3OHLA

Catalytic domain of stromelysin-1 in complex with n-hydroxy-2-(4-methoxy-n-(pyridine-3-ylmethyl)phenylsulfonamido)acetamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
159
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANALMYPLYHRFRLSQDDINGIQSLYGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Stromelysin-1
publication title Non-Resonance Raman Difference Spectroscopy as a Tool to Probe Enthalpy-Entropy Compensation and the Interfacial Mobility Model
rcsb
source organism Homo sapiens
total genus 47
structure length 159
sequence length 167
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ohlA00
1DTHA 1JK3A 2JNPA 3HBVP 2I47A 1JIZA 1KUGA 1BIWA 1ZTQA 2FV5A 2OZRA 1PWQA 1PWVA 4AXQA 1JANA 3LUNA 1BUDA 1BZSA 2N8RA 3HDBA 3USNA 1JH1A 4GUYA 3ZXHA 2EROA 1FLSA 1ND1A 3F18A 1XFVA 2SRTA 2JT6A 5BOTA 1OM6A 1AF0A 3LK8A 1XFXA 2OW1A 1IADA 3EWJA 5I2ZA 1G9KA 1SU3A 1I1IP 1A85A 1XFUA 1R54A 3EHXA 2J83A 4JPAA 3KHIA 1UEAA 4GR3A 2Z2DA 1H71P 3LJTA 2O3EA 1GE5A 5CXAA 1QIAA 1XFWA 4QKZA 966CA 5BOYA 1HOVA 2JIHA 4XM8A 3LJGA 4PKVA 1XFZA 1YCMA 5CZMA 1ZS0A 1B3DA 1QICA 1PWUA 3I7IA 1SATA 5D1SA 2X3CA 4GF1A 2V4BA 1XUDA 1DMTA 1OO9A 3DL1A 1JIWP 1HFSA 1R1HA 1SMPA 3TT4A 1CIZA 3LUMA 3I7GA 1Y0VA 5D1UA 1Y93A 2D1OA 5D3CA 2OI0A 3LEAA 1UMSA 1RM8A 2D1NA 3WV1A 3P24A 1CXVA 1GKCA 3F15A 1O0QA 1ZVXA 2J0TA 3P1VA 3OHLA 1GE6A 1QJIA 3BA0A 2W0DA 5I4OA 1CAQA 1BQOA 1MMPA 1UTTA 1YQYA 4WKEA 3LIKA 4PKQA 2DW1A 4WF6A 1GO8P 2AYKA 2OXUA 1GKDA 3DPEA 2OVXA 1I73A 2AIGP 1R1JA 3K7NA 4R3VA 3EHYA 3LJZA 5BPAA 2WO8A 2DW2A 4Q1LA 2Y6DA 4I35A 1K7QA 2XS3A 1I76A 1RMZA 3HBUP 1OM8A 4JIJA 3UVCA 2X7MA 4FXQA 3F16A 3Q2GA 4IUWA 4AUOA 2K2GA 1Y8JA 3RTSA 4H1QA 3AYUA 1SLNA 2Y6CA 1ZP5A 2MZHA 1K7IA 3TVCA 3GBOA 5H8XA 2E3XA 3KECA 3KMCA 2O36A 3LQBA 3KMEA 1OS9A 1OMJA 1CGLA 2TCLA 2OY2A 1FM1A 1FBLA 1CGEA 1BSWA 4ILWD 4GQLA 4H76A 1QIBA 1XFYA 1UMTA 3KRYA 4FVLA 3K7LA 2HU6A 3EDZA 1ZXCA 1OS2A 1C8TA 3B8ZA 2DW0A 3L0VA 2ERQA 1AYKA 4JP4A 3KEJA 4GR8A 1JKYA 1USNA 3RTTA 1HV5A 4PKWA 1D5JA 2DDFA 830CA 1MMRA 2X3AA 1MMQA 1ATLA 1IAGA 3O2XA 1K7GA 3F17A 3Q2HA 4L63A 4J4MA 3U1RA 4PKUA 3WV3A 2W14A 1BQQM 2CLTA 4PKSA 3WV2A 4IN9A 1HY7A 5B5OA 4WKIA 1YOUA 4H30A 4WK7A 1Q3AA 1G12A 4XCTA 3EDHA 2YIGA 1PWPA 4H84A 1YP1A 1JAOA 1Z3JA 4CTHA 3ZUKA 5B5PA 1BUVM 1G05A 1B8YA 3G5CA 1L6JA 1WNIA 1JJ9A 1ROSA 1IACA 2YB9A 1UTZA 3F19A 4I03A 3AIGA 1BKCI 3LILA 3KWVC 3MA2A 2USNA 1HFCA 3ZVSA 2RJPA 1D8MA 3EDIA 4AYKA 5D7WA 3VI1A 2JSDA 2W15A 4JA1A 4JQGA 1XUCA 5I43A 1G4KA 1MMBA 3HYGA 5LABA 4EFSA 4DV8A 1HTDA 3L0TA 2OW2A 2K9CA 4XM6A 2KRJA 2OXWA 1R55A 3DNGA 4WZVA 2ERPA 2L0RA 4ON1A 1J7NA 3E8RA 4FXYP 4ZR5A 1KUHA 3HY7A 3AYKA 2JT5A 1EUBA 3V96B 1ZXVA 3DPFA 3LGPA 1AKLA 5I3MA 3TSKA 1EB6A 1BKCE 4GWMA 2QPJA 2XS4A 1GXDA 4H2EA 4DPEA 3LQ0A 2A8HA 2MLRA 5D1TA 4H49A 4AIGA 