEA 2DDYA 1BQQM 3E8RA 2OY2A 1PWWA 4PKSA 2POJA 3F19A 5CUHA 3U1RA 3VTGA 2OW1A 2W13A 3EHYA 1GKCA 2OXUA 1UTTA 1Q3AA 830CA 1G05A 4FVLA 3KEJA 1IACA 1KUIA 1OZ9A 2SRTA 3F17A 3LILA 3KMEA 2O3EA 2TCLA 4H30A 1SRPA 2AIGP 4FXYP 3RTTA 1PWVA 2Z2DA 3HB2P 4ILWD 1I1IP 2CLTA 3KRYA 4ZR5A 4AIGA 1YQYA 1QJJA 2D1NA 1HV5A 1I73A 1K7QA 2DW2A 3MA2A 3HYGA 3LMCA 1XFYA 1XURA 2E2DA 1G12A 4HX3A 5I12A 1SMPA 4PKVA 2OW0A 3VI1A 4GR0A 4I03A 4GR3A 3B92A 3HY7A 4FXQA 2CKIA 5I4OA 2OZRA 5I2ZA 3DL1A 3P24A 3GBOA 1BIWA 456CA 1ASTA 2HU6A 1HFCA 2OW9A 5I0LA 2MZIA 5B5OA 1EAKA 3LUNA 1GE5A 3L0VA 1OM7A 2Y6DA 2ERPA 4WF6A 4IJOA 1JANA 1CAQA 4H3XA 3P1VA 3AYKA 4WZVA 5D1TA 3NX7A 1OM8A 1KUFA 3DWBA 5BOTA 1ROSA 2X3CA 1RM8A 1XFXA 1BM6A 2Y6CA 2V4BA 4G9LA 3EDHA 1D8MA 1XM5A 3TSKA 5D2BA 4EFSA 1OS9A 3LQ0A 2X7MA 1DMTA 2AYKA 1R1JA 3DPEA 1L6JA 4IUWA 1BUDA 1QJIA 3DNGA 1KUKA 1JAPA 1GO8P 4L19A 5D3CA 1C8TA 1BUVM 5I3MA 1JKYA 4WKIA 2JT5A 1JH1A 4CTHA 2QPJA 1C7KA 1PWPA 2YUFA 2JIHA 2RJPA 2OXWA 3TVCA 4XCTA 1JAQA 2I47A 4AYKA 1I76A 3O2XA 5B5PA 1Y8JA 1HFSA 1JIZA 2DW1A 3DTEA 5D1UA 2JNPA 3LE9A 2XS3A 4DPEA 1YOUA 4WK7A 1BKCI 1QUAA 3AYUA 3F18A 1G4KA 4R3VA 2JSDA 2OVXA 2EROA 2XS4A 1XFVA 2X3AA 4FU4A 5CXAA 1BKCE 1J7NA 4J4MA 4L63A 1ZS0A 1CGLA 1UEAA 4L7AA 1FM1A 3B8ZA 3KMCA 3LIKA 2E3XA 5BOYA 2O36A 966CA 1QIAA 3KHIA 3G5CA 3LGPA 1SLNA 1IABA 2JT6A 4QKZA 4G0DA 1ATLA 2D1OA 3ELMA 1WNIA 4AXQA 2X3BA 1JJ9A 1CQRA 1D8FA 1XUDA 1HOVA 1IAEA 2OW2A 4GWMA 1BKCA 1JIWP 1R55A 2W14A 1QIBA 1MMQA 3KECA 1OMJA 5D7WA 1MMRA 2USNA 5LABA 3EHXA 3HDAP 1CXVA 1G9KA 1YP1A 1IADA 1R1HA 2YIGA 4JIJA 1EUBA 3Q2HA 1EB6A 3ZXHA 2DW0A 4I35A 4XM6A 2ERQA 1ZTQA 1R1IA 5L79A 3B2ZA 4XM8A 2W12A 4PKRA 5BPAA 3N2VA 3WV1A 1MMPA 3EDGA 1ZXVA 4AUOA 1ZP5A 1A86A 3LEAA 2K2GA 4GWNA 1PWQA 3F16A 1XUCA 3F15A 3N2UA 1DTHA 3LKAA 3TS4A 1USNA 4H1QA 4DF9A 1XAXA 1ND1A 1UMTA 2MZHA 4Q1LA 3G42A 4JP4A 1B8YA 2PJTA 4PKTA 2DDFA 3V96B 1OO9A 3LJGA 1AKLA 2K9CA 1OS2A 4ON1A 4GUYA 3DPFA 1KUGA 3HBVP 3OHLA 2W15A 4DV8A 3L0TA 4GR8A 3UVCA 2RJQA 3WV3A 4GQLA 1MNCA 3WV2A 3LQBA 5CZMA 1A85A 3KEKA 1ZVXA 1HY7A 3LIRA 1R54A 3DTKA 1K7IA 1MMBA 2OY4A 2FV9A 2L0RA 4A3WA 4DD8A 3EDZA 1GXDA 2W0DA 1XFUA 4PKUA 3HY9A 1Z3JA 5D1SA 1Y0VA 2N8RA 1SATA 3SHIA 3Q2GA 3OHOA 3LJTA 4H76A 3O64A 3HDBA 1FLSA 1D5JA 1IAAA 3I7GA 3TT4A 4HMAA 3I7IA 1CK7A 1ZXCA 1CGEA 2WO8A 1JAOA 1TVIA 1SU3A 1GKDA 3ZVSA 3USNA 1UTZA 1UMSA 2MLSA 3RTSA 2FV5A 3F1AA 1KUHA 1XFZA 3HBUP 1AYKA 1G49A 4PKQA 2J0TA 1QICA 3BA0A 1BSWA 3EWJA 4H84A 2WOAA 2KRJA 2OI0A 1OM6A 1H71P 4GF1A 4PKWA
