3OHLA

Catalytic domain of stromelysin-1 in complex with n-hydroxy-2-(4-methoxy-n-(pyridine-3-ylmethyl)phenylsulfonamido)acetamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
159
Chain Sequence
b'FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANALMYPLYHRFRLSQDDINGIQSLYGPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromelysin-1
publication title Non-Resonance Raman Difference Spectroscopy as a Tool to Probe Enthalpy-Entropy Compensation and the Interfacial Mobility Model
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 47
structure length 159
sequence length 167
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ohlA00
1UTZA 1O0TA 1XUCA 3I7GA 1AKLA 5H8XA 1Q3AA 5I3MA 3Q2GA 1SATA 1SRPA 2O36A 1JH1A 1G05A 1BUDA 3EDGA 1USNA 4XM8A 3EWJA 5CZMA 2J83A 4WF6A 1D7XA 1CQRA 3L0TA 1KBCA 1CK7A 3LILA 3K7LA 5D3CA 1IAEA 1UMTA 1BM6A 4DPEA 4H76A 5B5OA 2OXWA 2DW1A 4FU4A 3V96B 4G9LA 1AF0A 1MMPA 1SLNA 3ZXHA 1KUFA 2W12A 3DWBA 3RTSA 4G0DA 2CLTA 3F16A 2ERPA 4CTHA 1L6JA 1OM7A 2D1OA 2DW2A 1GO8P 3ELMA 1XFVA 4GQLA 2RJPA 1OO9A 3AYKA 3DNGA 1BZSA 4GR0A 1XFXA 4FVLA 1OM8A 3ZVSA 1BKCA 3MA2A 1XUDA 2X3CA 1JJ9A 1BKCE 4AUOA 1QJIA 2FV5A 3G5CA 3I7IA 1QJJA 2JT5A 4J4MA 3KMCA 5I4OA 1JAPA 1UMSA 1EUBA 1PWPA 2MLSA 1IAGA 3AYUA 3DPFA 3G42A 4IUWA 1QICA 1OM6A 1OS9A 2WO8A 3L0VA 4I03A 1JIWP 1BIWA 4ILWD 1QUAA 1FM1A 2Y6CA 3B8ZA 1YCMA 1Y93A 2DDFA 1R55A 4Q1LA 1I76A 1PWWA 1HY7A 1A85A 3DL1A 1GE5A 3NX7A 4IN9A 5JMYA 1Y8JA 4H2EA 4JQGA 5BOYA 3HBUP 1JIZA 3LQBA 1HFCA 3F17A 5BOTA 2OZRA 3GBOA 1B8YA 1XFUA 3DSLA 1XFZA 1HOVA 2X3BA 3O64A 2EROA 1R1IA 2OVXA 2AYKA 5L7FA 4PKTA 3F15A 2QPJA 1IACA 5D2BA 4PKSA 1ND1A 3E8RA 1SMPA 1DMTA 1JKYA 1I73A 1K7QA 3O2XA 1YP1A 4H49A 3EDHA 1YQYA 2JT6A 2MZIA 2OY4A 1RMZA 1DTHA 3HYGA 4JPAA 1CGLA 2OW2A 2SRTA 2W15A 4DD8A 1EB6A 1EAKA 966CA 3KHIA 5BPAA 5D1TA 4XBHA 1PWVA 4H82A 1BQQM 4AIGA 1D8FA 3OHOA 3F19A 1BUVM 2WO9A 4ON1A 1OS2A 4HX3A 4DF9A 3LUMA 1KUKA 2DW0A 3HY9A 2X3AA 3EHYA 1A86A 3RTTA 3B92A 5I0LA 3DPEA 4PKVA 3HY7A 1JAOA 2OXUA 3AIGA 3U1RA 1HTDA 2W13A 4QKZA 1JANA 2X7MA 2K9CA 4XM6A 5I2ZA 1PWQA 3LIRA 5CUHA 2MLRA 1D5JA 4H84A 1K7GA 1CAQA 1BSWA 3EHXA 3HDAP 1BKCI 2RJQA 3P1VA 4WZVA 4XCTA 3TSKA 3BA0A 2JSDA 2D1NA 2OY2A 1CGEA 1MMBA 3EDZA 2E3XA 1ZTQA 1ZXCA 4PKUA 2AIGP 2PJTA 4GUYA 1KUGA 1O0QA 2OI0A 2V4BA 4WKEA 3P24A 1G49A 4GF1A 4GR8A 5D1SA 2OW1A 4AXQA 1XFYA 3OHLA 1RM8A 3LJZA 3CKIA 4HMAA 3HDBA 4A7BA 1IAAA 3WV1A 3Q2HA 1IABA 3N2UA 5CXAA 3LK8A 1KUIA 1ATLA 3EDIA 3N2VA 3UVCA 1C3IA 2O3EA 1IADA 3LEAA 1CIZA 1MMRA 3KWVC 4JA1A 3KEJA 4L19A 3HB2P 1ZVXA 4R3VA 3ZUKA 1CGFA 3KMEA 2KRJA 2OVZA 1H71P 1CXVA 1ZP5A 456CA 2Z2DA 2W14A 4PKRA 2L0RA 3VTGA 2ERQA 1FLSA 4H1QA 1R54A 4H30A 1HV5A 2MZEA 4H3XA 1XURA 2Y6DA 1I1IP 5LABA 5I12A 2POJA 3VI1A 3LMCA 3WV3A 2CKIA 2J0TA 1GO7P 1HFSA 4JP4A 2I47A 