3SHIA

Crystal structure of human mmp1 catalytic domain at 2.2 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
156
structure length
156
Chain Sequence
NPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interstitial collagenase
publication title The catalytic domain of MMP-1 studied through tagged lanthanides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 156
sequence length 156
chains with identical sequence G, M
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3shiA00
1BUDA 2J83A 3KRYA 2JT6A 3P24A 1BM6A 3LK8A 4J4MA 4PKRA 3B8ZA 5BOTA 1D5JA 2HU6A 2DW1A 2AIGP 1GXDA 3GBOA 2RJPA 2JT5A 4QKZA 1I76A 4A3WA 1ZS0A 3DPFA 2DW2A 2W13A 1GE6A 1IABA 4H82A 4WF6A 1GKDA 1JH1A 1UMSA 3LJTA 1FBLA 1QJIA 3RTSA 1OS2A 2ERQA 2MZEA 5CXAA 4L6TA 3G42A 1XFYA 3TVCA 3Q2GA 1SLMA 1JJ9A 4DPEA 4IN9A 5I3MA 3NX7A 1R1IA 3KEJA 1C8TA 1XFXA 1YQYA 3N2VA 5L79A 2I47A 1QJJA 1CGLA 1IACA 2L0RA 3DWBA 1QIBA 1ROSA 1S4BP 1WNIA 1ASTA 3ELMA 1AF0A 5I43A 4IJOA 2MZHA 3V96B 1MNCA 1PWQA 2RJQA 3OHLA 5B5OA 4PKWA 1PWVA 2K2GA 1BQQM 1IAGA 5L7FA 1Z3JA 1BKCA 1DTHA 1R1JA 1YCMA 2A8HA 2W0DA 1K7GA 1OS9A 4WKEA 4GR0A 1FLSA 3HBVP 3E8RA 4WZVA 2MZIA 4AXQA 4FXQA 2OVZA 1BKCI 2V4BA 3DPEA 3K7LA 3U1RA 3LJGA 4H49A 2K9CA 3WV1A 2OVXA 3G5CA 3EDGA 2D1OA 1C7KA 4GR3A 4DV8A 3WV3A 3VTGA 3B92A 1YP1A 4AUOA 4AYKA 1G05A 1RMZA 3I7GA 1G49A 1HV5A 3HYGA 1SATA 3ZUKA 2DDFA 4L19A 5I4OA 2JIHA 1XFUA 3F19A 5D2BA 4JQGA 2FV5A 5D3CA 1IADA 1UEAA 1ZXVA 4DF9A 3EDHA 2MLRA 2ERPA 3EWJA 1JAQA 1G12A 2OI0A 3F18A 1MMQA 1AKLA 2KRJA 1EB6A 3EHYA 3ZXHA 4FU4A 1D8FA 1JIWP 1KUIA 1R55A 3TT4A 2N8RA 4H84A 5BOYA 4AIGA 3LMCA 5I12A 3HDAP 1R54A 1O0QA 4FVLA 4PKSA 1Q3AA 3UVCA 2FV9A 3LE9A 3I7IA 5LABA 2XS4A 1QIAA 1J7NA 1CK7A 1CAQA 4JA1A 3OHOA 4WK7A 4XM8A 4HMAA 1H71P 1JAOA 4JIJA 1GE5A 1BKCE 1C3IA 1B8YA 1OM7A 1GE7A 3DSLA 1ZVXA 3CKIA 2OW9A 1BZSA 1K7IA 1BSWA 2Y6CA 1SRPA 1KAPP 1O0TA 4L63A 3VI1A 2CLTA 3SHIA 3DL1A 4GWMA 2CKIA 1KUFA 2WO8A 4ZR5A 830CA 966CA 1UTZA 2OW1A 3F1AA 4GF1A 5D1TA 3HBUP 2E2DA 1CXVA 4JP4A 1YOUA 4XM7A 4XM6A 1Y93A 5JMYA 1BQOA 3MA2A 3EDZA 3L0TA 4R3VA 1G9KA 1JIZA 4GWNA 1XFVA 1KUGA 3AYKA 4HX3A 2PJTA 2W14A 3LQBA 3O2XA 1SMPA 3EDIA 1GO7P 2OXZA 1A85A 4JPAA 5CUHA 1QICA 4PKUA 2OXUA 5CZMA 1SLNA 1HFSA 3TSKA 1OMJA 2USNA 2POJA 1KBCA 2Z2DA 4H2EA 2XS3A 1FM1A 3DNGA 2W12A 4XBHA 1Y8JA 4PKVA 1GO8P 2O36A 1ATLA 4H76A 1JK3A 2SRTA 1MMPA 1GKCA 3LILA 2OXWA 2X7MA 3LUNA 2JSDA 4GR8A 3LGPA 1ND1A 1MMBA 1B3DA 3RTTA 1JANA 3LJZA 1D8MA 3P1VA 4ON1A 2W15A 3L0VA 1PWWA 4ILWD 3KEKA 1I73A 1IAEA 2E3XA 2QPJA 3AIGA 3LIRA 1L6JA 3B2ZA 3LEAA 1ZXCA 3KHIA 2X3AA 3USNA 3EHXA 3F15A 4EFSA 1I1IP 3HY9A 1OM6A 5I2ZA 1KUKA 3KECA 3LKAA 4H30A 1DMTA 4Q1LA 5D1SA 2DDYA 1R1HA 3HY7A 4GUYA 5I0LA 1CGFA 2OW2A 1JKYA 3Q2HA 1XFWA 2X3BA 4DD8A 1CGEA 1XURA 1HOVA 4I35A 4G9LA 1XFZA 