chains in the Genus database with same CATH topology
3EDIA 3ZUKA 1PWUA 4L6TA 2YB9A 4JQGA 1CGFA 3AIGA 4XBHA 1AF0A 1SLMA 3DSLA 1O0QA 3KWVC 1FBLA 3LUMA 1BZSA 1B3DA 1D7XA 3LK8A 4A7BA 1RMZA 2A8HA 3K7LA 1Y93A 4H49A 1GO7P 2J83A 1XFWA 5JMYA 4H2EA 1CIZA 4IN9A 4H82A 3CKIA 5I43A 3LJZA 5L7FA 1IAGA 5H8XA 1KAPP 4WKEA 1GE6A 2OXZA 3DTIA 3K7NA 1HTDA 1YCMA 2MLRA 1BQOA 1JK3A 1S4BP 1C3IA 1GE7A 1K7GA 2OVZA 1KBCA 1O0TA 4JA1A 4JPAA 2WO9A 4XM7A 2MZEA 2DDYA 1BQQM 3E8RA 2OY2A 1PWWA 4PKSA 2POJA 3F19A 5CUHA 3U1RA 3VTGA 2OW1A 2W13A 3EHYA 1GKCA 2OXUA 1UTTA 1Q3AA 830CA 1G05A 4FVLA 3KEJA 1IACA 1KUIA 2SRTA 3F17A 3LILA 3KMEA 2O3EA 2TCLA 4H30A 1SRPA 2AIGP 4FXYP 3RTTA 1PWVA 2Z2DA 3HB2P 4ILWD 1I1IP 2CLTA 3KRYA 4ZR5A 4AIGA 1YQYA 1QJJA 2D1NA 1HV5A 1I73A 1K7QA 2DW2A 3MA2A 3HYGA 3LMCA 1XFYA 1XURA 2E2DA 1G12A 4HX3A 5I12A 1SMPA 4PKVA 2OW0A 3VI1A 4GR0A 4I03A 4GR3A 3B92A 3HY7A 4FXQA 2CKIA 5I4OA 2OZRA 5I2ZA 3DL1A 3P24A 3GBOA 1BIWA 456CA 1ASTA 2HU6A 1HFCA 2OW9A 5I0LA 2MZIA 5B5OA 1EAKA 3LUNA 1GE5A 3L0VA 1OM7A 2Y6DA 2ERPA 4WF6A 4IJOA 1JANA 1CAQA 4H3XA 3P1VA 3AYKA 4WZVA 5D1TA 3NX7A 1OM8A 1KUFA 3DWBA 5BOTA 1ROSA 2X3CA 1RM8A 1XFXA 1BM6A 2Y6CA 2V4BA 4G9LA 3EDHA 1D8MA 3TSKA 5D2BA 4EFSA 1OS9A 3LQ0A 2X7MA 1DMTA 2AYKA 1R1JA 3DPEA 1L6JA 4IUWA 1BUDA 1QJIA 3DNGA 1KUKA 1JAPA 1GO8P 4L19A 5D3CA 1C8TA 1BUVM 5I3MA 1JKYA 4WKIA 2JT5A 1JH1A 4CTHA 2QPJA 1C7KA 1PWPA 2YUFA 2JIHA 2RJPA 2OXWA 3TVCA 4XCTA 1JAQA 2I47A 4AYKA 1I76A 3O2XA 5B5PA 1Y8JA 1HFSA 1JIZA 2DW1A 3DTEA 5D1UA 2JNPA 3LE9A 2XS3A 4DPEA 1YOUA 4WK7A 1BKCI 1QUAA 3AYUA 3F18A 1G4KA 4R3VA 2JSDA 2OVXA 2EROA 2XS4A 1XFVA 2X3AA 4FU4A 5CXAA 1BKCE 1J7NA 4J4MA 4L63A 1ZS0A 1CGLA 1UEAA 4L7AA 1FM1A 3B8ZA 3KMCA 3LIKA 2E3XA 5BOYA 2O36A 966CA 1QIAA 3KHIA 3G5CA 3LGPA 1SLNA 1IABA 2JT6A 4QKZA 4G0DA 1ATLA 2D1OA 3ELMA 1WNIA 4AXQA 2X3BA 1JJ9A 1CQRA 1D8FA 1XUDA 1HOVA 1IAEA 2OW2A 4GWMA 1BKCA 1JIWP 1R55A 2W14A 1QIBA 1MMQA 3KECA 1OMJA 5D7WA 1MMRA 2USNA 5LABA 3EHXA 3HDAP 1CXVA 1G9KA 1YP1A 1IADA 1R1HA 2YIGA 4JIJA 1EUBA 3Q2HA 1EB6A 3ZXHA 2DW0A 4I35A 4XM6A 2ERQA 1ZTQA 1R1IA 5L79A 3B2ZA 4XM8A 2W12A 4PKRA 5BPAA 3N2VA 3WV1A 1MMPA 3EDGA 