1R1JA 3TVCA 1K7IA 1C7KA 4WK7A 2OW9A 1ROSA 1KUHA 4PKQA 1Z3JA 1UTTA 1QIAA 1XFWA 2HU6A 4XM7A 3TS4A 3F1AA 3LJGA 1QIBA 4L6TA 5L79A 3K7NA 1D8MA 4L63A 3SHIA 5D7WA 5I43A 1FBLA 1SU3A 2JNPA 1MMQA 4AYKA 4FXYP 4EFSA 1ASTA 3LQ0A 1ZXVA 4GR3A 4A3WA 2N8RA 2YIGA 4DV8A 2WOAA 2OW0A 3F18A 830CA 4ZR5A 3LIKA 2XS3A 4GWMA 2W0DA 2MZHA 2K2GA 3LUNA 1JK3A 1GKDA 3USNA 3KECA 1AYKA 1JAQA 1G9KA 2USNA 1SLMA 2DDYA 1UEAA 1GE6A 1GE7A 2YB9A 1G12A 4GWNA 3HBVP 5B5PA 5D1UA 2OXZA 1OMJA 1WNIA 3WV2A 1KAPP 2E2DA 2FV9A 3KRYA 1GKCA 3TT4A 1J7NA 3LJTA 1YOUA 3B2ZA 4I35A 2JIHA 3KEKA 4FXQA 3LGPA 1MNCA 2TCLA 1ZS0A 1B3DA 4IJOA 1BQOA 1Y0VA 1GXDA 2XS4A 4WKIA 3LE9A 4PKWA 2A8HA 1S4BP 1C8TA 1PWUA 1R1HA 1G4KA 3LKAA 4JIJA
chains in the Genus database with same CATH superfamily
1UTZA 1O0TA 1XUCA 3I7GA 1AKLA 5H8XA 1Q3AA 5I3MA 3Q2GA 1SATA 1SRPA 2O36A 1JH1A 1G05A 1BUDA 3EDGA 1USNA 4XM8A 3EWJA 5CZMA 2J83A 4WF6A 1D7XA 1OZ9A 1CQRA 3L0TA 1KBCA 1CK7A 3LILA 3DTEA 3K7LA 5D3CA 1IAEA 1UMTA 1BM6A 4DPEA 4H76A 5B5OA 2OXWA 2DW1A 1TVIA 4FU4A 3V96B 4G9LA 1AF0A 1MMPA 1SLNA 3ZXHA 1KUFA 2W12A 3DWBA 3RTSA 4G0DA 2CLTA 3F16A 2ERPA 4CTHA 1L6JA 1OM7A 2D1OA 2DW2A 1GO8P 3ELMA 1XFVA 4GQLA 2RJPA 1OO9A 3AYKA 3DNGA 1BZSA 4GR0A 1XFXA 4FVLA 1OM8A 3ZVSA 1BKCA 3MA2A 1XUDA 2X3CA 1JJ9A 1BKCE 4AUOA 1QJIA 2YUFA 2FV5A 3G5CA 3I7IA 1QJJA 2JT5A 4J4MA 3KMCA 5I4OA 1JAPA 1UMSA 1EUBA 1PWPA 2MLSA 1IAGA 3AYUA 3DPFA 3G42A 4IUWA 1QICA 1OM6A 1OS9A 2WO8A 3L0VA 4I03A 1JIWP 1BIWA 4ILWD 1QUAA 1FM1A 2Y6CA 3B8ZA 1YCMA 1Y93A 2DDFA 1R55A 4Q1LA 1I76A 1PWWA 1HY7A 1A85A 3DL1A 1GE5A 3NX7A 4IN9A 5JMYA 1Y8JA 4H2EA 4JQGA 5BOYA 3HBUP 1JIZA 3LQBA 1HFCA 3F17A 5BOTA 2OZRA 3GBOA 1B8YA 1XFUA 3DSLA 1XFZA 1HOVA 2X3BA 3O64A 2EROA 1R1IA 2OVXA 2AYKA 5L7FA 4PKTA 3F15A 2QPJA 1IACA 5D2BA 4PKSA 1ND1A 3E8RA 1SMPA 1DMTA 1JKYA 1I73A 1K7QA 3O2XA 1YP1A 4H49A 3EDHA 1YQYA 2JT6A 2MZIA 2OY4A 1RMZA 1DTHA 3HYGA 4JPAA 1CGLA 2OW2A 2SRTA 2W15A 4DD8A 1EB6A 1EAKA 966CA 3KHIA 5BPAA 5D1TA 4XBHA 1PWVA 4H82A 1BQQM 4AIGA 1D8FA 3OHOA 3F19A 1BUVM 2WO9A 4ON1A 1OS2A 4HX3A 4DF9A 3LUMA 1KUKA 2DW0A 3HY9A 2X3AA 3EHYA 1A86A 3RTTA 3B92A 5I0LA 3DPEA 4PKVA 3HY7A 1JAOA 2OXUA 3AIGA 3U1RA 1HTDA 2W13A 4QKZA 1JANA 2X7MA 2K9CA 4XM6A 5I2ZA 1PWQA 3LIRA 4L7AA 3DTKA 5CUHA 2MLRA 1D5JA 4H84A 1K7GA 1CAQA 1BSWA 3EHXA 3HDAP 1BKCI 2RJQA 3P1VA 4WZVA 4XCTA 3TSKA 3BA0A 2JSDA 2D1NA 2OY2A 1CGEA 1MMBA 3EDZA 2E3XA 1ZTQA 1ZXCA 4PKUA 2AIGP 2PJTA 4GUYA 1KUGA 1O0QA 2OI0A 2V4BA 4WKEA 3P24A 1G49A 4GF1A 4GR8A 5D1SA 2OW1A 4AXQA 1XFYA 3OHLA 1RM8A 3LJZA 3CKIA 4HMAA 3HDBA 4A7BA 1IAAA 3WV1A 3Q2HA 1IABA 3N2UA 5CXAA 3LK8A 1KUIA 1ATLA 3EDIA 3N2VA 3UVCA 1C3IA 2O3EA 1IADA 3LEAA 1CIZA 1MMRA 3KWVC 4JA1A 3KEJA 4L19A 3HB2P 1ZVXA 4R3VA 3ZUKA 1CGFA 3KMEA 2KRJA 1XAXA 2OVZA 1H71P 1CXVA 1ZP5A 456CA 2Z2DA 2W14A 4PKRA 2L0RA 3VTGA 2ERQA 1FLSA 4H1QA 