3OHLA

Catalytic domain of stromelysin-1 in complex with n-hydroxy-2-(4-methoxy-n-(pyridine-3-ylmethyl)phenylsulfonamido)acetamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
159
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANALMYPLYHRFRLSQDDINGIQSLYGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromelysin-1
publication title Non-Resonance Raman Difference Spectroscopy as a Tool to Probe Enthalpy-Entropy Compensation and the Interfacial Mobility Model
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 47
structure length 159
sequence length 167
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ohlA00
3KHIA 2JT5A 1XUDA 1GKCA 4XM6A 2ERQA 3LK8A 4CTHA 2K2GA 1C7KA 1KBCA 1QUAA 2OVXA 2ERPA 1GO8P 3GBOA 3SHIA 2AYKA 1PWPA 4ZR5A 3HY9A 1J7NA 2L0RA 4A3WA 1YQYA 1ASTA 4EFSA 3U1RA 3LJTA 1PWWA 3N2VA 3BA0A 2OXZA 2OY2A 1C3IA 1MMPA 3HBVP 4IUWA 1HFCA 1HY7A 1G4KA 4GR0A 1GE7A 3AYUA 1PWUA 3VI1A 1OM7A 1G49A 2MZIA 3KMCA 5B5PA 3RTTA 4DPEA 2W15A 4FU4A 2OY4A 1GO7P 1ZTQA 1BM6A 4FXQA 1KUIA 1MMRA 1BUDA 1IACA 830CA 5CXAA 3LUMA 1RMZA 3K7NA 2E3XA 2J0TA 4IJOA 2O36A 1SMPA 5I0LA 1HOVA 4DV8A 1O0QA 1Y8JA 1I76A 1YP1A 1ATLA 2Z2DA 1Y0VA 1CAQA 1AKLA 2CKIA 1BQOA 1OS2A 4H84A 4GUYA 2DW0A 4PKTA 3WV3A 1XURA 2E2DA 2A8HA 1JIWP 3OHLA 2DW1A 4AIGA 3P1VA 3LKAA 4WK7A 2KRJA 1BKCI 3Q2GA 4Q1LA 3EWJA 1Z3JA 2EROA 5B5OA 1JH1A 5JMYA 1ZS0A 1A85A 1ZXCA 4DF9A 4FXYP 1XFZA 3AIGA 2AIGP 4JIJA 1CGEA 3WV1A 1JJ9A 1O0TA 1SATA 2MZEA 4H76A 3EHXA 1G05A 3DPFA 2YIGA 2X7MA 2JSDA 1UTTA 5BPAA 3KEJA 1KUHA 3ELMA 2Y6CA 1XFVA 966CA 1QICA 5BOTA 1QJJA 3HB2P 3B92A 1ND1A 1YOUA 4FVLA 5L7FA 3DWBA 3EDGA 4DD8A 1UMTA 2JT6A 3HDAP 3NX7A 3ZVSA 4I35A 1B8YA 2D1NA 4A7BA 1JANA 4PKUA 1KAPP 1SRPA 1JAPA 4G9LA 3F19A 5I12A 1SLNA 2K9CA 1D5JA 4QKZA 4H30A 3AYKA 4GQLA 3I7GA 3LQBA 3L0VA 1FM1A 2J83A 3LUNA 4L6TA 1L6JA 2PJTA 1HTDA 4H2EA 2OZRA 2N8RA 1AYKA 4R3VA 1I73A 1K7GA 3G5CA 3VTGA 3I7IA 2XS3A 1CGFA 2OXWA 2O3EA 1OO9A 1XFUA 1BQQM 1D7XA 2DDFA 5I3MA 2D1OA 3L0TA 3F18A 3B2ZA 1MNCA 1CQRA 