1ZXVA 4AUOA 1ZP5A 1A86A 3LEAA 2K2GA 4GWNA 1PWQA 3F16A 1XUCA 3F15A 3N2UA 1DTHA 3LKAA 3TS4A 1USNA 4H1QA 4DF9A 1ND1A 1UMTA 2MZHA 4Q1LA 3G42A 4JP4A 1B8YA 2PJTA 4PKTA 2DDFA 3V96B 1OO9A 3LJGA 1AKLA 2K9CA 1OS2A 4ON1A 4GUYA 3DPFA 1KUGA 3HBVP 3OHLA 2W15A 4DV8A 3L0TA 4GR8A 3UVCA 2RJQA 3WV3A 4GQLA 1MNCA 3WV2A 3LQBA 5CZMA 1A85A 3KEKA 1ZVXA 1HY7A 3LIRA 1R54A 3DTKA 1K7IA 1MMBA 2OY4A 2FV9A 2L0RA 4A3WA 4DD8A 3EDZA 1GXDA 2W0DA 1XFUA 4PKUA 3HY9A 1Z3JA 5D1SA 1Y0VA 2N8RA 1SATA 3SHIA 3Q2GA 3OHOA 3LJTA 4H76A 3O64A 3HDBA 1FLSA 1D5JA 1IAAA 3I7GA 3TT4A 4HMAA 3I7IA 1CK7A 1ZXCA 1CGEA 2WO8A 1JAOA 1SU3A 1GKDA 3ZVSA 3USNA 1UTZA 1UMSA 2MLSA 3RTSA 2FV5A 3F1AA 1KUHA 1XFZA 3HBUP 1AYKA 1G49A 4PKQA 2J0TA 1QICA 3BA0A 1BSWA 3EWJA 4H84A 2WOAA 2KRJA 2OI0A 1OM6A 1H71P 4GF1A 4PKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDI A;  3ZUK A;  1PWU A;  4L6T A;  2YB9 A;  4JQG A;  1CGF A;  3AIG A;  4XBH A;  1AF0 A;  1SLM A;  3DSL A;  1O0Q A;  3KWV C;  1FBL A;  3LUM A;  1BZS A;  1B3D A;  1D7X A;  3LK8 A;  4A7B A;  1RMZ A;  2A8H A;  3K7L A;  1Y93 A;  4H49 A;  1GO7 P;  2J83 A;  1XFW A;  5JMY A;  4H2E A;  1CIZ A;  4IN9 A;  4H82 A;  3CKI A;  5I43 A;  3LJZ A;  5L7F A;  1IAG A;  5H8X A;  1KAP P;  4WKE A;  1GE6 A;  2OXZ A;  3K7N A;  1HTD A;  1YCM A;  2MLR A;  1BQO A;  1JK3 A;  1S4B P;  1C3I A;  1GE7 A;  1K7G A;  2OVZ A;  1KBC A;  1O0T A;  4JA1 A;  4JPA A;  2WO9 A;  4XM7 A;  2MZE A;  2DDY A;  1BQQ M;  3E8R A;  2OY2 A;  1PWW A;  4PKS A;  2POJ A;  3F19 A;  5CUH A;  3U1R A;  3VTG A;  2OW1 A;  2W13 A;  3EHY A;  1GKC A;  2OXU A;  1UTT A;  1Q3A A;  830C A;  1G05 A;  4FVL A;  3KEJ A;  1IAC A;  1KUI A;  2SRT A;  3F17 A;  3LIL A;  3KME A;  2O3E A;  2TCL A;  4H30 A;  1SRP A;  2AIG P;  4FXY P;  3RTT A;  1PWV A;  2Z2D A;  3HB2 P;  4ILW D;  1I1I P;  2CLT A;  3KRY A;  4ZR5 A;  4AIG A;  1YQY A;  1QJJ A;  2D1N A;  1HV5 A;  1I73 A;  1K7Q A;  2DW2 A;  3MA2 A;  3HYG A;  3LMC A;  1XFY A;  1XUR A;  2E2D A;  1G12 A;  4HX3 A;  5I12 A;  1SMP A;  4PKV A;  2OW0 A;  3VI1 A;  4GR0 A;  4I03 A;  4GR3 A;  3B92 A;  3HY7 A;  4FXQ A;  2CKI A;  5I4O A;  2OZR A;  5I2Z A;  3DL1 A;  3P24 A;  3GBO A;  1BIW A;  456C A;  1AST A;  2HU6 A;  1HFC A;  2OW9 A;  5I0L A;  2MZI A;  5B5O A;  1EAK A;  3LUN A;  1GE5 A;  3L0V A;  1OM7 A;  2Y6D A;  2ERP A;  4WF6 A;  