1R54A 4H30A 1HV5A 2MZEA 3DTIA 4H3XA 1XURA 2Y6DA 1I1IP 5LABA 5I12A 2POJA 3VI1A 3LMCA 3WV3A 2CKIA 2J0TA 1GO7P 1HFSA 4JP4A 2I47A 1R1JA 3TVCA 1K7IA 1C7KA 4WK7A 2OW9A 1ROSA 1KUHA 4PKQA 1Z3JA 1UTTA 1QIAA 1XFWA 2HU6A 4XM7A 3TS4A 3F1AA 3LJGA 1QIBA 4L6TA 5L79A 3K7NA 1D8MA 4L63A 3SHIA 5D7WA 5I43A 1FBLA 1SU3A 2JNPA 1MMQA 4AYKA 4FXYP 4EFSA 1ASTA 3LQ0A 1ZXVA 4GR3A 4A3WA 2N8RA 2YIGA 4DV8A 2WOAA 2OW0A 3F18A 830CA 4ZR5A 3LIKA 2XS3A 4GWMA 2W0DA 2MZHA 2K2GA 3LUNA 1JK3A 1GKDA 3USNA 3KECA 1AYKA 1JAQA 1G9KA 2USNA 1SLMA 2DDYA 1UEAA 1GE6A 1GE7A 2YB9A 1G12A 4GWNA 3HBVP 5B5PA 5D1UA 2OXZA 1OMJA 1WNIA 3WV2A 1KAPP 2E2DA 2FV9A 3KRYA 1GKCA 3TT4A 1J7NA 3LJTA 1YOUA 3B2ZA 4I35A 2JIHA 3KEKA 4FXQA 3LGPA 1MNCA 2TCLA 1ZS0A 1B3DA 4IJOA 1BQOA 1Y0VA 1GXDA 2XS4A 4WKIA 3LE9A 4PKWA 2A8HA 1S4BP 1XM5A 1C8TA 1PWUA 1R1HA 1G4KA 3LKAA 4JIJA
chains in the Genus database with same CATH topology
1UTZA 1O0TA 1XUCA 3I7GA 1AKLA 5H8XA 1Q3AA 5I3MA 3Q2GA 1SATA 1SRPA 2O36A 1JH1A 1G05A 1BUDA 3EDGA 1USNA 4XM8A 3EWJA 5CZMA 2J83A 4WF6A 1D7XA 1CQRA 3L0TA 1KBCA 1CK7A 3LILA 3DTEA 3K7LA 5D3CA 1IAEA 1UMTA 1BM6A 4DPEA 4H76A 5B5OA 2OXWA 2DW1A 4FU4A 3V96B 4G9LA 1AF0A 1MMPA 1SLNA 3ZXHA 1KUFA 2W12A 3DWBA 3RTSA 4G0DA 2CLTA 3F16A 2ERPA 4CTHA 1L6JA 1OM7A 2D1OA 2DW2A 1GO8P 3ELMA 1XFVA 4GQLA 2RJPA 1OO9A 3AYKA 3DNGA 1BZSA 4GR0A 1XFXA 4FVLA 1OM8A 3ZVSA 1BKCA 3MA2A 1XUDA 2X3CA 1JJ9A 1BKCE 4AUOA 1QJIA 2YUFA 2FV5A 3G5CA 3I7IA 1QJJA 2JT5A 4J4MA 3KMCA 5I4OA 1JAPA 1UMSA 1EUBA 1PWPA 2MLSA 1IAGA 3AYUA 3DPFA 3G42A 4IUWA 1QICA 1OM6A 1OS9A 2WO8A 3L0VA 4I03A 1JIWP 1BIWA 4ILWD 1QUAA 1FM1A 2Y6CA 3B8ZA 1YCMA 1Y93A 2DDFA 1R55A 4Q1LA 1I76A 1PWWA 1HY7A 1A85A 3DL1A 1GE5A 3NX7A 4IN9A 5JMYA 1Y8JA 4H2EA 4JQGA 5BOYA 3HBUP 1JIZA 3LQBA 1HFCA 3F17A 5BOTA 2OZRA 3GBOA 1B8YA 1XFUA 3DSLA 1XFZA 1HOVA 2X3BA 3O64A 2EROA 1R1IA 2OVXA 2AYKA 5L7FA 4PKTA 3F15A 2QPJA 1IACA 5D2BA 4PKSA 1ND1A 3E8RA 1SMPA 1DMTA 1JKYA 1I73A 1K7QA 3O2XA 1YP1A 4H49A 3EDHA 1YQYA 2JT6A 2MZIA 2OY4A 1RMZA 1DTHA 3HYGA 4JPAA 1CGLA 2OW2A 2SRTA 2W15A 4DD8A 1EB6A 1EAKA 966CA 3KHIA 5BPAA 5D1TA 4XBHA 1PWVA 4H82A 1BQQM 4AIGA 1D8FA 3OHOA 3F19A 1BUVM 2WO9A 4ON1A 1OS2A 4HX3A 4DF9A 3LUMA 1KUKA 2DW0A 3HY9A 2X3AA 3EHYA 1A86A 3RTTA 3B92A 5I0LA 3DPEA 4PKVA 3HY7A 1JAOA 2OXUA 3AIGA 3U1RA 1HTDA 2W13A 4QKZA 1JANA 2X7MA 2K9CA 4XM6A 5I2ZA 1PWQA 3LIRA 4L7AA 3DTKA 5CUHA 2MLRA 1D5JA 4H84A 1K7GA 1CAQA 1BSWA 3EHXA 3HDAP 1BKCI 2RJQA 3P1VA 4WZVA 4XCTA 3TSKA 3BA0A 2JSDA 2D1NA 2OY2A 1CGEA 1MMBA 3EDZA 2E3XA 1ZTQA 1ZXCA 4PKUA 2AIGP 2PJTA 4GUYA 1KUGA 1O0QA 2OI0A 2V4BA 4WKEA 3P24A 1G49A 4GF1A 4GR8A 5D1SA 2OW1A 4AXQA 1XFYA 3OHLA 1RM8A 3LJZA 3CKIA 4HMAA 3HDBA 4A7BA 1IAAA 3WV1A 3Q2HA 1IABA 3N2UA 5CXAA 3LK8A 1KUIA 1ATLA 3EDIA 3N2VA 3UVCA 1C3IA 2O3EA 1IADA 3LEAA 1CIZA 1MMRA 3KWVC 4JA1A 3KEJA 4L19A 3HB2P 1ZVXA 