1JAPA 5L79A 1OM7A 1SLMA 3ELMA 1D7XA 4IJOA 1GE7A 5JMYA 3O64A 1IAEA 3VTGA 3B2ZA 1QJJA 3G42A 1PWWA 3LIRA 4PKTA 3CKIA 3LMCA 3B92A 4A7BA 2OVZA 4FU4A 4DD8A 2OW0A 1CK7A 1G49A 3DSLA 3EDGA 2POJA 3KEKA 1C3IA 1GO7P 3NX7A 4GWNA 2OXZA 1S4BP 5I0LA 2PJTA 1IAAA 3HY9A 2W13A 2MZEA 3HB2P 456CA 3SHIA 1CGFA 3LE9A 4L19A 1XURA 3F1AA 4L6TA 1IABA 4HX3A 1O0TA 1CQRA 1MNCA 2OY4A 2MZIA 3OHOA 4H3XA 3DWBA 1BKCA 4DF9A 2DDYA 1D8FA 1QUAA 5L7FA 2E2DA 4G0DA 4XBHA 1KUIA 2WO9A 2WOAA 3N2UA 3LKAA 4GR0A 1A86A 5D2BA 1EAKA 1KBCA 1JAQA 1ASTA 1KUKA 4G9LA 2MLSA 2OW9A 1KAPP 4A3WA 2W12A 3TS4A 1KUFA 5CUHA 1SRPA 2X3BA 2RJQA 4H82A 1BM6A 2CKIA 5I12A 4XM7A 3HDAP 4HMAA 1C7KA 2FV9A 1R1IA 4PKRA 3N2VA
chains in the Genus database with same CATH superfamily
1DTHA 1JK3A 2JNPA 3HBVP 2YUFA 2I47A 3DTKA 1JIZA 1OZ9A 1KUGA 1BIWA 1ZTQA 2FV5A 2OZRA 1PWQA 1PWVA 4AXQA 1JANA 3LUNA 1BUDA 1BZSA 2N8RA 3HDBA 3USNA 1JH1A 4GUYA 3ZXHA 2EROA 1FLSA 1ND1A 3F18A 1XFVA 2SRTA 2JT6A 5BOTA 1OM6A 1AF0A 3LK8A 1XFXA 2OW1A 1IADA 3EWJA 5I2ZA 1G9KA 1SU3A 1I1IP 1A85A 1XFUA 1R54A 3EHXA 2J83A 4JPAA 3KHIA 1UEAA 4GR3A 2Z2DA 1H71P 3LJTA 2O3EA 1GE5A 5CXAA 1QIAA 1XFWA 4QKZA 966CA 5BOYA 1HOVA 2JIHA 4XM8A 3LJGA 4PKVA 1XFZA 1YCMA 5CZMA 1ZS0A 1B3DA 1QICA 1PWUA 3I7IA 1SATA 5D1SA 2X3CA 4GF1A 2V4BA 1XUDA 1DMTA 1OO9A 3DL1A 1JIWP 1HFSA 1R1HA 1SMPA 3TT4A 1CIZA 3LUMA 3I7GA 1Y0VA 5D1UA 1Y93A 2D1OA 5D3CA 2OI0A 3LEAA 1UMSA 1RM8A 2D1NA 3WV1A 3P24A 1CXVA 1GKCA 3F15A 1O0QA 1ZVXA 2J0TA 3DTEA 3P1VA 3OHLA 1GE6A 1QJIA 3BA0A 2W0DA 5I4OA 1CAQA 1BQOA 1MMPA 1UTTA 1YQYA 4WKEA 3LIKA 4PKQA 2DW1A 4WF6A 1GO8P 2AYKA 2OXUA 1GKDA 3DPEA 2OVXA 1I73A 2AIGP 1R1JA 3K7NA 4R3VA 3EHYA 3LJZA 5BPAA 2WO8A 2DW2A 4Q1LA 2Y6DA 4I35A 1K7QA 2XS3A 1I76A 1RMZA 3HBUP 1OM8A 4JIJA 3UVCA 2X7MA 4FXQA 3F16A 3Q2GA 4IUWA 4AUOA 2K2GA 1Y8JA 3RTSA 4H1QA 3AYUA 1SLNA 2Y6CA 1ZP5A 2MZHA 1K7IA 3TVCA 3GBOA 5H8XA 2E3XA 3KECA 3KMCA 2O36A 3LQBA 3KMEA 1OS9A 1OMJA 1CGLA 2TCLA 2OY2A 1FM1A 1FBLA 1CGEA 1BSWA 4ILWD 4GQLA 4H76A 1QIBA 1XFYA 1UMTA 3KRYA 4FVLA 3K7LA 2HU6A 3EDZA 1ZXCA 1OS2A 1C8TA 3B8ZA 2DW0A 3L0VA 2ERQA 1AYKA 4JP4A 3KEJA 4GR8A 1JKYA 1USNA 3RTTA 1HV5A 4PKWA 1XM5A 1D5JA 2DDFA 830CA 1MMRA 2X3AA 1MMQA 1ATLA 1IAGA 3O2XA 1K7GA 3F17A 3Q2HA 4L63A 4J4MA 3U1RA 4PKUA 3WV3A 2W14A 1BQQM 2CLTA 4PKSA 3WV2A 4IN9A 1HY7A 5B5OA 4WKIA 1YOUA 4H30A 4WK7A 1Q3AA 1G12A 4XCTA 3EDHA 2YIGA 1PWPA 4H84A 1YP1A 1JAOA 1Z3JA 4CTHA 3ZUKA 4L7AA 5B5PA 1BUVM 1G05A 1B8YA 3G5CA 1L6JA 1WNIA 1JJ9A 1ROSA 1IACA 2YB9A 1UTZA 3F19A 4I03A 3AIGA 1BKCI 3LILA 3KWVC 3MA2A 3DTIA 2USNA 1HFCA 3ZVSA 2RJPA 1D8MA 3EDIA 4AYKA 5D7WA 3VI1A 2JSDA 2W15A 4JA1A 4JQGA 1XUCA 5I43A 1G4KA 1MMBA 3HYGA 5LABA 4EFSA 4DV8A 1HTDA 3L0TA 2OW2A 2K9CA 4XM6A 2KRJA 2OXWA 1R55A 3DNGA 4WZVA 2ERPA 2L0RA 4ON1A 1J7NA 3E8RA 4FXYP 4ZR5A 1KUHA 3HY7A 3AYKA 2JT5A 1EUBA 3V96B 