3O64A 1USNA 1CQRA 3HDBA 1AYKA 5D1UA 1HTDA 4G0DA 1A86A 2WO9A 3K7NA 4CTHA 2OY4A 4H3XA 1UTTA 4IUWA 3BA0A 2WOAA 4I03A 456CA 1G4KA 1D7XA 3KWVC 1SU3A 4XCTA 1ZP5A 2YIGA 1MMRA 3F17A 2OY2A 3ZVSA 2J0TA 2X3CA 1ZTQA 1JAPA 1BUVM 1HY7A 1CIZA 1HFCA 3LIKA 2OZRA 3KMEA 3LQ0A 5BPAA 1PWPA 3WV2A 1K7QA 1UMTA 3LUMA 2O3EA 2Y6DA 1PWUA 3KMCA 1OM8A 1XUDA 2AYKA 3HB2P 5D7WA 4H1QA 5H8XA 1KUHA 2YB9A 1XUCA 1EUBA 2EROA 2JNPA 1BIWA 4A7BA 1RM8A 4PKTA 3F16A 2OW0A 1Y0VA 2MLSA 5B5PA 2D1NA 2TCLA 3N2UA 3AYUA 2DW0A 1IAAA 4PKQA 1QUAA 4FXYP 1OO9A 1EAKA 4WKIA 3TS4A 4GQLA
chains in the Genus database with same CATH superfamily
1BUDA 2J83A 3KRYA 2JT6A 3P24A 1BM6A 3LK8A 4J4MA 4PKRA 3B8ZA 5BOTA 1D5JA 2HU6A 2DW1A 2AIGP 1GXDA 3GBOA 2RJPA 2JT5A 4QKZA 1I76A 4A3WA 1ZS0A 3DPFA 2DW2A 2W13A 1GE6A 1IABA 4H82A 4WF6A 1GKDA 1JH1A 1UMSA 3LJTA 1FBLA 1QJIA 3RTSA 1OS2A 2ERQA 2MZEA 5CXAA 4L6TA 3G42A 1XFYA 3TVCA 3Q2GA 1SLMA 1JJ9A 4DPEA 4IN9A 5I3MA 3NX7A 1R1IA 3KEJA 1C8TA 1XFXA 1YQYA 3N2VA 5L79A 2I47A 1QJJA 1CGLA 1IACA 2L0RA 3DWBA 1QIBA 1ROSA 1S4BP 1WNIA 1ASTA 3ELMA 3DTIA 1AF0A 5I43A 4IJOA 2MZHA 1XAXA 3V96B 1MNCA 1PWQA 2RJQA 3OHLA 5B5OA 4PKWA 1PWVA 2K2GA 1BQQM 1IAGA 5L7FA 1Z3JA 1BKCA 1DTHA 1R1JA 1YCMA 2A8HA 2W0DA 1K7GA 1OS9A 4WKEA 4GR0A 1FLSA 3HBVP 3E8RA 3DTEA 4WZVA 2MZIA 4AXQA 4FXQA 2OVZA 1BKCI 2V4BA 3DPEA 3K7LA 3U1RA 3LJGA 4H49A 2K9CA 3WV1A 2OVXA 3G5CA 3EDGA 2D1OA 1C7KA 4GR3A 4DV8A 3WV3A 3VTGA 2YUFA 3B92A 1YP1A 4AUOA 4AYKA 1G05A 1RMZA 3I7GA 1G49A 1HV5A 3HYGA 1SATA 3ZUKA 2DDFA 4L19A 5I4OA 2JIHA 1XFUA 3F19A 5D2BA 4JQGA 2FV5A 5D3CA 1IADA 1UEAA 1ZXVA 4DF9A 3EDHA 2MLRA 2ERPA 3EWJA 1JAQA 1G12A 4L7AA 2OI0A 3F18A 1MMQA 1AKLA 2KRJA 1EB6A 3EHYA 3ZXHA 4FU4A 1D8FA 1JIWP 1KUIA 1R55A 3TT4A 2N8RA 4H84A 5BOYA 4AIGA 3LMCA 5I12A 3HDAP 1R54A 1O0QA 4FVLA 4PKSA 1Q3AA 3UVCA 2FV9A 3LE9A 3I7IA 5LABA 2XS4A 1QIAA 1J7NA 1CK7A 1CAQA 4JA1A 3OHOA 4WK7A 4XM8A 4HMAA 3DTKA 1H71P 1JAOA 4JIJA 1GE5A 1BKCE 1C3IA 1B8YA 1OM7A 1GE7A 3DSLA 1ZVXA 3CKIA 2OW9A 1BZSA 1K7IA 1BSWA 2Y6CA 1SRPA 1KAPP 1O0TA 4L63A 3VI1A 2CLTA 3SHIA 3DL1A 4GWMA 2CKIA 1KUFA 2WO8A 4ZR5A 830CA 966CA 1UTZA 2OW1A 3F1AA 4GF1A 5D1TA 3HBUP 2E2DA 1CXVA 4JP4A 1YOUA 4XM7A 4XM6A 1Y93A 5JMYA 1BQOA 3MA2A 3EDZA 3L0TA 4R3VA 1G9KA 1JIZA 4GWNA 1XFVA 1KUGA 3AYKA 4HX3A 2PJTA 2W14A 3LQBA 3O2XA 1SMPA 3EDIA 1GO7P 2OXZA 1A85A 4JPAA 5CUHA 1QICA 4PKUA 2OXUA 5CZMA 1SLNA 1HFSA 3TSKA 1OMJA 2USNA 2POJA 1KBCA 2Z2DA 4H2EA 2XS3A 1FM1A 3DNGA 2W12A 4XBHA 1Y8JA 4PKVA 1GO8P 2O36A 1ATLA 4H76A 1JK3A 2SRTA 1MMPA 1GKCA 3LILA 2OXWA 2X7MA 3LUNA 2JSDA 4GR8A 3LGPA 1ND1A 1MMBA 1B3DA 3RTTA 1JANA 3LJZA 1D8MA 3P1VA 4ON1A 1XM5A 2W15A 3L0VA 1PWWA 4ILWD 3KEKA 1I73A 1IAEA 2E3XA 2QPJA 3AIGA 3LIRA 1L6JA 3B2ZA 3LEAA 1ZXCA 3KHIA 2X3AA 3USNA 3EHXA 3F15A 4EFSA 1I1IP 3HY9A 1OM6A 5I2ZA 1TVIA 1KUKA 