4R3VA 3ZUKA 1CGFA 3KMEA 2KRJA 2OVZA 1H71P 1CXVA 1ZP5A 456CA 2Z2DA 2W14A 4PKRA 2L0RA 3VTGA 2ERQA 1FLSA 4H1QA 1R54A 4H30A 1HV5A 2MZEA 3DTIA 4H3XA 1XURA 2Y6DA 1I1IP 5LABA 5I12A 2POJA 3VI1A 3LMCA 3WV3A 2CKIA 2J0TA 1GO7P 1HFSA 4JP4A 2I47A 1R1JA 3TVCA 1K7IA 1C7KA 4WK7A 2OW9A 1ROSA 1KUHA 4PKQA 1Z3JA 1UTTA 1QIAA 1XFWA 2HU6A 4XM7A 3TS4A 3F1AA 3LJGA 1QIBA 4L6TA 5L79A 3K7NA 1D8MA 4L63A 3SHIA 5D7WA 5I43A 1FBLA 1SU3A 2JNPA 1MMQA 4AYKA 4FXYP 4EFSA 1ASTA 3LQ0A 1ZXVA 4GR3A 4A3WA 2N8RA 2YIGA 4DV8A 2WOAA 2OW0A 3F18A 830CA 4ZR5A 3LIKA 2XS3A 4GWMA 2W0DA 2MZHA 2K2GA 3LUNA 1JK3A 1GKDA 3USNA 3KECA 1AYKA 1JAQA 1G9KA 2USNA 1SLMA 2DDYA 1UEAA 1GE6A 1GE7A 2YB9A 1G12A 4GWNA 3HBVP 5B5PA 5D1UA 2OXZA 1OMJA 1WNIA 3WV2A 1KAPP 2E2DA 2FV9A 3KRYA 1GKCA 3TT4A 1J7NA 3LJTA 1YOUA 3B2ZA 4I35A 2JIHA 3KEKA 4FXQA 3LGPA 1MNCA 2TCLA 1ZS0A 1B3DA 4IJOA 1BQOA 1Y0VA 1GXDA 2XS4A 4WKIA 3LE9A 4PKWA 2A8HA 1S4BP 1C8TA 1PWUA 1R1HA 1G4KA 3LKAA 4JIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTZ A;  1O0T A;  1XUC A;  3I7G A;  1AKL A;  5H8X A;  1Q3A A;  5I3M A;  3Q2G A;  1SAT A;  1SRP A;  2O36 A;  1JH1 A;  1G05 A;  1BUD A;  3EDG A;  1USN A;  4XM8 A;  3EWJ A;  5CZM A;  2J83 A;  4WF6 A;  1D7X A;  1CQR A;  3L0T A;  1KBC A;  1CK7 A;  3LIL A;  3K7L A;  5D3C A;  1IAE A;  1UMT A;  1BM6 A;  4DPE A;  4H76 A;  5B5O A;  2OXW A;  2DW1 A;  4FU4 A;  3V96 B;  4G9L A;  1AF0 A;  1MMP A;  1SLN A;  3ZXH A;  1KUF A;  2W12 A;  3DWB A;  3RTS A;  4G0D A;  2CLT A;  3F16 A;  2ERP A;  4CTH A;  1L6J A;  1OM7 A;  2D1O A;  2DW2 A;  1GO8 P;  3ELM A;  1XFV A;  4GQL A;  2RJP A;  1OO9 A;  3AYK A;  3DNG A;  1BZS A;  4GR0 A;  1XFX A;  4FVL A;  1OM8 A;  3ZVS A;  1BKC A;  3MA2 A;  1XUD A;  2X3C A;  1JJ9 A;  1BKC E;  4AUO A;  1QJI A;  2FV5 A;  3G5C A;  3I7I A;  1QJJ A;  2JT5 A;  4J4M A;  3KMC A;  5I4O A;  1JAP A;  1UMS A;  1EUB A;  1PWP A;  2MLS A;  1IAG A;  3AYU A;  3DPF A;  3G42 A;  4IUW A;  1QIC A;  1OM6 A;  1OS9 A;  2WO8 A;  3L0V A;  4I03 A;  1JIW P;  1BIW A;  4ILW D;  1QUA A;  1FM1 A;  2Y6C A;  3B8Z A;  1YCM A;  1Y93 A;  2DDF A;  1R55 A;  4Q1L A;  1I76 A;  1PWW A;  1HY7 A;  1A85 A;  3DL1 A;  1GE5 A;  3NX7 A;  4IN9 A;  5JMY A;  1Y8J A;  4H2E A;  4JQG A;  5BOY A;  3HBU P;  1JIZ A;  3LQB A;  1HFC A;  3F17 A;  5BOT A;  2OZR A;  3GBO A;  1B8Y A;  1XFU A;  3DSL A;  1XFZ A;  1HOV A;  2X3B A;  3O64 A;  2ERO A;  1R1I A;  2OVX A;  2AYK A;  5L7F A;  4PKT A;  3F15 A;  2QPJ A;  1IAC A;  5D2B A;  4PKS A;  1ND1 A;  3E8R A;  1SMP A;  1DMT A;  1JKY A;  1I73 A;  1K7Q A;  3O2X A;  1YP1 A;  4H49 A;  3EDH A;  1YQY A;  2JT6 A;  2MZI A;  2OY4 A;  1RMZ A;  1DTH A;  3HYG A;  4JPA A;  1CGL A;  2OW2 A;  2SRT A;  2W15 A;  4DD8 A;  1EB6 A;  1EAK A;  966C A;  3KHI A;  5BPA A;  5D1T A;  4XBH A;  1PWV A;  4H82 A;  1BQQ M;  4AIG A;  1D8F