1ZXVA 3DPFA 3LGPA 1AKLA 5I3MA 3TSKA 1EB6A 1BKCE 4GWMA 2QPJA 2XS4A 1GXDA 4H2EA 4DPEA 3LQ0A 2A8HA 2MLRA 5D1TA 4H49A 4AIGA 1JAPA 5L79A 1OM7A 1SLMA 3ELMA 1D7XA 4IJOA 1GE7A 5JMYA 3O64A 1IAEA 3VTGA 3B2ZA 1QJJA 3G42A 1PWWA 3LIRA 4PKTA 3CKIA 3LMCA 3B92A 4A7BA 2OVZA 4FU4A 4DD8A 2OW0A 1CK7A 1G49A 3DSLA 3EDGA 2POJA 3KEKA 1C3IA 1GO7P 3NX7A 4GWNA 2OXZA 1TVIA 1S4BP 5I0LA 2PJTA 1IAAA 3HY9A 2W13A 2MZEA 3HB2P 456CA 3SHIA 1CGFA 3LE9A 4L19A 1XURA 3F1AA 4L6TA 1IABA 4HX3A 1O0TA 1CQRA 1MNCA 2OY4A 2MZIA 3OHOA 4H3XA 3DWBA 1BKCA 4DF9A 2DDYA 1D8FA 1QUAA 5L7FA 2E2DA 4G0DA 4XBHA 1KUIA 2WO9A 2WOAA 3N2UA 3LKAA 4GR0A 1A86A 5D2BA 1EAKA 1KBCA 1JAQA 1ASTA 1KUKA 1XAXA 4G9LA 2MLSA 2OW9A 1KAPP 4A3WA 2W12A 3TS4A 1KUFA 5CUHA 1SRPA 2X3BA 2RJQA 4H82A 1BM6A 2CKIA 5I12A 4XM7A 3HDAP 4HMAA 1C7KA 2FV9A 1R1IA 4PKRA 3N2VA
chains in the Genus database with same CATH topology
1DTHA 1JK3A 2JNPA 3HBVP 2YUFA 2I47A 3DTKA 1JIZA 1KUGA 1BIWA 1ZTQA 2FV5A 2OZRA 1PWQA 1PWVA 4AXQA 1JANA 3LUNA 1BUDA 1BZSA 2N8RA 3HDBA 3USNA 1JH1A 4GUYA 3ZXHA 2EROA 1FLSA 1ND1A 3F18A 1XFVA 2SRTA 2JT6A 5BOTA 1OM6A 1AF0A 3LK8A 1XFXA 2OW1A 1IADA 3EWJA 5I2ZA 1G9KA 1SU3A 1I1IP 1A85A 1XFUA 1R54A 3EHXA 2J83A 4JPAA 3KHIA 1UEAA 4GR3A 2Z2DA 1H71P 3LJTA 2O3EA 1GE5A 5CXAA 1QIAA 1XFWA 4QKZA 966CA 5BOYA 1HOVA 2JIHA 4XM8A 3LJGA 4PKVA 1XFZA 1YCMA 5CZMA 1ZS0A 1B3DA 1QICA 1PWUA 3I7IA 1SATA 5D1SA 2X3CA 4GF1A 2V4BA 1XUDA 1DMTA 1OO9A 3DL1A 1JIWP 1HFSA 1R1HA 1SMPA 3TT4A 1CIZA 3LUMA 3I7GA 1Y0VA 5D1UA 1Y93A 2D1OA 5D3CA 2OI0A 3LEAA 1UMSA 1RM8A 2D1NA 3WV1A 3P24A 1CXVA 1GKCA 3F15A 1O0QA 1ZVXA 2J0TA 3DTEA 3P1VA 3OHLA 1GE6A 1QJIA 3BA0A 2W0DA 5I4OA 1CAQA 1BQOA 1MMPA 1UTTA 1YQYA 4WKEA 3LIKA 4PKQA 2DW1A 4WF6A 1GO8P 2AYKA 2OXUA 1GKDA 3DPEA 2OVXA 1I73A 2AIGP 1R1JA 3K7NA 4R3VA 3EHYA 3LJZA 5BPAA 2WO8A 2DW2A 4Q1LA 2Y6DA 4I35A 1K7QA 2XS3A 1I76A 1RMZA 3HBUP 1OM8A 4JIJA 3UVCA 2X7MA 4FXQA 3F16A 3Q2GA 4IUWA 4AUOA 2K2GA 1Y8JA 3RTSA 4H1QA 3AYUA 1SLNA 2Y6CA 1ZP5A 2MZHA 1K7IA 3TVCA 3GBOA 5H8XA 2E3XA 3KECA 3KMCA 2O36A 3LQBA 3KMEA 1OS9A 1OMJA 1CGLA 2TCLA 2OY2A 1FM1A 1FBLA 1CGEA 1BSWA 4ILWD 4GQLA 4H76A 1QIBA 1XFYA 1UMTA 3KRYA 4FVLA 3K7LA 2HU6A 3EDZA 1ZXCA 1OS2A 1C8TA 3B8ZA 2DW0A 3L0VA 2ERQA 1AYKA 4JP4A 3KEJA 4GR8A 1JKYA 1USNA 3RTTA 1HV5A 4PKWA 1D5JA 2DDFA 830CA 1MMRA 2X3AA 1MMQA 1ATLA 1IAGA 3O2XA 1K7GA 3F17A 3Q2HA 4L63A 4J4MA 3U1RA 4PKUA 3WV3A 2W14A 1BQQM 2CLTA 4PKSA 3WV2A 4IN9A 1HY7A 5B5OA 4WKIA 1YOUA 4H30A 4WK7A 1Q3AA 1G12A 4XCTA 3EDHA 2YIGA 1PWPA 4H84A 1YP1A 1JAOA 1Z3JA 4CTHA 3ZUKA 4L7AA 5B5PA 1BUVM 1G05A 1B8YA 3G5CA 1L6JA 1WNIA 1JJ9A 1ROSA 1IACA 2YB9A 1UTZA 3F19A 4I03A 3AIGA 1BKCI 3LILA 3KWVC 3MA2A 3DTIA 2USNA 1HFCA 3ZVSA 2RJPA 1D8MA 3EDIA 4AYKA 5D7WA 3VI1A 2JSDA 2W15A 4JA1A 4JQGA 1XUCA 5I43A 1G4KA 1MMBA 3HYGA 5LABA 4EFSA 4DV8A 1HTDA 3L0TA 2OW2A 