4IJO A;  1JAN A;  1CAQ A;  4H3X A;  3P1V A;  3AYK A;  4WZV A;  5D1T A;  3NX7 A;  1OM8 A;  1KUF A;  3DWB A;  5BOT A;  1ROS A;  2X3C A;  1RM8 A;  1XFX A;  1BM6 A;  2Y6C A;  2V4B A;  4G9L A;  3EDH A;  1D8M A;  3TSK A;  5D2B A;  4EFS A;  1OS9 A;  3LQ0 A;  2X7M A;  1DMT A;  2AYK A;  1R1J A;  3DPE A;  1L6J A;  4IUW A;  1BUD A;  1QJI A;  3DNG A;  1KUK A;  1JAP A;  1GO8 P;  4L19 A;  5D3C A;  1C8T A;  1BUV M;  5I3M A;  1JKY A;  4WKI A;  2JT5 A;  1JH1 A;  4CTH A;  2QPJ A;  1C7K A;  1PWP A;  2JIH A;  2RJP A;  2OXW A;  3TVC A;  4XCT A;  1JAQ A;  2I47 A;  4AYK A;  1I76 A;  3O2X A;  5B5P A;  1Y8J A;  1HFS A;  1JIZ A;  2DW1 A;  5D1U A;  2JNP A;  3LE9 A;  2XS3 A;  4DPE A;  1YOU A;  4WK7 A;  1BKC I;  1QUA A;  3AYU A;  3F18 A;  1G4K A;  4R3V A;  2JSD A;  2OVX A;  2ERO A;  2XS4 A;  1XFV A;  2X3A A;  4FU4 A;  5CXA A;  1BKC E;  1J7N A;  4J4M A;  4L63 A;  1ZS0 A;  1CGL A;  1UEA A;  1FM1 A;  3B8Z A;  3KMC A;  3LIK A;  2E3X A;  5BOY A;  2O36 A;  966C A;  1QIA A;  3KHI A;  3G5C A;  3LGP A;  1SLN A;  1IAB A;  2JT6 A;  4QKZ A;  4G0D A;  1ATL A;  2D1O A;  3ELM A;  1WNI A;  4AXQ A;  2X3B A;  1JJ9 A;  1CQR A;  1D8F A;  1XUD A;  1HOV A;  1IAE A;  2OW2 A;  4GWM A;  1BKC A;  1JIW P;  1R55 A;  2W14 A;  1QIB A;  1MMQ A;  3KEC A;  1OMJ A;  5D7W A;  1MMR A;  2USN A;  5LAB A;  3EHX A;  3HDA P;  1CXV A;  1G9K A;  1YP1 A;  1IAD A;  1R1H A;  2YIG A;  4JIJ A;  1EUB A;  3Q2H A;  1EB6 A;  3ZXH A;  2DW0 A;  4I35 A;  4XM6 A;  2ERQ A;  1ZTQ A;  1R1I A;  5L79 A;  3B2Z A;  4XM8 A;  2W12 A;  4PKR A;  5BPA A;  3N2V A;  3WV1 A;  1MMP A;  3EDG A;  1ZXV A;  4AUO A;  1ZP5 A;  1A86 A;  3LEA A;  2K2G A;  4GWN A;  1PWQ A;  3F16 A;  1XUC A;  3F15 A;  3N2U A;  1DTH A;  3LKA A;  3TS4 A;  1USN A;  4H1Q A;  4DF9 A;  1ND1 A;  1UMT A;  2MZH A;  4Q1L A;  3G42 A;  4JP4 A;  1B8Y A;  2PJT A;  4PKT A;  2DDF A;  3V96 B;  1OO9 A;  3LJG A;  1AKL A;  2K9C A;  1OS2 A;  4ON1 A;  4GUY A;  3DPF A;  1KUG A;  3HBV P;  3OHL A;  2W15 A;  4DV8 A;  3L0T A;  4GR8 A;  3UVC A;  2RJQ A;  3WV3 A;  4GQL A;  1MNC A;  3WV2 A;  3LQB A;  5CZM A;  1A85 A;  3KEK A;  1ZVX A;  1HY7 A;  3LIR A;  1R54 A;  1K7I A;  1MMB A;  2OY4 A;  2FV9 A;  2L0R A;  4A3W A;  4DD8 A;  3EDZ A;  1GXD A;  2W0D A;  1XFU A;  4PKU A;  3HY9 A;  1Z3J A;  5D1S A;  1Y0V A;  2N8R A;  1SAT