A;  3OHO A;  3F19 A;  1BUV M;  2WO9 A;  4ON1 A;  1OS2 A;  4HX3 A;  4DF9 A;  3LUM A;  1KUK A;  2DW0 A;  3HY9 A;  2X3A A;  3EHY A;  1A86 A;  3RTT A;  3B92 A;  5I0L A;  3DPE A;  4PKV A;  3HY7 A;  1JAO A;  2OXU A;  3AIG A;  3U1R A;  1HTD A;  2W13 A;  4QKZ A;  1JAN A;  2X7M A;  2K9C A;  4XM6 A;  5I2Z A;  1PWQ A;  3LIR A;  5CUH A;  2MLR A;  1D5J A;  4H84 A;  1K7G A;  1CAQ A;  1BSW A;  3EHX A;  3HDA P;  1BKC I;  2RJQ A;  3P1V A;  4WZV A;  4XCT A;  3TSK A;  3BA0 A;  2JSD A;  2D1N A;  2OY2 A;  1CGE A;  1MMB A;  3EDZ A;  2E3X A;  1ZTQ A;  1ZXC A;  4PKU A;  2AIG P;  2PJT A;  4GUY A;  1KUG A;  1O0Q A;  2OI0 A;  2V4B A;  4WKE A;  3P24 A;  1G49 A;  4GF1 A;  4GR8 A;  5D1S A;  2OW1 A;  4AXQ A;  1XFY A;  3OHL A;  1RM8 A;  3LJZ A;  3CKI A;  4HMA A;  3HDB A;  4A7B A;  1IAA A;  3WV1 A;  3Q2H A;  1IAB A;  3N2U A;  5CXA A;  3LK8 A;  1KUI A;  1ATL A;  3EDI A;  3N2V A;  3UVC A;  1C3I A;  2O3E A;  1IAD A;  3LEA A;  1CIZ A;  1MMR A;  3KWV C;  4JA1 A;  3KEJ A;  4L19 A;  3HB2 P;  1ZVX A;  4R3V A;  3ZUK A;  1CGF A;  3KME A;  2KRJ A;  2OVZ A;  1H71 P;  1CXV A;  1ZP5 A;  456C A;  2Z2D A;  2W14 A;  4PKR A;  2L0R A;  3VTG A;  2ERQ A;  1FLS A;  4H1Q A;  1R54 A;  4H30 A;  1HV5 A;  2MZE A;  4H3X A;  1XUR A;  2Y6D A;  1I1I P;  5LAB A;  5I12 A;  2POJ A;  3VI1 A;  3LMC A;  3WV3 A;  2CKI A;  2J0T A;  1GO7 P;  1HFS A;  4JP4 A;  2I47 A;  1R1J A;  3TVC A;  1K7I A;  1C7K A;  4WK7 A;  2OW9 A;  1ROS A;  1KUH A;  4PKQ A;  1Z3J A;  1UTT A;  1QIA A;  1XFW A;  2HU6 A;  4XM7 A;  3TS4 A;  3F1A A;  3LJG A;  1QIB A;  4L6T A;  5L79 A;  3K7N A;  1D8M A;  4L63 A;  3SHI A;  5D7W A;  5I43 A;  1FBL A;  1SU3 A;  2JNP A;  1MMQ A;  4AYK A;  4FXY P;  4EFS A;  1AST A;  3LQ0 A;  1ZXV A;  4GR3 A;  4A3W A;  2N8R A;  2YIG A;  4DV8 A;  2WOA A;  2OW0 A;  3F18 A;  830C A;  4ZR5 A;  3LIK A;  2XS3 A;  4GWM A;  2W0D A;  2MZH A;  2K2G A;  3LUN A;  1JK3 A;  1GKD A;  3USN A;  3KEC A;  1AYK A;  1JAQ A;  1G9K A;  2USN A;  1SLM A;  2DDY A;  1UEA A;  1GE6 A;  1GE7 A;  2YB9 A;  1G12 A;  4GWN A;  3HBV P;  5B5P A;  5D1U A;  2OXZ A;  1OMJ A;  1WNI A;  3WV2 A;  1KAP P;  2E2D A;  2FV9 A;  3KRY A;  1GKC A;  3TT4 A;  1J7N A;  3LJT A;  1YOU A;  3B2Z A;  4I35 A;  2JIH A;  3KEK A;  4FXQ A;  3LGP A;  1MNC A;  2TCL A;  1ZS0 A;  1B3D A;  4IJO A;  1BQO A;  1Y0V A;  1GXD A;  2XS4 A;  4WKI A;  3LE9 A;  4PKW A;  2A8H A;  1S4B P;  1C8T A;  1PWU A;  1R1H A;  1G4K A;  3LKA A;  4JIJ A; 
#chains in the Genus database with same CATH topology