2K9CA 4XM6A 2KRJA 2OXWA 1R55A 3DNGA 4WZVA 2ERPA 2L0RA 4ON1A 1J7NA 3E8RA 4FXYP 4ZR5A 1KUHA 3HY7A 3AYKA 2JT5A 1EUBA 3V96B 1ZXVA 3DPFA 3LGPA 1AKLA 5I3MA 3TSKA 1EB6A 1BKCE 4GWMA 2QPJA 2XS4A 1GXDA 4H2EA 4DPEA 3LQ0A 2A8HA 2MLRA 5D1TA 4H49A 4AIGA 1JAPA 5L79A 1OM7A 1SLMA 3ELMA 1D7XA 4IJOA 1GE7A 5JMYA 3O64A 1IAEA 3VTGA 3B2ZA 1QJJA 3G42A 1PWWA 3LIRA 4PKTA 3CKIA 3LMCA 3B92A 4A7BA 2OVZA 4FU4A 4DD8A 2OW0A 1CK7A 1G49A 3DSLA 3EDGA 2POJA 3KEKA 1C3IA 1GO7P 3NX7A 4GWNA 2OXZA 1S4BP 5I0LA 2PJTA 1IAAA 3HY9A 2W13A 2MZEA 3HB2P 456CA 3SHIA 1CGFA 3LE9A 4L19A 1XURA 3F1AA 4L6TA 1IABA 4HX3A 1O0TA 1CQRA 1MNCA 2OY4A 2MZIA 3OHOA 4H3XA 3DWBA 1BKCA 4DF9A 2DDYA 1D8FA 1QUAA 5L7FA 2E2DA 4G0DA 4XBHA 1KUIA 2WO9A 2WOAA 3N2UA 3LKAA 4GR0A 1A86A 5D2BA 1EAKA 1KBCA 1JAQA 1ASTA 1KUKA 4G9LA 2MLSA 2OW9A 1KAPP 4A3WA 2W12A 3TS4A 1KUFA 5CUHA 1SRPA 2X3BA 2RJQA 4H82A 1BM6A 2CKIA 5I12A 4XM7A 3HDAP 4HMAA 1C7KA 2FV9A 1R1IA 4PKRA 3N2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTH A;  1JK3 A;  2JNP A;  3HBV P;  2I47 A;  1JIZ A;  1KUG A;  1BIW A;  1ZTQ A;  2FV5 A;  2OZR A;  1PWQ A;  1PWV A;  4AXQ A;  1JAN A;  3LUN A;  1BUD A;  1BZS A;  2N8R A;  3HDB A;  3USN A;  1JH1 A;  4GUY A;  3ZXH A;  2ERO A;  1FLS A;  1ND1 A;  3F18 A;  1XFV A;  2SRT A;  2JT6 A;  5BOT A;  1OM6 A;  1AF0 A;  3LK8 A;  1XFX A;  2OW1 A;  1IAD A;  3EWJ A;  5I2Z A;  1G9K A;  1SU3 A;  1I1I P;  1A85 A;  1XFU A;  1R54 A;  3EHX A;  2J83 A;  4JPA A;  3KHI A;  1UEA A;  4GR3 A;  2Z2D A;  1H71 P;  3LJT A;  2O3E A;  1GE5 A;  5CXA A;  1QIA A;  1XFW A;  4QKZ A;  966C A;  5BOY A;  1HOV A;  2JIH A;  4XM8 A;  3LJG A;  4PKV A;  1XFZ A;  1YCM A;  5CZM A;  1ZS0 A;  1B3D A;  1QIC A;  1PWU A;  3I7I A;  1SAT A;  5D1S A;  2X3C A;  4GF1 A;  2V4B A;  1XUD A;  1DMT A;  1OO9 A;  3DL1 A;  1JIW P;  1HFS A;  1R1H A;  1SMP A;  3TT4 A;  1CIZ A;  3LUM A;  3I7G A;  1Y0V A;  5D1U A;  1Y93 A;  2D1O A;  5D3C A;  2OI0 A;  3LEA A;  1UMS A;  1RM8 A;  2D1N A;  3WV1 A;  3P24 A;  1CXV A;  1GKC A;  3F15 A;  1O0Q A;  1ZVX A;  2J0T A;  3P1V A;  3OHL A;  1GE6 A;  1QJI A;  3BA0 A;  2W0D A;  5I4O A;  1CAQ A;  1BQO A;  1MMP A;  1UTT A;  1YQY A;  4WKE A;  3LIK A;  4PKQ A;  2DW1 A;  4WF6 A;  1GO8 P;  2AYK A;  2OXU A;  1GKD A;  3DPE A;  2OVX A;  1I73 A;  2AIG P;  1R1J A;  3K7N A;  4R3V A;  3EHY A;  3LJZ A;  5BPA A;  2WO8 A;  2DW2 A;  4Q1L A;  2Y6D A;  4I35 A;  1K7Q A;  2XS3 A;  1I76 A;  1RMZ A;  3HBU P;  1OM8 A;  4JIJ A;  3UVC A;  2X7M A;  4FXQ A;  3F16 A;  3Q2G A;  4IUW A;  4AUO A;  2K2G A;  1Y8J A;  3RTS A;  4H1Q A;  3AYU A;  1SLN A;  2Y6C A;  1ZP5 A;  2MZH A;  1K7I A;  3TVC A;  3GBO A;  5H8X A;  2E3X A;  3KEC A;  3KMC A;  2O36 A;  3LQB A;  3KME A;  1OS9 A;  1OMJ A;  1CGL A;  2TCL A;  2OY2 A;  1FM1 A;  1FBL A;  1CGE A;  1BSW A;  4ILW D;  4GQL A;  4H76 A;  1QIB A;  1XFY A;  1UMT A;  3KRY A;  4FVL A;  3K7L A;  2HU6 A;  3EDZ A;  1ZXC A;  1OS2 A;  1C8T A;  3B8Z A;  2DW0 A;  3L0V A;  2ERQ A;  1AYK A;  4JP4 A;  3KEJ A;  4GR8 A;  1JKY A;  1USN A;  3RTT A;  1HV5 A;  4PKW A;  1D5J A;  2DDF A;  830C A;  1MMR A;  2X3A A;  1MMQ A;  1ATL A;  1IAG A;  3O2X A;  1K7G A;  3F17 A;  3Q2H A;  4L63 A;  4J4M A;  3U1R A;  4PKU A;  3WV3 A;  2W14 A;  1BQQ M;  2CLT A;  4PKS A;  3WV2 A;  4IN9 A;  1HY7 A;  5B5O A;  4WKI A;  1YOU A;  4H30 A;  4WK7 A;  1Q3A A;  1G12 A;  4XCT A;  3EDH A;  2YIG A;  1PWP A;  4H84 A;  1YP1 A;  1JAO A;  1Z3J A;  4CTH A;  3ZUK A;  5B5P A;  1BUV M;  1G05 A;  1B8Y A;  3G5C A;  1L6J A;  1WNI A;  1JJ9 A;  1ROS A;  1IAC A;  2YB9 A;  1UTZ A;  3F19 A;  4I03 A;  3AIG A;  1BKC I;  3LIL A;  3KWV C;  3MA2 A;  2USN A;  1HFC A;  3ZVS A;  2RJP A;  1D8M A;  3EDI A;  4AYK A;  5D7W A;  3VI1 A;  2JSD A;  2W15 A;  4JA1 A;  4JQG A;  1XUC A;  5I43 A;  1G4K A;  1MMB A;  3HYG A;  5LAB A;  4EFS A;  4DV8 A;  1HTD A;  3L0T A;  2OW2 A;  2K9C A;  4XM6 A;  2KRJ A;  2OXW A;  1R55 A;  3DNG A;  4WZV A;  2ERP A;  2L0R A;  4ON1 A;  1J7N A;  3E8R A;  4FXY P;  4ZR5 A;  1KUH A;  3HY7 A;  3AYK A;  2JT5 A;  1EUB A;  3V96 B;  1ZXV A;  3DPF A;  3LGP A;  1AKL A;  5I3M A;  3TSK A;  1EB6 A;  1BKC E;  4GWM A;  2QPJ A;  2XS4 A;  1GXD A;  4H2E A;  4DPE A;  3LQ0 A;  2A8H A;  2MLR A;  5D1T A;  4H49 A;  4AIG A;  1JAP A;  5L79 A;  1OM7 A;  1SLM A;  3ELM A;  1D7X A;  4IJO A;  1GE7 A;  5JMY A;  3O64 A;  1IAE A;  3VTG A;  3B2Z A;  1QJJ A;  3G42 A;  1PWW A;  3LIR A;  4PKT A;  3CKI A;  3LMC A;  3B92 A;  4A7B A;  2OVZ A;  4FU4 A;  4DD8 A;  2OW0 A;  1CK7 A;  1G49 A;  3DSL A;  3EDG A;  2POJ A;  3KEK A;  1C3I A;  1GO7 P;  3NX7 A;  4GWN A;  2OXZ A;  1S4B P;  5I0L A;  2PJT A;  1IAA A;  3HY9 A;  2W13 A;  2MZE A;  3HB2 P;  456C A;  3SHI A;  1CGF A;  3LE9 A;  4L19 A;  1XUR A;  3F1A A;  4L6T A;  1IAB A;  4HX3 A;  1O0T A;  1CQR A;  1MNC A;  2OY4 A;  2MZI A;  3OHO A;  4H3X A;  3DWB A;  1BKC A;  4DF9 A;  2DDY A;  1D8F A;  1QUA A;  5L7F A;  2E2D A;  4G0D A;  4XBH A;  1KUI A;  2WO9 A;  2WOA A;  3N2U A;  3LKA A;  4GR0 A;  1A86 A;  5D2B A;  1EAK A;  1KBC A;  1JAQ A;  1AST A;  1KUK A;  4G9L A;  2MLS A;  2OW9 A;  1KAP P;  4A3W A;  2W12 A;  3TS4 A;  1KUF A;  5CUH A;  1SRP A;  2X3B A;  2RJQ A;  4H82 A;  1BM6 A;  2CKI A;  5I12 A;  4XM7 A;  3HDA P;  4HMA A;  1C7K A;  2FV9 A;  1R1I A;  4PKR A;  3N2V A; 
#chains in the Genus database with same CATH topology