A;  3SHI A;  3Q2G A;  3OHO A;  3LJT A;  4H76 A;  3O64 A;  3HDB A;  1FLS A;  1D5J A;  1IAA A;  3I7G A;  3TT4 A;  4HMA A;  3I7I A;  1CK7 A;  1ZXC A;  1CGE A;  2WO8 A;  1JAO A;  1SU3 A;  1GKD A;  3ZVS A;  3USN A;  1UTZ A;  1UMS A;  2MLS A;  3RTS A;  2FV5 A;  3F1A A;  1KUH A;  1XFZ A;  3HBU P;  1AYK A;  1G49 A;  4PKQ A;  2J0T A;  1QIC A;  3BA0 A;  1BSW A;  3EWJ A;  4H84 A;  2WOA A;  2KRJ A;  2OI0 A;  1OM6 A;  1H71 P;  4GF1 A;  4PKW A; 
#chains in the Genus database with same CATH topology
 3EDI A;  3ZUK A;  1PWU A;  4L6T A;  2YB9 A;  4JQG A;  1CGF A;  3AIG A;  4XBH A;  1AF0 A;  1SLM A;  3DSL A;  1O0Q A;  3KWV C;  1FBL A;  3LUM A;  1BZS A;  1B3D A;  1D7X A;  3LK8 A;  4A7B A;  1RMZ A;  2A8H A;  3K7L A;  1Y93 A;  4H49 A;  1GO7 P;  2J83 A;  1XFW A;  5JMY A;  4H2E A;  1CIZ A;  4IN9 A;  4H82 A;  3CKI A;  5I43 A;  3LJZ A;  5L7F A;  1IAG A;  5H8X A;  1KAP P;  4WKE A;  1GE6 A;  2OXZ A;  3DTI A;  3K7N A;  1HTD A;  1YCM A;  2MLR A;  1BQO A;  1JK3 A;  1S4B P;  1C3I A;  1GE7 A;  1K7G A;  2OVZ A;  1KBC A;  1O0T A;  4JA1 A;  4JPA A;  2WO9 A;  4XM7 A;  2MZE A;  2DDY A;  1BQQ M;  3E8R A;  2OY2 A;  1PWW A;  4PKS A;  2POJ A;  3F19 A;  5CUH A;  3U1R A;  3VTG A;  2OW1 A;  2W13 A;  3EHY A;  1GKC A;  2OXU A;  1UTT A;  1Q3A A;  830C A;  1G05 A;  4FVL A;  3KEJ A;  1IAC A;  1KUI A;  1OZ9 A;  2SRT A;  3F17 A;  3LIL A;  3KME A;  2O3E A;  2TCL A;  4H30 A;  1SRP A;  2AIG P;  4FXY P;  3RTT A;  1PWV A;  2Z2D A;  3HB2 P;  4ILW D;  1I1I P;  2CLT A;  3KRY A;  4ZR5 A;  4AIG A;  1YQY A;  1QJJ A;  2D1N A;  1HV5 A;  1I73 A;  1K7Q A;  2DW2 A;  3MA2 A;  3HYG A;  3LMC A;  1XFY A;  1XUR A;  2E2D A;  1G12 A;  4HX3 A;  5I12 A;  1SMP A;  4PKV A;  2OW0 A;  3VI1 A;  4GR0 A;  4I03 A;  4GR3 A;  3B92 A;  3HY7 A;  4FXQ A;  2CKI A;  5I4O A;  2OZR A;  5I2Z A;  3DL1 A;  3P24 A;  3GBO A;  1BIW A;  456C A;  1AST A;  2HU6 A;  1HFC A;  2OW9 A;  5I0L A;  2MZI A;  5B5O A;  1EAK A;  3LUN A;  1GE5 A;  3L0V A;  1OM7 A;  2Y6D A;  2ERP A;  4WF6 A;  4IJO A;  1JAN A;  1CAQ A;  4H3X A;  3P1V A;  3AYK A;  4WZV A;  5D1T A;  3NX7 A;  1OM8 A;  1KUF A;  3DWB A;  5BOT A;  1ROS A;  2X3C A;  1RM8 A;  1XFX A;  1BM6 A;  2Y6C A;  2V4B A;  4G9L A;  3EDH A;  1D8M A;  1XM5 A;  3TSK A;  5D2B A;  4EFS A;  1OS9 A;  3LQ0 A;  2X7M A;  1DMT A;  2AYK A;  