3KECA 3LKAA 4H30A 1DMTA 4Q1LA 5D1SA 2DDYA 1R1HA 3HY7A 4GUYA 5I0LA 1CGFA 2OW2A 1JKYA 3Q2HA 1XFWA 2X3BA 4DD8A 1CGEA 1XURA 1HOVA 4I35A 4G9LA 1XFZA 3O64A 1USNA 1CQRA 3HDBA 1AYKA 5D1UA 1HTDA 4G0DA 1A86A 2WO9A 3K7NA 4CTHA 2OY4A 4H3XA 1UTTA 4IUWA 3BA0A 2WOAA 4I03A 456CA 1G4KA 1D7XA 3KWVC 1OZ9A 1SU3A 4XCTA 1ZP5A 2YIGA 1MMRA 3F17A 2OY2A 3ZVSA 2J0TA 2X3CA 1ZTQA 1JAPA 1BUVM 1HY7A 1CIZA 1HFCA 3LIKA 2OZRA 3KMEA 3LQ0A 5BPAA 1PWPA 3WV2A 1K7QA 1UMTA 3LUMA 2O3EA 2Y6DA 1PWUA 3KMCA 1OM8A 1XUDA 2AYKA 3HB2P 5D7WA 4H1QA 5H8XA 1KUHA 2YB9A 1XUCA 1EUBA 2EROA 2JNPA 1BIWA 4A7BA 1RM8A 4PKTA 3F16A 2OW0A 1Y0VA 2MLSA 5B5PA 2D1NA 2TCLA 3N2UA 3AYUA 2DW0A 1IAAA 4PKQA 1QUAA 4FXYP 1OO9A 1EAKA 4WKIA 3TS4A 4GQLA
chains in the Genus database with same CATH topology
1BUDA 2J83A 3KRYA 2JT6A 3P24A 1BM6A 3LK8A 4J4MA 4PKRA 3B8ZA 5BOTA 1D5JA 2HU6A 2DW1A 2AIGP 1GXDA 3GBOA 2RJPA 2JT5A 4QKZA 1I76A 4A3WA 1ZS0A 3DPFA 2DW2A 2W13A 1GE6A 1IABA 4H82A 4WF6A 1GKDA 1JH1A 1UMSA 3LJTA 1FBLA 1QJIA 3RTSA 1OS2A 2ERQA 2MZEA 5CXAA 4L6TA 3G42A 1XFYA 3TVCA 3Q2GA 1SLMA 1JJ9A 4DPEA 4IN9A 5I3MA 3NX7A 1R1IA 3KEJA 1C8TA 1XFXA 1YQYA 3N2VA 5L79A 2I47A 1QJJA 1CGLA 1IACA 2L0RA 3DWBA 1QIBA 1ROSA 1S4BP 1WNIA 1ASTA 3ELMA 3DTIA 1AF0A 5I43A 4IJOA 2MZHA 3V96B 1MNCA 1PWQA 2RJQA 3OHLA 5B5OA 4PKWA 1PWVA 2K2GA 1BQQM 1IAGA 5L7FA 1Z3JA 1BKCA 1DTHA 1R1JA 1YCMA 2A8HA 2W0DA 1K7GA 1OS9A 4WKEA 4GR0A 1FLSA 3HBVP 3E8RA 3DTEA 4WZVA 2MZIA 4AXQA 4FXQA 2OVZA 1BKCI 2V4BA 3DPEA 3K7LA 3U1RA 3LJGA 4H49A 2K9CA 3WV1A 2OVXA 3G5CA 3EDGA 2D1OA 1C7KA 4GR3A 4DV8A 3WV3A 3VTGA 2YUFA 3B92A 1YP1A 4AUOA 4AYKA 1G05A 1RMZA 3I7GA 1G49A 1HV5A 3HYGA 1SATA 3ZUKA 2DDFA 4L19A 5I4OA 2JIHA 1XFUA 3F19A 5D2BA 4JQGA 2FV5A 5D3CA 1IADA 1UEAA 1ZXVA 4DF9A 3EDHA 2MLRA 2ERPA 3EWJA 1JAQA 1G12A 4L7AA 2OI0A 3F18A 1MMQA 1AKLA 2KRJA 1EB6A 3EHYA 3ZXHA 4FU4A 1D8FA 1JIWP 1KUIA 1R55A 3TT4A 2N8RA 4H84A 5BOYA 4AIGA 3LMCA 5I12A 3HDAP 1R54A 1O0QA 4FVLA 4PKSA 1Q3AA 3UVCA 2FV9A 3LE9A 3I7IA 5LABA 2XS4A 1QIAA 1J7NA 1CK7A 1CAQA 4JA1A 3OHOA 4WK7A 4XM8A 4HMAA 3DTKA 1H71P 1JAOA 4JIJA 1GE5A 1BKCE 1C3IA 1B8YA 1OM7A 1GE7A 3DSLA 1ZVXA 3CKIA 2OW9A 1BZSA 1K7IA 1BSWA 2Y6CA 1SRPA 1KAPP 1O0TA 4L63A 3VI1A 2CLTA 3SHIA 3DL1A 4GWMA 2CKIA 1KUFA 2WO8A 4ZR5A 830CA 966CA 1UTZA 2OW1A 3F1AA 4GF1A 5D1TA 3HBUP 2E2DA 1CXVA 4JP4A 1YOUA 4XM7A 4XM6A 1Y93A 5JMYA 1BQOA 3MA2A 3EDZA 3L0TA 4R3VA 1G9KA 1JIZA 4GWNA 1XFVA 1KUGA 3AYKA 4HX3A 2PJTA 2W14A 3LQBA 3O2XA 1SMPA 3EDIA 1GO7P 2OXZA 1A85A 4JPAA 5CUHA 1QICA 4PKUA 2OXUA 5CZMA 1SLNA 1HFSA 3TSKA 1OMJA 2USNA 2POJA 1KBCA 2Z2DA 4H2EA 2XS3A 1FM1A 3DNGA 2W12A 4XBHA 1Y8JA 4PKVA 1GO8P 2O36A 1ATLA 4H76A 1JK3A 2SRTA 1MMPA 1GKCA 3LILA 2OXWA 2X7MA 3LUNA 2JSDA 4GR8A 3LGPA 1ND1A 1MMBA 1B3DA 3RTTA 1JANA 3LJZA 1D8MA 3P1VA 4ON1A 2W15A 3L0VA 1PWWA 4ILWD 