 1DTH A;  1JK3 A;  2JNP A;  3HBV P;  2YUF A;  2I47 A;  3DTK A;  1JIZ A;  1OZ9 A;  1KUG A;  1BIW A;  1ZTQ A;  2FV5 A;  2OZR A;  1PWQ A;  1PWV A;  4AXQ A;  1JAN A;  3LUN A;  1BUD A;  1BZS A;  2N8R A;  3HDB A;  3USN A;  1JH1 A;  4GUY A;  3ZXH A;  2ERO A;  1FLS A;  1ND1 A;  3F18 A;  1XFV A;  2SRT A;  2JT6 A;  5BOT A;  1OM6 A;  1AF0 A;  3LK8 A;  1XFX A;  2OW1 A;  1IAD A;  3EWJ A;  5I2Z A;  1G9K A;  1SU3 A;  1I1I P;  1A85 A;  1XFU A;  1R54 A;  3EHX A;  2J83 A;  4JPA A;  3KHI A;  1UEA A;  4GR3 A;  2Z2D A;  1H71 P;  3LJT A;  2O3E A;  1GE5 A;  5CXA A;  1QIA A;  1XFW A;  4QKZ A;  966C A;  5BOY A;  1HOV A;  2JIH A;  4XM8 A;  3LJG A;  4PKV A;  1XFZ A;  1YCM A;  5CZM A;  1ZS0 A;  1B3D A;  1QIC A;  1PWU A;  3I7I A;  1SAT A;  5D1S A;  2X3C A;  4GF1 A;  2V4B A;  1XUD A;  1DMT A;  1OO9 A;  3DL1 A;  1JIW P;  1HFS A;  1R1H A;  1SMP A;  3TT4 A;  1CIZ A;  3LUM A;  3I7G A;  1Y0V A;  5D1U A;  1Y93 A;  2D1O A;  5D3C A;  2OI0 A;  3LEA A;  1UMS A;  1RM8 A;  2D1N A;  3WV1 A;  3P24 A;  1CXV A;  1GKC A;  3F15 A;  1O0Q A;  1ZVX A;  2J0T A;  3DTE A;  3P1V A;  3OHL A;  1GE6 A;  1QJI A;  3BA0 A;  2W0D A;  5I4O A;  1CAQ A;  1BQO A;  1MMP A;  1UTT A;  1YQY A;  4WKE A;  3LIK A;  4PKQ A;  2DW1 A;  4WF6 A;  1GO8 P;  2AYK A;  2OXU A;  1GKD A;  3DPE A;  2OVX A;  1I73 A;  2AIG P;  1R1J A;  3K7N A;  4R3V A;  3EHY A;  3LJZ A;  5BPA A;  2WO8 A;  2DW2 A;  4Q1L A;  2Y6D A;  4I35 A;  1K7Q A;  2XS3 A;  1I76 A;  1RMZ A;  3HBU P;  1OM8 A;  4JIJ A;  3UVC A;  2X7M A;  4FXQ A;  3F16 A;  3Q2G A;  4IUW A;  4AUO A;  2K2G A;  1Y8J A;  3RTS A;  4H1Q A;  3AYU A;  1SLN A;  2Y6C A;  1ZP5 A;  2MZH A;  1K7I A;  3TVC A;  3GBO A;  5H8X A;  2E3X A;  3KEC A;  3KMC A;  2O36 A;  3LQB A;  3KME A;  1OS9 A;  1OMJ A;  1CGL A;  2TCL A;  2OY2 A;  1FM1 A;  1FBL A;  1CGE A;  1BSW A;  4ILW D;  4GQL A;  4H76 A;  1QIB A;  1XFY A;  1UMT A;  3KRY A;  4FVL A;  3K7L A;  2HU6 A;  3EDZ A;  1ZXC A;  1OS2 A;  1C8T A;  3B8Z A;  2DW0 A;  3L0V A;  2ERQ A;  1AYK A;  4JP4 A;  3KEJ A;  4GR8 A;  1JKY A;  1USN A;  3RTT A;  1HV5 A;  4PKW A;  1XM5 A;  1D5J A;  2DDF A;  830C A;  1MMR A;  2X3A A;  1MMQ A;  1ATL A;  1IAG A;  3O2X A;  1K7G A;  3F17 A;  3Q2H A;  4L63 A;  4J4M A;  3U1R A;  4PKU A;  3WV3 A;  2W14 A;  1BQQ M;  2CLT A;  4PKS A;  3WV2 A;  4IN9 A;  1HY7 A;  5B5O A;  4WKI A;  1YOU A;  4H30 A;  4WK7 A;  1Q3A A;  1G12 A;  4XCT A;  3EDH A;  2YIG A;  1PWP A;  4H84 A;  1YP1 A;  1JAO A;  1Z3J A;  4CTH A;  3ZUK A;  4L7A A;  5B5P A;  1BUV M;  1G05 A;  1B8Y A;  3G5C A;  1L6J A;  1WNI A;  1JJ9 A;  1ROS A;  1IAC A;  2YB9 A;  1UTZ A;  3F19 A;  4I03 A;  3AIG A;  1BKC I;  3LIL A;  3KWV C;  3MA2 A;  3DTI A;  2USN A;  1HFC A;  3ZVS A;  2RJP A;  1D8M A;  3EDI A;  4AYK A;  5D7W A;  3VI1 A;  2JSD A;  2W15 A;  4JA1 A;  4JQG A;  1XUC A;  5I43 A;  1G4K A;  1MMB A;  3HYG A;  5LAB A;  4EFS A;  4DV8 A;  1HTD A;  3L0T A;  2OW2 A;  2K9C A;  4XM6 A;  2KRJ A;  2OXW A;  1R55 A;  3DNG A;  4WZV A;  2ERP A;  2L0R A;  4ON1 A;  1J7N A;  3E8R A;  4FXY P;  4ZR5 A;  1KUH A;  3HY7 A;  3AYK A;  2JT5 A;  1EUB A;  3V96 B;  1ZXV A;  3DPF A;  3LGP A;  1AKL