1R1J A;  3DPE A;  1L6J A;  4IUW A;  1BUD A;  1QJI A;  3DNG A;  1KUK A;  1JAP A;  1GO8 P;  4L19 A;  5D3C A;  1C8T A;  1BUV M;  5I3M A;  1JKY A;  4WKI A;  2JT5 A;  1JH1 A;  4CTH A;  2QPJ A;  1C7K A;  1PWP A;  2YUF A;  2JIH A;  2RJP A;  2OXW A;  3TVC A;  4XCT A;  1JAQ A;  2I47 A;  4AYK A;  1I76 A;  3O2X A;  5B5P A;  1Y8J A;  1HFS A;  1JIZ A;  2DW1 A;  3DTE A;  5D1U A;  2JNP A;  3LE9 A;  2XS3 A;  4DPE A;  1YOU A;  4WK7 A;  1BKC I;  1QUA A;  3AYU A;  3F18 A;  1G4K A;  4R3V A;  2JSD A;  2OVX A;  2ERO A;  2XS4 A;  1XFV A;  2X3A A;  4FU4 A;  5CXA A;  1BKC E;  1J7N A;  4J4M A;  4L63 A;  1ZS0 A;  1CGL A;  1UEA A;  4L7A A;  1FM1 A;  3B8Z A;  3KMC A;  3LIK A;  2E3X A;  5BOY A;  2O36 A;  966C A;  1QIA A;  3KHI A;  3G5C A;  3LGP A;  1SLN A;  1IAB A;  2JT6 A;  4QKZ A;  4G0D A;  1ATL A;  2D1O A;  3ELM A;  1WNI A;  4AXQ A;  2X3B A;  1JJ9 A;  1CQR A;  1D8F A;  1XUD A;  1HOV A;  1IAE A;  2OW2 A;  4GWM A;  1BKC A;  1JIW P;  1R55 A;  2W14 A;  1QIB A;  1MMQ A;  3KEC A;  1OMJ A;  5D7W A;  1MMR A;  2USN A;  5LAB A;  3EHX A;  3HDA P;  1CXV A;  1G9K A;  1YP1 A;  1IAD A;  1R1H A;  2YIG A;  4JIJ A;  1EUB A;  3Q2H A;  1EB6 A;  3ZXH A;  2DW0 A;  4I35 A;  4XM6 A;  2ERQ A;  1ZTQ A;  1R1I A;  5L79 A;  3B2Z A;  4XM8 A;  2W12 A;  4PKR A;  5BPA A;  3N2V A;  3WV1 A;  1MMP A;  3EDG A;  1ZXV A;  4AUO A;  1ZP5 A;  1A86 A;  3LEA A;  2K2G A;  4GWN A;  1PWQ A;  3F16 A;  1XUC A;  3F15 A;  3N2U A;  1DTH A;  3LKA A;  3TS4 A;  1USN A;  4H1Q A;  4DF9 A;  1XAX A;  1ND1 A;  1UMT A;  2MZH A;  4Q1L A;  3G42 A;  4JP4 A;  1B8Y A;  2PJT A;  4PKT A;  2DDF A;  3V96 B;  1OO9 A;  3LJG A;  1AKL A;  2K9C A;  1OS2 A;  4ON1 A;  4GUY A;  3DPF A;  1KUG A;  3HBV P;  3OHL A;  2W15 A;  4DV8 A;  3L0T A;  4GR8 A;  3UVC A;  2RJQ A;  3WV3 A;  4GQL A;  1MNC A;  3WV2 A;  3LQB A;  5CZM A;  1A85 A;  3KEK A;  1ZVX A;  1HY7 A;  3LIR A;  1R54 A;  3DTK A;  1K7I A;  1MMB A;  2OY4 A;  2FV9 A;  2L0R A;  4A3W A;  4DD8 A;  3EDZ A;  1GXD A;  2W0D A;  1XFU A;  4PKU A;  3HY9 A;  1Z3J A;  5D1S A;  1Y0V A;  2N8R A;  1SAT A;  3SHI A;  3Q2G A;  3OHO A;  3LJT A;  4H76 A;  3O64 A;  3HDB A;  1FLS A;  1D5J A;  1IAA A;  3I7G A;  3TT4 A;  4HMA A;  3I7I A;  1CK7 A;  1ZXC A;  1CGE A;  2WO8 A;  1JAO A;  1TVI A;  1SU3 A;  1GKD A;  3ZVS A;  3USN A;  1UTZ A;  1UMS A;  2MLS A;  3RTS A;  2FV5 A;  3F1A A;  1KUH A;  1XFZ A;  3HBU P;  1AYK A;  1G49 A;  4PKQ A;  2J0T A;  1QIC A;  3BA0 A;  1BSW A;  3EWJ A;  4H84 A;  2WOA A;  2KRJ A;  2OI0 A;  1OM6 A;  1H71 P;  4GF1 A;  4PKW A; 
#chains in the Genus database with same CATH homology
 3EDI A;  3ZUK A;  1PWU A;  4L6T A;  2YB9 A;  4JQG A;  1CGF A;  3AIG A;  4XBH A;  1AF0 A;  1SLM A;  3DSL A;  1O0Q A;  3KWV C;  1FBL A;  3LUM A;  1BZS A;  1B3D A;  1D7X A;  3LK8 A;  4A7B A;  1RMZ A;  2A8H A;  3K7L A;  1Y93 A;  4H49 A;  1GO7 P;  2J83 A;  1XFW A;  5JMY A;  4H2E A;  1CIZ A;  4IN9 A;  4H82 A;  3CKI A;  5I43 A;  3LJZ A;  5L7F A;  1IAG A;  5H8X A;  1KAP P;  4WKE A;  1GE6 A;  2OXZ A;  3DTI A;  3K7N A;  1HTD A;  1YCM A;  2MLR A;  1BQO A;  1JK3 A;  1S4B P;  1C3I A;  1GE7 A;  1K7G A;  2OVZ A;  1KBC A;  1O0T A;  4JA1 A;  4JPA A;  2WO9 A;  4XM7 A;  2MZE A;  2DDY A;  1BQQ M;  3E8R A;  2OY2 A;  1PWW A;  4PKS A;  2POJ A;  3F19 A;  5CUH A;  3U1R A;  3VTG A;  2OW1 A;  2W13 A;  3EHY A;  1GKC A;  2OXU A;  1UTT A;  1Q3A A;  830C A;  1G05 A;  4FVL A;  3KEJ A;  1IAC A;  1KUI A;  2SRT A;  3F17 A;  3LIL A;  3KME A;  2O3E A;  2TCL A;  4H30 A;  1SRP A;  2AIG P;  4FXY P;  3RTT A;  1PWV A;  2Z2D A;  3HB2 P;  4ILW D;  1I1I P;  2CLT A;  3KRY A;  4ZR5 A;  4AIG A;  1YQY A;  1QJJ A;  2D1N A;  1HV5 A;  1I73 A;  1K7Q A;  2DW2 A;  3MA2 A;  3HYG A;  3LMC A;  1XFY A;  1XUR A;  2E2D A;  1G12 A;  4HX3 A;  5I12 A;  1SMP A;  4PKV A;  2OW0 A;  3VI1 A;  4GR0 A;  4I03 A;  4GR3 A;  3B92 A;  3HY7 A;  4FXQ A;  2CKI A;  5I4O A;  2OZR A;  5I2Z A;  3DL1 A;  3P24 A;  3GBO A;  1BIW A;  456C A;  1AST A;  2HU6 A;  1HFC A;  2OW9 A;  5I0L A;  2MZI A;  5B5O A;  1EAK A;  3LUN A;  1GE5 A;  3L0V A;  1OM7 A;  2Y6D A;  2ERP A;  4WF6 A;  4IJO A;  1JAN A;  1CAQ A;  4H3X A;  3P1V A;  3AYK A;  4WZV A;  5D1T A;  3NX7 A;  1OM8 A;  1KUF A;  3DWB A;  5BOT A;  1ROS A;  2X3C A;  1RM8 A;  1XFX A;  1BM6 A;  2Y6C A;  2V4B A;  4G9L A;  3EDH A;  1D8M A;  3TSK A;  5D2B A;  4EFS A;  1OS9 A;  3LQ0 A;  2X7M A;  1DMT A;  2AYK A;  1R1J A;  3DPE A;  1L6J A;  4IUW A;  1BUD A;  1QJI A;  3DNG A;  1KUK A;  1JAP A;  1GO8 P;  4L19 A;  5D3C A;  1C8T A;  1BUV M;  5I3M A;  1JKY A;  4WKI A;  2JT5 A;  1JH1 A;  4CTH A;  2QPJ A;  1C7K A;  1PWP A;  2YUF A;  2JIH A;  2RJP A;  2OXW A;  