3KEKA 1I73A 1IAEA 2E3XA 2QPJA 3AIGA 3LIRA 1L6JA 3B2ZA 3LEAA 1ZXCA 3KHIA 2X3AA 3USNA 3EHXA 3F15A 4EFSA 1I1IP 3HY9A 1OM6A 5I2ZA 1KUKA 3KECA 3LKAA 4H30A 1DMTA 4Q1LA 5D1SA 2DDYA 1R1HA 3HY7A 4GUYA 5I0LA 1CGFA 2OW2A 1JKYA 3Q2HA 1XFWA 2X3BA 4DD8A 1CGEA 1XURA 1HOVA 4I35A 4G9LA 1XFZA 3O64A 1USNA 1CQRA 3HDBA 1AYKA 5D1UA 1HTDA 4G0DA 1A86A 2WO9A 3K7NA 4CTHA 2OY4A 4H3XA 1UTTA 4IUWA 3BA0A 2WOAA 4I03A 456CA 1G4KA 1D7XA 3KWVC 1SU3A 4XCTA 1ZP5A 2YIGA 1MMRA 3F17A 2OY2A 3ZVSA 2J0TA 2X3CA 1ZTQA 1JAPA 1BUVM 1HY7A 1CIZA 1HFCA 3LIKA 2OZRA 3KMEA 3LQ0A 5BPAA 1PWPA 3WV2A 1K7QA 1UMTA 3LUMA 2O3EA 2Y6DA 1PWUA 3KMCA 1OM8A 1XUDA 2AYKA 3HB2P 5D7WA 4H1QA 5H8XA 1KUHA 2YB9A 1XUCA 1EUBA 2EROA 2JNPA 1BIWA 4A7BA 1RM8A 4PKTA 3F16A 2OW0A 1Y0VA 2MLSA 5B5PA 2D1NA 2TCLA 3N2UA 3AYUA 2DW0A 1IAAA 4PKQA 1QUAA 4FXYP 1OO9A 1EAKA 4WKIA 3TS4A 4GQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUD A;  2J83 A;  3KRY A;  2JT6 A;  3P24 A;  1BM6 A;  3LK8 A;  4J4M A;  4PKR A;  3B8Z A;  5BOT A;  1D5J A;  2HU6 A;  2DW1 A;  2AIG P;  1GXD A;  3GBO A;  2RJP A;  2JT5 A;  4QKZ A;  1I76 A;  4A3W A;  1ZS0 A;  3DPF A;  2DW2 A;  2W13 A;  1GE6 A;  1IAB A;  4H82 A;  4WF6 A;  1GKD A;  1JH1 A;  1UMS A;  3LJT A;  1FBL A;  1QJI A;  3RTS A;  1OS2 A;  2ERQ A;  2MZE A;  5CXA A;  4L6T A;  3G42 A;  1XFY A;  3TVC A;  3Q2G A;  1SLM A;  1JJ9 A;  4DPE A;  4IN9 A;  5I3M A;  3NX7 A;  1R1I A;  3KEJ A;  1C8T A;  1XFX A;  1YQY A;  3N2V A;  5L79 A;  2I47 A;  1QJJ A;  1CGL A;  1IAC A;  2L0R A;  3DWB A;  1QIB A;  1ROS A;  1S4B P;  1WNI A;  1AST A;  3ELM A;  1AF0 A;  5I43 A;  4IJO A;  2MZH A;  3V96 B;  1MNC A;  1PWQ A;  2RJQ A;  3OHL A;  5B5O A;  4PKW A;  1PWV A;  2K2G A;  1BQQ M;  1IAG A;  5L7F A;  1Z3J A;  1BKC A;  1DTH A;  1R1J A;  1YCM A;  2A8H A;  2W0D A;  1K7G A;  1OS9 A;  4WKE A;  4GR0 A;  1FLS A;  3HBV P;  3E8R A;  4WZV A;  2MZI A;  4AXQ A;  4FXQ A;  2OVZ A;  1BKC I;  2V4B A;  3DPE A;  3K7L A;  3U1R A;  3LJG A;  4H49 A;  2K9C A;  3WV1 A;  2OVX A;  3G5C A;  3EDG A;  2D1O A;  1C7K A;  4GR3 A;  4DV8 A;  3WV3 A;  3VTG A;  3B92 A;  1YP1 A;  4AUO A;  4AYK A;  1G05 A;  1RMZ A;  3I7G A;  1G49 A;  1HV5 A;  3HYG A;  1SAT A;  3ZUK A;  2DDF A;  4L19 A;  5I4O A;  2JIH A;  1XFU A;  3F19 A;  5D2B A;  4JQG A;  2FV5 A;  5D3C A;  1IAD A;  1UEA A;  1ZXV A;  4DF9 A;  3EDH A;  2MLR A;  2ERP A;  3EWJ A;  1JAQ A;  1G12 A;  2OI0 A;  3F18 A;  1MMQ A;  1AKL A;  2KRJ A;  1EB6 A;  3EHY A;  3ZXH A;  4FU4 A;  1D8F A;  1JIW P;  1KUI A;  1R55 A;  3TT4 A;  2N8R A;  4H84 A;  5BOY A;  4AIG A;  3LMC A;  5I12 A;  3HDA P;  1R54 A;  1O0Q A;  4FVL A;  4PKS A;  1Q3A A;  3UVC A;  2FV9 A;  3LE9 A;  3I7I A;  5LAB A;  2XS4 A;  1QIA A;  1J7N A;  1CK7 A;  1CAQ A;  4JA1 A;  3OHO A;  4WK7 A;  4XM8 A;  4HMA A;  1H71 P;  1JAO A;  4JIJ A;  1GE5 A;  1BKC E;  1C3I A;  1B8Y A;  1OM7 A;  1GE7 A;  3DSL A;  1ZVX A;  3CKI A;  2OW9 A;  1BZS A;  1K7I A;  1BSW A;  2Y6C A;  1SRP A;  1KAP P;  1O0T A;  4L63 A;  3VI1 A;  2CLT A;  3SHI A;  3DL1 A;  4GWM A;  2CKI A;  1KUF A;  2WO8 A;  4ZR5 A;  830C A;  966C A;  1UTZ A;  2OW1 A;  3F1A A;  4GF1 A;  5D1T A;  3HBU P;  2E2D A;  1CXV A;  4JP4 A;  1YOU A;  4XM7 A;  4XM6 A;  1Y93 A;  5JMY A;  1BQO A;  3MA2 A;  3EDZ A;  3L0T A;  4R3V A;  1G9K A;  1JIZ A;  4GWN A;  1XFV A;  1KUG A;  3AYK A;  4HX3 A;  2PJT A;  2W14 A;  3LQB A;  3O2X A;  1SMP A;  3EDI A;  1GO7 P;  2OXZ A;  1A85 A;  4JPA A;  5CUH A;  1QIC A;  4PKU A;  2OXU A;  5CZM A;  1SLN A;  1HFS A;  3TSK A;  1OMJ A;  2USN A;  2POJ A;  1KBC A;  2Z2D A;  4H2E A;  2XS3 A;  1FM1 A;  3DNG A;  2W12 A;  4XBH A;  1Y8J A;  4PKV A;  1GO8 P;  2O36 A;  1ATL A;  4H76 A;  1JK3 A;  2SRT A;  1MMP A;  1GKC A;  3LIL A;  2OXW A;  2X7M A;  3LUN A;  2JSD A;  4GR8 A;  3LGP A;  1ND1 A;  1MMB A;  1B3D A;  3RTT A;  1JAN A;  3LJZ A;  1D8M A;  3P1V A;  4ON1 A;  2W15 A;  3L0V A;  1PWW A;  4ILW D;  3KEK A;  1I73 A;  1IAE A;  2E3X A;  2QPJ A;  3AIG A;  3LIR A;  1L6J A;  3B2Z A;  3LEA A;  1ZXC A;  3KHI A;  2X3A A;  3USN A;  3EHX A;  3F15 A;  4EFS A;  1I1I P;  3HY9 A;  1OM6 A;  5I2Z A;  1KUK A;  3KEC A;  3LKA A;  4H30 A;  1DMT A;  4Q1L A;  5D1S A;  2DDY A;  1R1H A;  3HY7 A;  4GUY A;  5I0L A;  1CGF A;  2OW2 A;  1JKY A;  3Q2H A;  1XFW A;  2X3B A;  4DD8 A;  1CGE A;  1XUR A;  1HOV A;  4I35 A;  4G9L A;  1XFZ A;  3O64 A;  1USN A;  1CQR A;  3HDB A;  1AYK A;  5D1U A;  1HTD A;  4G0D A;  1A86 A;  2WO9 A;  3K7N A;  4CTH A;  2OY4 A;  4H3X A;  1UTT A;  4IUW A;  3BA0 A;  2WOA A;  4I03 A;  456C A;  1G4K A;  1D7X A;  3KWV C;  1SU3 A;  4XCT A;  1ZP5 A;  2YIG A;  1MMR A;  3F17 A;  2OY2 A;  3ZVS A;  2J0T A;  2X3C A;  1ZTQ A;  1JAP A;  1BUV M;  1HY7 A;  1CIZ A;  1HFC A;  3LIK A;  2OZR A;  3KME A;  3LQ0 A;  5BPA A;  1PWP A;  3WV2 A;  1K7Q A;  1UMT A;  3LUM A;  2O3E A;  2Y6D A;  1PWU A;  3KMC A;  1OM8 A;  1XUD A;  2AYK A;  3HB2 P;  5D7W A;  4H1Q A;  5H8X A;  1KUH A;  2YB9 A;  1XUC A;  1EUB A;  2ERO A;  2JNP A;  1BIW A;  4A7B A;  1RM8 A;  4PKT A;  3F16 A;  2OW0 A;  1Y0V A;  2MLS A;  5B5P A;  2D1N A;  2TCL A;  3N2U A;  3AYU A;  2DW0 A;  1IAA A;  4PKQ A;  1QUA A;  4FXY P;  1OO9 A;  1EAK A;  4WKI A;  3TS4 A;  4GQL A; 
#chains in the Genus database with same CATH topology