3HYGA 1DTHA 3HBUP 2MLSA 1WNIA 3N2UA 1B3DA 1USNA 4PKQA 2SRTA 1JKYA 1G9KA 1C8TA 3V96B 4GR3A 4GWMA 1Q3AA 2RJQA 4H3XA 2USNA 5CUHA 3LJGA 1EAKA 2OW2A 2DDYA 1FLSA 1K7IA 1R54A 2WO9A 3DPEA 2RJPA 1BSWA 2OI0A 3CKIA 3DL1A 2W13A 3UVCA 3LJZA 1QJIA 2MLRA 1JAQA 1ZVXA 1OS9A 3ZUKA 1JAOA 1A86A 1GKDA 1AF0A 4HMAA 1BIWA 2V4BA 5I4OA 1IAAA 3Q2HA 456CA 3USNA 1IABA 3LGPA 1IADA 3TSKA 1PWVA 2QPJA 2WOAA 1UMSA 2OW0A 1XFYA 1HV5A 2POJA 4XCTA 2OW1A 1OM8A 1PWQA 1QIBA 3KECA 3O2XA 3MA2A 1OM6A 3P24A 1ROSA 4I03A 1H71P 2X3BA 3DSLA 3LE9A 4L19A 1BUVM 5L79A 2WO8A 4XM7A 4PKWA 3LQ0A 1GE6A 3EDHA 1BZSA 1FBLA 1BKCA 3KEKA 2OW9A 2W0DA 1JIZA 1D8FA 4PKSA 2I47A 5D1TA 2JNPA 3LMCA 3HY7A 1D8MA 3TT4A 4WKIA 1SLMA 2OVZA 5I2ZA 1R1HA 3F15A 1XFXA 2JIHA 3F1AA 1ZP5A 1KUGA 1IAGA 1GE5A 5LABA 1HFSA 1XUCA 5H8XA 3HDBA 1EUBA 5D1UA 1XFWA 4GR8A 1R1JA 1CGLA 4JA1A 1MMQA 3EDZA 1Y93A 2W14A 5D3CA 1MMBA 2XS4A 1G12A 3KMEA 1CIZA 3O64A 2X3AA 1DMTA 3KRYA 1K7QA 2X3CA 3B8ZA 4L63A 2TCLA 3F16A 1QIAA 2YB9A 4ILWD 3KWVC 2FV9A 3DNGA 1KUKA 3LEAA 1IAEA 1RM8A 1R1IA 3K7LA 3EHYA 4PKVA 2FV5A 4XM8A 4XBHA 4G0DA 4ON1A 3F17A 1R55A 4WF6A 1CXVA 4JQGA 4GWNA 5I43A 1CK7A 2DW2A 5D1SA 1S4BP 4H1QA 3WV2A 2Y6DA 3RTSA 4HX3A 1I1IP 4AUOA 2W12A 5D2BA 3TVCA 2HU6A 1SU3A 3LILA 1EB6A 3TS4A 1ZXVA 5CZMA 3LIRA 3G42A 1GXDA 4AXQA 3EDIA 2OXUA 3OHOA 4JP4A 1OMJA 2MZHA 1KUFA 4IN9A 5D7WA 4WKEA 4H82A 4AYKA 4J4MA 1JK3A 4H49A 1BKCE 3E8RA 4JPAA 4WZVA 4PKRA 3ZXHA 4GF1A 1UEAA 2CLTA 1UTZA 3LIKA 1YCMA 5BOYA
chains in the Genus database with same CATH superfamily
3KHIA 2JT5A 1XUDA 1GKCA 4XM6A 2ERQA 3LK8A 4CTHA 2K2GA 1C7KA 1KBCA 1QUAA 2YUFA 2OVXA 2ERPA 1GO8P 3GBOA 3SHIA 2AYKA 1PWPA 4L7AA 4ZR5A 3HY9A 1J7NA 2L0RA 4A3WA 1YQYA 1ASTA 4EFSA 3U1RA 3LJTA 1PWWA 3N2VA 3BA0A 2OXZA 2OY2A 1C3IA 1MMPA 3HBVP 4IUWA 1HFCA 1HY7A 1G4KA 4GR0A 1GE7A 3AYUA 1PWUA 3VI1A 1OM7A 1G49A 2MZIA 3KMCA 5B5PA 3RTTA 3DTKA 4DPEA 2W15A 4FU4A 2OY4A 1GO7P 1ZTQA 1BM6A 4FXQA 1KUIA 1MMRA 1BUDA 1IACA 830CA 5CXAA 3LUMA 1RMZA 3K7NA 2E3XA 2J0TA 4IJOA 2O36A 1SMPA 5I0LA 1HOVA 