 1UTZ A;  1O0T A;  1XUC A;  3I7G A;  1AKL A;  5H8X A;  1Q3A A;  5I3M A;  3Q2G A;  1SAT A;  1SRP A;  2O36 A;  1JH1 A;  1G05 A;  1BUD A;  3EDG A;  1USN A;  4XM8 A;  3EWJ A;  5CZM A;  2J83 A;  4WF6 A;  1D7X A;  1OZ9 A;  1CQR A;  3L0T A;  1KBC A;  1CK7 A;  3LIL A;  3DTE A;  3K7L A;  5D3C A;  1IAE A;  1UMT A;  1BM6 A;  4DPE A;  4H76 A;  5B5O A;  2OXW A;  2DW1 A;  1TVI A;  4FU4 A;  3V96 B;  4G9L A;  1AF0 A;  1MMP A;  1SLN A;  3ZXH A;  1KUF A;  2W12 A;  3DWB A;  3RTS A;  4G0D A;  2CLT A;  3F16 A;  2ERP A;  4CTH A;  1L6J A;  1OM7 A;  2D1O A;  2DW2 A;  1GO8 P;  3ELM A;  1XFV A;  4GQL A;  2RJP A;  1OO9 A;  3AYK A;  3DNG A;  1BZS A;  4GR0 A;  1XFX A;  4FVL A;  1OM8 A;  3ZVS A;  1BKC A;  3MA2 A;  1XUD A;  2X3C A;  1JJ9 A;  1BKC E;  4AUO A;  1QJI A;  2YUF A;  2FV5 A;  3G5C A;  3I7I A;  1QJJ A;  2JT5 A;  4J4M A;  3KMC A;  5I4O A;  1JAP A;  1UMS A;  1EUB A;  1PWP A;  2MLS A;  1IAG A;  3AYU A;  3DPF A;  3G42 A;  4IUW A;  1QIC A;  1OM6 A;  1OS9 A;  2WO8 A;  3L0V A;  4I03 A;  1JIW P;  1BIW A;  4ILW D;  1QUA A;  1FM1 A;  2Y6C A;  3B8Z A;  1YCM A;  1Y93 A;  2DDF A;  1R55 A;  4Q1L A;  1I76 A;  1PWW A;  1HY7 A;  1A85 A;  3DL1 A;  1GE5 A;  3NX7 A;  4IN9 A;  5JMY A;  1Y8J A;  4H2E A;  4JQG A;  5BOY A;  3HBU P;  1JIZ A;  3LQB A;  1HFC A;  3F17 A;  5BOT A;  2OZR A;  3GBO A;  1B8Y A;  1XFU A;  3DSL A;  1XFZ A;  1HOV A;  2X3B A;  3O64 A;  2ERO A;  1R1I A;  2OVX A;  2AYK A;  5L7F A;  4PKT A;  3F15 A;  2QPJ A;  1IAC A;  5D2B A;  4PKS A;  1ND1 A;  3E8R A;  1SMP A;  1DMT A;  1JKY A;  1I73 A;  1K7Q A;  3O2X A;  1YP1 A;  4H49 A;  3EDH A;  1YQY A;  2JT6 A;  2MZI A;  2OY4 A;  1RMZ A;  1DTH A;  3HYG A;  4JPA A;  1CGL A;  2OW2 A;  2SRT A;  2W15 A;  4DD8 A;  1EB6 A;  1EAK A;  966C A;  3KHI A;  5BPA A;  5D1T A;  4XBH A;  1PWV A;  4H82 A;  1BQQ M;  4AIG A;  1D8F A;  3OHO A;  3F19 A;  1BUV M;  2WO9 A;  4ON1 A;  1OS2 A;  4HX3 A;  4DF9 A;  3LUM A;  1KUK A;  2DW0 A;  3HY9 A;  2X3A A;  3EHY A;  1A86 A;  3RTT A;  3B92 A;  5I0L A;  3DPE A;  4PKV A;  3HY7 A;  1JAO A;  2OXU A;  3AIG A;  3U1R A;  1HTD A;  2W13 A;  4QKZ A;  1JAN A;  2X7M A;  2K9C A;  4XM6 A;  5I2Z A;  1PWQ A;  3LIR A;  4L7A A;  3DTK A;  5CUH A;  2MLR A;  1D5J A;  4H84 A;  1K7G A;  1CAQ A;  1BSW A;  3EHX A;  3HDA P;  1BKC I;  2RJQ A;  3P1V A;  4WZV A;  4XCT A;  3TSK A;  3BA0 A;  2JSD A;  2D1N A;  2OY2 A;  1CGE A;  1MMB A;  3EDZ A;  2E3X A;  1ZTQ A;  1ZXC A;  4PKU A;  2AIG P;  2PJT A;  4GUY A;  1KUG A;  1O0Q A;  2OI0 A;  2V4B A;  4WKE A;  3P24 A;  1G49 A;  4GF1 A;  4GR8 A;  5D1S A;  2OW1 A;  4AXQ A;  1XFY A;  3OHL A;  1RM8 A;  3LJZ A;  3CKI A;  4HMA A;  3HDB A;  4A7B A;  1IAA A;  3WV1 A;  3Q2H A;  1IAB A;  3N2U A;  5CXA A;  3LK8 A;  1KUI A;  1ATL A;  3EDI A;  3N2V A;  3UVC A;  1C3I A;  2O3E A;  1IAD A;  3LEA A;  1CIZ A;  1MMR A;  3KWV C;  4JA1 A;  3KEJ A;  4L19 A;  3HB2 P;  1ZVX A;  4R3V A;  3ZUK A;  1CGF A;  3KME A;  2KRJ A;  1XAX A;  2OVZ A;  1H71 P;  1CXV A;  1ZP5 A;  456C A;  2Z2D A;  2W14 A;  4PKR A;  2L0R A;  3VTG A;  2ERQ A;  1FLS A;  4H1Q A;  1R54 A;  4H30 A;  1HV5 A;  2MZE A;  3DTI A;  4H3X