 1BUD A;  2J83 A;  3KRY A;  2JT6 A;  3P24 A;  1BM6 A;  3LK8 A;  4J4M A;  4PKR A;  3B8Z A;  5BOT A;  1D5J A;  2HU6 A;  2DW1 A;  2AIG P;  1GXD A;  3GBO A;  2RJP A;  2JT5 A;  4QKZ A;  1I76 A;  4A3W A;  1ZS0 A;  3DPF A;  2DW2 A;  2W13 A;  1GE6 A;  1IAB A;  4H82 A;  4WF6 A;  1GKD A;  1JH1 A;  1UMS A;  3LJT A;  1FBL A;  1QJI A;  3RTS A;  1OS2 A;  2ERQ A;  2MZE A;  5CXA A;  4L6T A;  3G42 A;  1XFY A;  3TVC A;  3Q2G A;  1SLM A;  1JJ9 A;  4DPE A;  4IN9 A;  5I3M A;  3NX7 A;  1R1I A;  3KEJ A;  1C8T A;  1XFX A;  1YQY A;  3N2V A;  5L79 A;  2I47 A;  1QJJ A;  1CGL A;  1IAC A;  2L0R A;  3DWB A;  1QIB A;  1ROS A;  1S4B P;  1WNI A;  1AST A;  3ELM A;  3DTI A;  1AF0 A;  5I43 A;  4IJO A;  2MZH A;  1XAX A;  3V96 B;  1MNC A;  1PWQ A;  2RJQ A;  3OHL A;  5B5O A;  4PKW A;  1PWV A;  2K2G A;  1BQQ M;  1IAG A;  5L7F A;  1Z3J A;  1BKC A;  1DTH A;  1R1J A;  1YCM A;  2A8H A;  2W0D A;  1K7G A;  1OS9 A;  4WKE A;  4GR0 A;  1FLS A;  3HBV P;  3E8R A;  3DTE A;  4WZV A;  2MZI A;  4AXQ A;  4FXQ A;  2OVZ A;  1BKC I;  2V4B A;  3DPE A;  3K7L A;  3U1R A;  3LJG A;  4H49 A;  2K9C A;  3WV1 A;  2OVX A;  3G5C A;  3EDG A;  2D1O A;  1C7K A;  4GR3 A;  4DV8 A;  3WV3 A;  3VTG A;  2YUF A;  3B92 A;  1YP1 A;  4AUO A;  4AYK A;  1G05 A;  1RMZ A;  3I7G A;  1G49 A;  1HV5 A;  3HYG A;  1SAT A;  3ZUK A;  2DDF A;  4L19 A;  5I4O A;  2JIH A;  1XFU A;  3F19 A;  5D2B A;  4JQG A;  2FV5 A;  5D3C A;  1IAD A;  1UEA A;  1ZXV A;  4DF9 A;  3EDH A;  2MLR A;  2ERP A;  3EWJ A;  1JAQ A;  1G12 A;  4L7A A;  2OI0 A;  3F18 A;  1MMQ A;  1AKL A;  2KRJ A;  1EB6 A;  3EHY A;  3ZXH A;  4FU4 A;  1D8F A;  1JIW P;  1KUI A;  1R55 A;  3TT4 A;  2N8R A;  4H84 A;  5BOY A;  4AIG A;  3LMC A;  5I12 A;  3HDA P;  1R54 A;  1O0Q A;  4FVL A;  4PKS A;  1Q3A A;  3UVC A;  2FV9 A;  3LE9 A;  3I7I A;  5LAB A;  2XS4 A;  1QIA A;  1J7N A;  1CK7 A;  1CAQ A;  4JA1 A;  3OHO A;  4WK7 A;  4XM8 A;  4HMA A;  3DTK A;  1H71 P;  1JAO A;  4JIJ A;  1GE5 A;  1BKC E;  1C3I A;  1B8Y A;  1OM7 A;  1GE7 A;  3DSL A;  1ZVX A;  3CKI A;  2OW9 A;  1BZS A;  1K7I A;  1BSW A;  2Y6C A;  1SRP A;  1KAP P;  1O0T A;  4L63 A;  3VI1 A;  2CLT A;  3SHI A;  3DL1 A;  4GWM A;  2CKI A;  1KUF A;  2WO8 A;  4ZR5 A;  830C A;  966C A;  1UTZ A;  2OW1 A;  3F1A A;  4GF1 A;  5D1T A;  3HBU P;  2E2D A;  1CXV A;  4JP4 A;  1YOU A;  4XM7 A;  4XM6 A;  1Y93 A;  5JMY A;  1BQO A;  3MA2 A;  3EDZ A;  3L0T A;  4R3V A;  1G9K A;  1JIZ A;  4GWN A;  1XFV A;  1KUG A;  3AYK A;  4HX3 A;  2PJT A;  2W14 A;  3LQB A;  3O2X A;  1SMP A;  3EDI A;  1GO7 P;  2OXZ A;  1A85 A;  4JPA A;  5CUH A;  1QIC A;  4PKU A;  2OXU A;  5CZM A;  1SLN A;  1HFS A;  3TSK A;  1OMJ A;  2USN A;  2POJ A;  1KBC A;  2Z2D A;  4H2E A;  2XS3 A;  1FM1 A;  3DNG A;  2W12 A;  4XBH A;  1Y8J A;  4PKV A;  1GO8 P;  2O36 A;  1ATL A;  4H76 A;  1JK3 A;  2SRT A;  1MMP A;  1GKC A;  3LIL A;  2OXW A;  2X7M A;  3LUN A;  2JSD A;  4GR8 A;  3LGP A;  1ND1 A;  1MMB A;  1B3D A;  3RTT A;  1JAN A;  3LJZ A;  1D8M A;  3P1V A;  4ON1 A;  1XM5 A;  2W15 A;  3L0V A;  1PWW A;  4ILW D;  3KEK A;  1I73 A;  1IAE A;  2E3X A;  2QPJ A;  3AIG A;  3LIR A;  1L6J A;  3B2Z A;  3LEA A;  1ZXC A;  3KHI A;  2X3A A;  