3TVC A;  4XCT A;  1JAQ A;  2I47 A;  4AYK A;  1I76 A;  3O2X A;  5B5P A;  1Y8J A;  1HFS A;  1JIZ A;  2DW1 A;  3DTE A;  5D1U A;  2JNP A;  3LE9 A;  2XS3 A;  4DPE A;  1YOU A;  4WK7 A;  1BKC I;  1QUA A;  3AYU A;  3F18 A;  1G4K A;  4R3V A;  2JSD A;  2OVX A;  2ERO A;  2XS4 A;  1XFV A;  2X3A A;  4FU4 A;  5CXA A;  1BKC E;  1J7N A;  4J4M A;  4L63 A;  1ZS0 A;  1CGL A;  1UEA A;  4L7A A;  1FM1 A;  3B8Z A;  3KMC A;  3LIK A;  2E3X A;  5BOY A;  2O36 A;  966C A;  1QIA A;  3KHI A;  3G5C A;  3LGP A;  1SLN A;  1IAB A;  2JT6 A;  4QKZ A;  4G0D A;  1ATL A;  2D1O A;  3ELM A;  1WNI A;  4AXQ A;  2X3B A;  1JJ9 A;  1CQR A;  1D8F A;  1XUD A;  1HOV A;  1IAE A;  2OW2 A;  4GWM A;  1BKC A;  1JIW P;  1R55 A;  2W14 A;  1QIB A;  1MMQ A;  3KEC A;  1OMJ A;  5D7W A;  1MMR A;  2USN A;  5LAB A;  3EHX A;  3HDA P;  1CXV A;  1G9K A;  1YP1 A;  1IAD A;  1R1H A;  2YIG A;  4JIJ A;  1EUB A;  3Q2H A;  1EB6 A;  3ZXH A;  2DW0 A;  4I35 A;  4XM6 A;  2ERQ A;  1ZTQ A;  1R1I A;  5L79 A;  3B2Z A;  4XM8 A;  2W12 A;  4PKR A;  5BPA A;  3N2V A;  3WV1 A;  1MMP A;  3EDG A;  1ZXV A;  4AUO A;  1ZP5 A;  1A86 A;  3LEA A;  2K2G A;  4GWN A;  1PWQ A;  3F16 A;  1XUC A;  3F15 A;  3N2U A;  1DTH A;  3LKA A;  3TS4 A;  1USN A;  4H1Q A;  4DF9 A;  1ND1 A;  1UMT A;  2MZH A;  4Q1L A;  3G42 A;  4JP4 A;  1B8Y A;  2PJT A;  4PKT A;  2DDF A;  3V96 B;  1OO9 A;  3LJG A;  1AKL A;  2K9C A;  1OS2 A;  4ON1 A;  4GUY A;  3DPF A;  1KUG A;  3HBV P;  3OHL A;  2W15 A;  4DV8 A;  3L0T A;  4GR8 A;  3UVC A;  2RJQ A;  3WV3 A;  4GQL A;  1MNC A;  3WV2 A;  3LQB A;  5CZM A;  1A85 A;  3KEK A;  1ZVX A;  1HY7 A;  3LIR A;  1R54 A;  3DTK A;  1K7I A;  1MMB A;  2OY4 A;  2FV9 A;  2L0R A;  4A3W A;  4DD8 A;  3EDZ A;  1GXD A;  2W0D A;  1XFU A;  4PKU A;  3HY9 A;  1Z3J A;  5D1S A;  1Y0V A;  2N8R A;  1SAT A;  3SHI A;  3Q2G A;  3OHO A;  3LJT A;  4H76 A;  3O64 A;  3HDB A;  1FLS A;  1D5J A;  1IAA A;  3I7G A;  3TT4 A;  4HMA A;  3I7I A;  1CK7 A;  1ZXC A;  1CGE A;  2WO8 A;  1JAO A;  1SU3 A;  1GKD A;  3ZVS A;  3USN A;  1UTZ A;  1UMS A;  2MLS A;  3RTS A;  2FV5 A;  3F1A A;  1KUH A;  1XFZ A;  3HBU P;  1AYK A;  1G49 A;  4PKQ A;  2J0T A;  1QIC A;  3BA0 A;  1BSW A;  3EWJ A;  4H84 A;  2WOA A;  2KRJ A;  2OI0 A;  1OM6 A;  1H71 P;  4GF1 A;  4PKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...