A;  1XUR A;  2Y6D A;  1I1I P;  5LAB A;  5I12 A;  2POJ A;  3VI1 A;  3LMC A;  3WV3 A;  2CKI A;  2J0T A;  1GO7 P;  1HFS A;  4JP4 A;  2I47 A;  1R1J A;  3TVC A;  1K7I A;  1C7K A;  4WK7 A;  2OW9 A;  1ROS A;  1KUH A;  4PKQ A;  1Z3J A;  1UTT A;  1QIA A;  1XFW A;  2HU6 A;  4XM7 A;  3TS4 A;  3F1A A;  3LJG A;  1QIB A;  4L6T A;  5L79 A;  3K7N A;  1D8M A;  4L63 A;  3SHI A;  5D7W A;  5I43 A;  1FBL A;  1SU3 A;  2JNP A;  1MMQ A;  4AYK A;  4FXY P;  4EFS A;  1AST A;  3LQ0 A;  1ZXV A;  4GR3 A;  4A3W A;  2N8R A;  2YIG A;  4DV8 A;  2WOA A;  2OW0 A;  3F18 A;  830C A;  4ZR5 A;  3LIK A;  2XS3 A;  4GWM A;  2W0D A;  2MZH A;  2K2G A;  3LUN A;  1JK3 A;  1GKD A;  3USN A;  3KEC A;  1AYK A;  1JAQ A;  1G9K A;  2USN A;  1SLM A;  2DDY A;  1UEA A;  1GE6 A;  1GE7 A;  2YB9 A;  1G12 A;  4GWN A;  3HBV P;  5B5P A;  5D1U A;  2OXZ A;  1OMJ A;  1WNI A;  3WV2 A;  1KAP P;  2E2D A;  2FV9 A;  3KRY A;  1GKC A;  3TT4 A;  1J7N A;  3LJT A;  1YOU A;  3B2Z A;  4I35 A;  2JIH A;  3KEK A;  4FXQ A;  3LGP A;  1MNC A;  2TCL A;  1ZS0 A;  1B3D A;  4IJO A;  1BQO A;  1Y0V A;  1GXD A;  2XS4 A;  4WKI A;  3LE9 A;  4PKW A;  2A8H A;  1S4B P;  1XM5 A;  1C8T A;  1PWU A;  1R1H A;  1G4K A;  3LKA A;  4JIJ A; 
#chains in the Genus database with same CATH homology
 1UTZ A;  1O0T A;  1XUC A;  3I7G A;  1AKL A;  5H8X A;  1Q3A A;  5I3M A;  3Q2G A;  1SAT A;  1SRP A;  2O36 A;  1JH1 A;  1G05 A;  1BUD A;  3EDG A;  1USN A;  4XM8 A;  3EWJ A;  5CZM A;  2J83 A;  4WF6 A;  1D7X A;  1CQR A;  3L0T A;  1KBC A;  1CK7 A;  3LIL A;  3DTE A;  3K7L A;  5D3C A;  1IAE A;  1UMT A;  1BM6 A;  4DPE A;  4H76 A;  5B5O A;  2OXW A;  2DW1 A;  4FU4 A;  3V96 B;  4G9L A;  1AF0 A;  1MMP A;  1SLN A;  3ZXH A;  1KUF A;  2W12 A;  3DWB A;  3RTS A;  4G0D A;  2CLT A;  3F16 A;  2ERP A;  4CTH A;  1L6J A;  1OM7 A;  2D1O A;  2DW2 A;  1GO8 P;  3ELM A;  1XFV A;  4GQL A;  2RJP A;  1OO9 A;  3AYK A;  3DNG A;  1BZS A;  4GR0 A;  1XFX A;  4FVL A;  1OM8 A;  3ZVS A;  1BKC A;  3MA2 A;  1XUD A;  2X3C A;  1JJ9 A;  1BKC E;  4AUO A;  1QJI A;  2YUF A;  2FV5 A;  3G5C A;  3I7I A;  1QJJ A;  2JT5 A;  4J4M A;  3KMC A;  5I4O A;  1JAP A;  1UMS A;  1EUB A;  1PWP A;  2MLS A;  1IAG A;  3AYU A;  3DPF A;  3G42 A;  4IUW A;  1QIC A;  1OM6 A;  1OS9 A;  2WO8 A;  3L0V A;  4I03 A;  1JIW P;  1BIW A;  4ILW D;  1QUA A;  1FM1 A;  2Y6C A;  3B8Z A;  1YCM A;  1Y93 A;  2DDF A;  1R55 A;  4Q1L A;  1I76 A;  1PWW A;  1HY7 A;  1A85 A;  3DL1 A;  1GE5 A;  3NX7 A;  4IN9 A;  5JMY A;  1Y8J A;  4H2E A;  4JQG A;  5BOY A;  3HBU P;  1JIZ A;  3LQB A;  1HFC A;  3F17 A;  5BOT A;  2OZR A;  3GBO A;  1B8Y A;  1XFU A;  3DSL A;  1XFZ A;  1HOV A;  2X3B A;  3O64 A;  2ERO A;  1R1I A;  2OVX A;  2AYK A;  5L7F A;  4PKT A;  3F15 A;  2QPJ A;  1IAC A;  5D2B A;  4PKS A;  1ND1 A;  3E8R A;  1SMP A;  1DMT A;  1JKY A;  1I73 