A;  5I3M A;  3TSK A;  1EB6 A;  1BKC E;  4GWM A;  2QPJ A;  2XS4 A;  1GXD A;  4H2E A;  4DPE A;  3LQ0 A;  2A8H A;  2MLR A;  5D1T A;  4H49 A;  4AIG A;  1JAP A;  5L79 A;  1OM7 A;  1SLM A;  3ELM A;  1D7X A;  4IJO A;  1GE7 A;  5JMY A;  3O64 A;  1IAE A;  3VTG A;  3B2Z A;  1QJJ A;  3G42 A;  1PWW A;  3LIR A;  4PKT A;  3CKI A;  3LMC A;  3B92 A;  4A7B A;  2OVZ A;  4FU4 A;  4DD8 A;  2OW0 A;  1CK7 A;  1G49 A;  3DSL A;  3EDG A;  2POJ A;  3KEK A;  1C3I A;  1GO7 P;  3NX7 A;  4GWN A;  2OXZ A;  1TVI A;  1S4B P;  5I0L A;  2PJT A;  1IAA A;  3HY9 A;  2W13 A;  2MZE A;  3HB2 P;  456C A;  3SHI A;  1CGF A;  3LE9 A;  4L19 A;  1XUR A;  3F1A A;  4L6T A;  1IAB A;  4HX3 A;  1O0T A;  1CQR A;  1MNC A;  2OY4 A;  2MZI A;  3OHO A;  4H3X A;  3DWB A;  1BKC A;  4DF9 A;  2DDY A;  1D8F A;  1QUA A;  5L7F A;  2E2D A;  4G0D A;  4XBH A;  1KUI A;  2WO9 A;  2WOA A;  3N2U A;  3LKA A;  4GR0 A;  1A86 A;  5D2B A;  1EAK A;  1KBC A;  1JAQ A;  1AST A;  1KUK A;  1XAX A;  4G9L A;  2MLS A;  2OW9 A;  1KAP P;  4A3W A;  2W12 A;  3TS4 A;  1KUF A;  5CUH A;  1SRP A;  2X3B A;  2RJQ A;  4H82 A;  1BM6 A;  2CKI A;  5I12 A;  4XM7 A;  3HDA P;  4HMA A;  1C7K A;  2FV9 A;  1R1I A;  4PKR A;  3N2V A; 
#chains in the Genus database with same CATH homology
 1DTH A;  1JK3 A;  2JNP A;  3HBV P;  2YUF A;  2I47 A;  3DTK A;  1JIZ A;  1KUG A;  1BIW A;  1ZTQ A;  2FV5 A;  2OZR A;  1PWQ A;  1PWV A;  4AXQ A;  1JAN A;  3LUN A;  1BUD A;  1BZS A;  2N8R A;  3HDB A;  3USN A;  1JH1 A;  4GUY A;  3ZXH A;  2ERO A;  1FLS A;  1ND1 A;  3F18 A;  1XFV A;  2SRT A;  2JT6 A;  5BOT A;  1OM6 A;  1AF0 A;  3LK8 A;  1XFX A;  2OW1 A;  1IAD A;  3EWJ A;  5I2Z A;  1G9K A;  1SU3 A;  1I1I P;  1A85 A;  1XFU A;  1R54 A;  3EHX A;  2J83 A;  4JPA A;  3KHI A;  1UEA A;  4GR3 A;  2Z2D A;  1H71 P;  3LJT A;  2O3E A;  1GE5 A;  5CXA A;  1QIA A;  1XFW A;  4QKZ A;  966C A;  5BOY A;  1HOV A;  2JIH A;  4XM8 A;  3LJG A;  4PKV A;  1XFZ A;  1YCM A;  5CZM A;  1ZS0 A;  1B3D A;  1QIC A;  1PWU A;  3I7I A;  1SAT A;  5D1S A;  2X3C A;  4GF1 A;  2V4B A;  1XUD A;  1DMT A;  1OO9 A;  3DL1 A;  1JIW P;  1HFS A;  1R1H A;  1SMP A;  3TT4 A;  1CIZ A;  3LUM A;  3I7G A;  1Y0V A;  5D1U A;  1Y93 A;  2D1O A;  5D3C A;  2OI0 A;  3LEA A;  1UMS A;  1RM8 A;  2D1N A;  3WV1 A;  3P24 A;  1CXV A;  1GKC A;  3F15 A;  1O0Q A;  1ZVX A;  2J0T A;  3DTE A;  3P1V A;  3OHL A;  1GE6 A;  1QJI A;  3BA0 A;  2W0D A;  5I4O A;  1CAQ A;  1BQO A;  1MMP A;  1UTT A;  1YQY A;  4WKE A;  3LIK A;  4PKQ A;  2DW1 A;  4WF6 A;  1GO8 P;  2AYK A;  2OXU A;  1GKD A;  3DPE A;  2OVX A;  1I73 A;  2AIG P;  1R1J A;  3K7N A;  4R3V A;  3EHY A;  3LJZ A;  5BPA A;  2WO8 A;  2DW2 A;  4Q1L A;  2Y6D A;  4I35 A;  1K7Q A;  2XS3 A;  1I76 A;  1RMZ A;  3HBU P;  1OM8 A;  4JIJ A;  3UVC A;  2X7M A;  4FXQ A;  3F16 A;  3Q2G A;  4IUW A;  