3USN A;  3EHX A;  3F15 A;  4EFS A;  1I1I P;  3HY9 A;  1OM6 A;  5I2Z A;  1TVI A;  1KUK A;  3KEC A;  3LKA A;  4H30 A;  1DMT A;  4Q1L A;  5D1S A;  2DDY A;  1R1H A;  3HY7 A;  4GUY A;  5I0L A;  1CGF A;  2OW2 A;  1JKY A;  3Q2H A;  1XFW A;  2X3B A;  4DD8 A;  1CGE A;  1XUR A;  1HOV A;  4I35 A;  4G9L A;  1XFZ A;  3O64 A;  1USN A;  1CQR A;  3HDB A;  1AYK A;  5D1U A;  1HTD A;  4G0D A;  1A86 A;  2WO9 A;  3K7N A;  4CTH A;  2OY4 A;  4H3X A;  1UTT A;  4IUW A;  3BA0 A;  2WOA A;  4I03 A;  456C A;  1G4K A;  1D7X A;  3KWV C;  1OZ9 A;  1SU3 A;  4XCT A;  1ZP5 A;  2YIG A;  1MMR A;  3F17 A;  2OY2 A;  3ZVS A;  2J0T A;  2X3C A;  1ZTQ A;  1JAP A;  1BUV M;  1HY7 A;  1CIZ A;  1HFC A;  3LIK A;  2OZR A;  3KME A;  3LQ0 A;  5BPA A;  1PWP A;  3WV2 A;  1K7Q A;  1UMT A;  3LUM A;  2O3E A;  2Y6D A;  1PWU A;  3KMC A;  1OM8 A;  1XUD A;  2AYK A;  3HB2 P;  5D7W A;  4H1Q A;  5H8X A;  1KUH A;  2YB9 A;  1XUC A;  1EUB A;  2ERO A;  2JNP A;  1BIW A;  4A7B A;  1RM8 A;  4PKT A;  3F16 A;  2OW0 A;  1Y0V A;  2MLS A;  5B5P A;  2D1N A;  2TCL A;  3N2U A;  3AYU A;  2DW0 A;  1IAA A;  4PKQ A;  1QUA A;  4FXY P;  1OO9 A;  1EAK A;  4WKI A;  3TS4 A;  4GQL A; 
#chains in the Genus database with same CATH homology
 1BUD A;  2J83 A;  3KRY A;  2JT6 A;  3P24 A;  1BM6 A;  3LK8 A;  4J4M A;  4PKR A;  3B8Z A;  5BOT A;  1D5J A;  2HU6 A;  2DW1 A;  2AIG P;  1GXD A;  3GBO A;  2RJP A;  2JT5 A;  4QKZ A;  1I76 A;  4A3W A;  1ZS0 A;  3DPF A;  2DW2 A;  2W13 A;  1GE6 A;  1IAB A;  4H82 A;  4WF6 A;  1GKD A;  1JH1 A;  1UMS A;  3LJT A;  1FBL A;  1QJI A;  3RTS A;  1OS2 A;  2ERQ A;  2MZE A;  5CXA A;  4L6T A;  3G42 A;  1XFY A;  3TVC A;  3Q2G A;  1SLM A;  1JJ9 A;  4DPE A;  4IN9 A;  5I3M A;  3NX7 A;  1R1I A;  3KEJ A;  1C8T A;  1XFX A;  1YQY A;  3N2V A;  5L79 A;  2I47 A;  1QJJ A;  1CGL A;  1IAC A;  2L0R A;  3DWB A;  1QIB A;  1ROS A;  1S4B P;  1WNI A;  1AST A;  3ELM A;  3DTI A;  1AF0 A;  5I43 A;  4IJO A;  2MZH A;  3V96 B;  1MNC A;  1PWQ A;  2RJQ A;  3OHL A;  5B5O A;  4PKW A;  1PWV A;  2K2G A;  1BQQ M;  1IAG A;  5L7F A;  1Z3J A;  1BKC A;  1DTH A;  1R1J A;  1YCM A;  2A8H A;  2W0D A;  1K7G A;  1OS9 A;  4WKE A;  4GR0 A;  1FLS A;  3HBV P;  3E8R A;  3DTE A;  4WZV A;  2MZI A;  4AXQ A;  4FXQ A;  2OVZ A;  1BKC I;  2V4B A;  3DPE A;  3K7L A;  3U1R A;  3LJG A;  4H49 A;  2K9C A;  3WV1 A;  2OVX A;  3G5C A;  3EDG A;  2D1O A;  1C7K A;  4GR3 A;  4DV8 A;  3WV3 A;  3VTG A;  2YUF A;  3B92 A;  1YP1 A;  4AUO A;  4AYK A;  1G05 A;  1RMZ A;  3I7G A;  1G49 A;  1HV5 A;  3HYG A;  1SAT A;  3ZUK A;  2DDF A;  4L19 A;  5I4O A;  2JIH A;  1XFU A;  3F19 A;  5D2B A;  4JQG A;  2FV5 A;  5D3C A;  1IAD A;  1UEA A;  1ZXV A;  4DF9 A;  3EDH A;  2MLR A;  2ERP A;  3EWJ A;  1JAQ A;  1G12 A;  4L7A A;  2OI0 A;  3F18 A;  1MMQ A;  1AKL A;  2KRJ A;  1EB6 A;  3EHY A;  3ZXH A;  4FU4 A;  1D8F A;  1JIW P;  1KUI A;  1R55 A;  3TT4 A;  2N8R A;  4H84 A;  5BOY A;  4AIG A;  3LMC A;  5I12 A;  3HDA P;  1R54 A;  1O0Q A;  4FVL A;  4PKS A;  1Q3A A;  3UVC A;  2FV9 A;  3LE9 A;  3I7I A;  5LAB A;  2XS4 A;  1QIA A;  1J7N A;  1CK7 A;  1CAQ A;  4JA1 A;  3OHO A;  4WK7 A;  4XM8 A;  4HMA A;  3DTK A;  1H71 P;  1JAO A;  4JIJ A;  1GE5 A;  1BKC E;  1C3I A;  1B8Y A;  1OM7 A;  1GE7 A;  3DSL A;  1ZVX A;  3CKI A;  2OW9 A;  1BZS A;  1K7I A;  1BSW A;  2Y6C A;  1SRP A;  1KAP P;  1O0T A;  4L63 A;  3VI1 A;  2CLT A;  3SHI A;  3DL1 A;  4GWM A;  2CKI A;  1KUF A;  2WO8 A;  4ZR5 A;  830C A;  966C A;  1UTZ A;  2OW1 A;  3F1A A;  4GF1 A;  5D1T A;  3HBU P;  2E2D A;  1CXV A;  4JP4 A;  1YOU A;  4XM7 A;  4XM6 A;  1Y93 A;  5JMY A;  1BQO A;  3MA2 A;  3EDZ A;  3L0T A;  4R3V A;  1G9K A;  1JIZ A;  4GWN A;  1XFV A;  1KUG A;  3AYK A;  4HX3 A;  2PJT A;  2W14 A;  3LQB A;  3O2X A;  1SMP A;  3EDI A;  1GO7 P;  2OXZ A;  1A85 A;  4JPA A;  5CUH A;  1QIC A;  4PKU A;  2OXU A;  5CZM A;  1SLN A;  1HFS A;  3TSK A;  1OMJ A;  2USN A;  2POJ A;  1KBC A;  2Z2D A;  4H2E A;  2XS3 A;  1FM1 A;  3DNG A;  2W12 A;  4XBH A;  1Y8J A;  4PKV A;  1GO8 P;  2O36 A;  1ATL A;  4H76 A;  1JK3 A;  2SRT A;  1MMP A;  1GKC A;  3LIL A;  2OXW A;  2X7M A;  3LUN A;  2JSD A;  4GR8 A;  3LGP A;  1ND1 A;  1MMB A;  1B3D A;  3RTT A;  1JAN A;  3LJZ A;  1D8M A;  3P1V A;  4ON1 A;  2W15 A;  3L0V A;  1PWW A;  4ILW D;  3KEK A;  1I73 A;  1IAE A;  2E3X A;  2QPJ A;  3AIG A;  3LIR A;  1L6J A;  3B2Z A;  3LEA A;  1ZXC A;  3KHI A;  2X3A A;  3USN A;  3EHX A;  3F15 A;  4EFS A;  1I1I P;  3HY9 A;  1OM6 A;  5I2Z A;  1KUK A;  3KEC A;  3LKA A;  4H30 A;  1DMT A;  4Q1L A;  5D1S A;  2DDY A;  1R1H A;  3HY7 A;  4GUY A;  5I0L A;  1CGF A;  2OW2 A;  1JKY A;  3Q2H A;  1XFW A;  2X3B A;  4DD8 A;  1CGE A;  1XUR A;  1HOV A;  4I35 A;  4G9L A;  1XFZ A;  3O64 A;  1USN A;  1CQR A;  3HDB A;  1AYK A;  5D1U A;  1HTD A;  4G0D A;  1A86 A;  2WO9 A;  3K7N A;  4CTH A;  2OY4 A;  4H3X A;  1UTT A;  4IUW A;  3BA0 A;  2WOA A;  4I03 A;  456C A;  1G4K A;  1D7X A;  3KWV C;  1SU3 A;  4XCT A;  1ZP5 A;  2YIG A;  1MMR A;  3F17 A;  2OY2 A;  3ZVS A;  2J0T A;  2X3C A;  1ZTQ A;  1JAP A;  1BUV M;  1HY7 A;  1CIZ A;  1HFC A;  3LIK A;  2OZR A;  3KME A;  3LQ0 A;  5BPA A;  1PWP A;  3WV2 A;  1K7Q A;  1UMT A;  3LUM A;  2O3E A;  2Y6D A;  1PWU A;  3KMC A;  1OM8 A;  1XUD A;  2AYK A;  3HB2 P;  5D7W A;  4H1Q A;  5H8X A;  1KUH A;  2YB9 A;  1XUC A;  1EUB A;  2ERO A;  2JNP A;  1BIW A;  4A7B A;  1RM8 A;  4PKT A;  3F16 A;  2OW0 A;  1Y0V A;  2MLS A;  5B5P A;  2D1N A;  2TCL A;  3N2U A;  3AYU A;  2DW0 A;  1IAA A;  4PKQ A;  1QUA A;  4FXY P;  1OO9 A;  1EAK A;  4WKI A;  3TS4 A;  4GQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...