A;  1K7Q A;  3O2X A;  1YP1 A;  4H49 A;  3EDH A;  1YQY A;  2JT6 A;  2MZI A;  2OY4 A;  1RMZ A;  1DTH A;  3HYG A;  4JPA A;  1CGL A;  2OW2 A;  2SRT A;  2W15 A;  4DD8 A;  1EB6 A;  1EAK A;  966C A;  3KHI A;  5BPA A;  5D1T A;  4XBH A;  1PWV A;  4H82 A;  1BQQ M;  4AIG A;  1D8F A;  3OHO A;  3F19 A;  1BUV M;  2WO9 A;  4ON1 A;  1OS2 A;  4HX3 A;  4DF9 A;  3LUM A;  1KUK A;  2DW0 A;  3HY9 A;  2X3A A;  3EHY A;  1A86 A;  3RTT A;  3B92 A;  5I0L A;  3DPE A;  4PKV A;  3HY7 A;  1JAO A;  2OXU A;  3AIG A;  3U1R A;  1HTD A;  2W13 A;  4QKZ A;  1JAN A;  2X7M A;  2K9C A;  4XM6 A;  5I2Z A;  1PWQ A;  3LIR A;  4L7A A;  3DTK A;  5CUH A;  2MLR A;  1D5J A;  4H84 A;  1K7G A;  1CAQ A;  1BSW A;  3EHX A;  3HDA P;  1BKC I;  2RJQ A;  3P1V A;  4WZV A;  4XCT A;  3TSK A;  3BA0 A;  2JSD A;  2D1N A;  2OY2 A;  1CGE A;  1MMB A;  3EDZ A;  2E3X A;  1ZTQ A;  1ZXC A;  4PKU A;  2AIG P;  2PJT A;  4GUY A;  1KUG A;  1O0Q A;  2OI0 A;  2V4B A;  4WKE A;  3P24 A;  1G49 A;  4GF1 A;  4GR8 A;  5D1S A;  2OW1 A;  4AXQ A;  1XFY A;  3OHL A;  1RM8 A;  3LJZ A;  3CKI A;  4HMA A;  3HDB A;  4A7B A;  1IAA A;  3WV1 A;  3Q2H A;  1IAB A;  3N2U A;  5CXA A;  3LK8 A;  1KUI A;  1ATL A;  3EDI A;  3N2V A;  3UVC A;  1C3I A;  2O3E A;  1IAD A;  3LEA A;  1CIZ A;  1MMR A;  3KWV C;  4JA1 A;  3KEJ A;  4L19 A;  3HB2 P;  1ZVX A;  4R3V A;  3ZUK A;  1CGF A;  3KME A;  2KRJ A;  2OVZ A;  1H71 P;  1CXV A;  1ZP5 A;  456C A;  2Z2D A;  2W14 A;  4PKR A;  2L0R A;  3VTG A;  2ERQ A;  1FLS A;  4H1Q A;  1R54 A;  4H30 A;  1HV5 A;  2MZE A;  3DTI A;  4H3X A;  1XUR A;  2Y6D A;  1I1I P;  5LAB A;  5I12 A;  2POJ A;  3VI1 A;  3LMC A;  3WV3 A;  2CKI A;  2J0T A;  1GO7 P;  1HFS A;  4JP4 A;  2I47 A;  1R1J A;  3TVC A;  1K7I A;  1C7K A;  4WK7 A;  2OW9 A;  1ROS A;  1KUH A;  4PKQ A;  1Z3J A;  1UTT A;  1QIA A;  1XFW A;  2HU6 A;  4XM7 A;  3TS4 A;  3F1A A;  3LJG A;  1QIB A;  4L6T A;  5L79 A;  3K7N A;  1D8M A;  4L63 A;  3SHI A;  5D7W A;  5I43 A;  1FBL A;  1SU3 A;  2JNP A;  1MMQ A;  4AYK A;  4FXY P;  4EFS A;  1AST A;  3LQ0 A;  1ZXV A;  4GR3 A;  4A3W A;  2N8R A;  2YIG A;  4DV8 A;  2WOA A;  2OW0 A;  3F18 A;  830C A;  4ZR5 A;  3LIK A;  2XS3 A;  4GWM A;  2W0D A;  2MZH A;  2K2G A;  3LUN A;  1JK3 A;  1GKD A;  3USN A;  3KEC A;  1AYK A;  1JAQ A;  1G9K A;  2USN A;  1SLM A;  2DDY A;  1UEA A;  1GE6 A;  1GE7 A;  2YB9 A;  1G12 A;  4GWN A;  3HBV P;  5B5P A;  5D1U A;  2OXZ A;  1OMJ A;  1WNI A;  3WV2 A;  1KAP P;  2E2D A;  2FV9 A;  3KRY A;  1GKC A;  3TT4 A;  1J7N A;  3LJT A;  1YOU A;  3B2Z A;  4I35 A;  2JIH A;  3KEK A;  4FXQ A;  3LGP A;  1MNC A;  2TCL A;  1ZS0 A;  1B3D A;  4IJO A;  1BQO A;  1Y0V A;  1GXD A;  2XS4 A;  4WKI A;  3LE9 A;  4PKW A;  2A8H A;  1S4B P;  1C8T A;  1PWU A;  1R1H A;  1G4K A;  3LKA A;  4JIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...