4AUO A;  2K2G A;  1Y8J A;  3RTS A;  4H1Q A;  3AYU A;  1SLN A;  2Y6C A;  1ZP5 A;  2MZH A;  1K7I A;  3TVC A;  3GBO A;  5H8X A;  2E3X A;  3KEC A;  3KMC A;  2O36 A;  3LQB A;  3KME A;  1OS9 A;  1OMJ A;  1CGL A;  2TCL A;  2OY2 A;  1FM1 A;  1FBL A;  1CGE A;  1BSW A;  4ILW D;  4GQL A;  4H76 A;  1QIB A;  1XFY A;  1UMT A;  3KRY A;  4FVL A;  3K7L A;  2HU6 A;  3EDZ A;  1ZXC A;  1OS2 A;  1C8T A;  3B8Z A;  2DW0 A;  3L0V A;  2ERQ A;  1AYK A;  4JP4 A;  3KEJ A;  4GR8 A;  1JKY A;  1USN A;  3RTT A;  1HV5 A;  4PKW A;  1D5J A;  2DDF A;  830C A;  1MMR A;  2X3A A;  1MMQ A;  1ATL A;  1IAG A;  3O2X A;  1K7G A;  3F17 A;  3Q2H A;  4L63 A;  4J4M A;  3U1R A;  4PKU A;  3WV3 A;  2W14 A;  1BQQ M;  2CLT A;  4PKS A;  3WV2 A;  4IN9 A;  1HY7 A;  5B5O A;  4WKI A;  1YOU A;  4H30 A;  4WK7 A;  1Q3A A;  1G12 A;  4XCT A;  3EDH A;  2YIG A;  1PWP A;  4H84 A;  1YP1 A;  1JAO A;  1Z3J A;  4CTH A;  3ZUK A;  4L7A A;  5B5P A;  1BUV M;  1G05 A;  1B8Y A;  3G5C A;  1L6J A;  1WNI A;  1JJ9 A;  1ROS A;  1IAC A;  2YB9 A;  1UTZ A;  3F19 A;  4I03 A;  3AIG A;  1BKC I;  3LIL A;  3KWV C;  3MA2 A;  3DTI A;  2USN A;  1HFC A;  3ZVS A;  2RJP A;  1D8M A;  3EDI A;  4AYK A;  5D7W A;  3VI1 A;  2JSD A;  2W15 A;  4JA1 A;  4JQG A;  1XUC A;  5I43 A;  1G4K A;  1MMB A;  3HYG A;  5LAB A;  4EFS A;  4DV8 A;  1HTD A;  3L0T A;  2OW2 A;  2K9C A;  4XM6 A;  2KRJ A;  2OXW A;  1R55 A;  3DNG A;  4WZV A;  2ERP A;  2L0R A;  4ON1 A;  1J7N A;  3E8R A;  4FXY P;  4ZR5 A;  1KUH A;  3HY7 A;  3AYK A;  2JT5 A;  1EUB A;  3V96 B;  1ZXV A;  3DPF A;  3LGP A;  1AKL A;  5I3M A;  3TSK A;  1EB6 A;  1BKC E;  4GWM A;  2QPJ A;  2XS4 A;  1GXD A;  4H2E A;  4DPE A;  3LQ0 A;  2A8H A;  2MLR A;  5D1T A;  4H49 A;  4AIG A;  1JAP A;  5L79 A;  1OM7 A;  1SLM A;  3ELM A;  1D7X A;  4IJO A;  1GE7 A;  5JMY A;  3O64 A;  1IAE A;  3VTG A;  3B2Z A;  1QJJ A;  3G42 A;  1PWW A;  3LIR A;  4PKT A;  3CKI A;  3LMC A;  3B92 A;  4A7B A;  2OVZ A;  4FU4 A;  4DD8 A;  2OW0 A;  1CK7 A;  1G49 A;  3DSL A;  3EDG A;  2POJ A;  3KEK A;  1C3I A;  1GO7 P;  3NX7 A;  4GWN A;  2OXZ A;  1S4B P;  5I0L A;  2PJT A;  1IAA A;  3HY9 A;  2W13 A;  2MZE A;  3HB2 P;  456C A;  3SHI A;  1CGF A;  3LE9 A;  4L19 A;  1XUR A;  3F1A A;  4L6T A;  1IAB A;  4HX3 A;  1O0T A;  1CQR A;  1MNC A;  2OY4 A;  2MZI A;  3OHO A;  4H3X A;  3DWB A;  1BKC A;  4DF9 A;  2DDY A;  1D8F A;  1QUA A;  5L7F A;  2E2D A;  4G0D A;  4XBH A;  1KUI A;  2WO9 A;  2WOA A;  3N2U A;  3LKA A;  4GR0 A;  1A86 A;  5D2B A;  1EAK A;  1KBC A;  1JAQ A;  1AST A;  1KUK A;  4G9L A;  2MLS A;  2OW9 A;  1KAP P;  4A3W A;  2W12 A;  3TS4 A;  1KUF A;  5CUH A;  1SRP A;  2X3B A;  2RJQ A;  4H82 A;  1BM6 A;  2CKI A;  5I12 A;  4XM7 A;  3HDA P;  4HMA A;  1C7K A;  2FV9 A;  1R1I A;  4PKR A;  3N2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...