4DV8A 1O0QA 1Y8JA 1I76A 1YP1A 1ATLA 2Z2DA 1Y0VA 1CAQA 1AKLA 2CKIA 1BQOA 1OS2A 4H84A 4GUYA 2DW0A 4PKTA 3WV3A 1XURA 2E2DA 2A8HA 1JIWP 3OHLA 2DW1A 4AIGA 3P1VA 3LKAA 4WK7A 2KRJA 1BKCI 3Q2GA 4Q1LA 3EWJA 1Z3JA 2EROA 5B5OA 1JH1A 5JMYA 1ZS0A 1A85A 1ZXCA 4DF9A 4FXYP 1XFZA 3AIGA 2AIGP 4JIJA 1CGEA 3WV1A 1JJ9A 1O0TA 1SATA 2MZEA 4H76A 3EHXA 1G05A 3DPFA 2YIGA 2X7MA 2JSDA 1UTTA 5BPAA 3KEJA 1KUHA 3ELMA 2Y6CA 1XFVA 966CA 1QICA 5BOTA 1QJJA 3HB2P 3B92A 1ND1A 1YOUA 4FVLA 5L7FA 3DWBA 3EDGA 4DD8A 1UMTA 2JT6A 3HDAP 3NX7A 3ZVSA 4I35A 1B8YA 2D1NA 4A7BA 1JANA 4PKUA 1KAPP 1SRPA 1JAPA 4G9LA 3F19A 5I12A 1SLNA 2K9CA 1D5JA 4QKZA 1TVIA 3DTIA 4H30A 3AYKA 4GQLA 3I7GA 3LQBA 3L0VA 1FM1A 2J83A 3LUNA 4L6TA 1L6JA 2PJTA 1HTDA 4H2EA 2OZRA 2N8RA 1AYKA 4R3VA 1I73A 1K7GA 3G5CA 3VTGA 3I7IA 2XS3A 1CGFA 2OXWA 2O3EA 1OO9A 1XFUA 1BQQM 1D7XA 2DDFA 5I3MA 2D1OA 3L0TA 3F18A 3B2ZA 1MNCA 1CQRA 3HYGA 1DTHA 3HBUP 2MLSA 1WNIA 3N2UA 1B3DA 1USNA 4PKQA 2SRTA 1JKYA 1G9KA 1C8TA 3V96B 4GR3A 4GWMA 1Q3AA 2RJQA 4H3XA 2USNA 5CUHA 3LJGA 1EAKA 2OW2A 2DDYA 1FLSA 1K7IA 1R54A 2WO9A 3DPEA 2RJPA 1BSWA 2OI0A 3CKIA 3DL1A 2W13A 3UVCA 3LJZA 1QJIA 2MLRA 1JAQA 1ZVXA 1OS9A 3ZUKA 1JAOA 1A86A 1GKDA 1AF0A 4HMAA 1BIWA 2V4BA 5I4OA 1IAAA 3Q2HA 456CA 3USNA 1IABA 3LGPA 1IADA 3TSKA 1PWVA 2QPJA 2WOAA 1UMSA 2OW0A 1XFYA 1HV5A 2POJA 4XCTA 2OW1A 1OM8A 1PWQA 1QIBA 3KECA 3O2XA 3MA2A 1OM6A 3P24A 1ROSA 4I03A 1H71P 2X3BA 3DSLA 3LE9A 4L19A 1BUVM 5L79A 2WO8A 4XM7A 4PKWA 3LQ0A 1GE6A 3EDHA 1BZSA 1FBLA 1BKCA 3KEKA 2OW9A 2W0DA 1JIZA 1D8FA 4PKSA 2I47A 5D1TA 2JNPA 3LMCA 3HY7A 1D8MA 3TT4A 4WKIA 1SLMA 2OVZA 5I2ZA 1R1HA 3F15A 1OZ9A 1XFXA 2JIHA 3F1AA 1ZP5A 1KUGA 1IAGA 1GE5A 5LABA 1HFSA 1XUCA 5H8XA 3HDBA 1EUBA 5D1UA 1XFWA 4GR8A 1R1JA 1CGLA 4JA1A 1MMQA 3EDZA 1Y93A 2W14A 5D3CA 1MMBA 2XS4A 1G12A 1XAXA 3KMEA 1CIZA 3O64A 2X3AA 1DMTA 3KRYA 1K7QA 2X3CA 3B8ZA 4L63A 2TCLA 3F16A 1QIAA 2YB9A 4ILWD 3KWVC 2FV9A 3DNGA 1KUKA 3LEAA 1IAEA 1RM8A 1R1IA 3K7LA 3EHYA 4PKVA 3DTEA 2FV5A 4XM8A 4XBHA 4G0DA 4ON1A 3F17A 1R55A 4WF6A 1CXVA 4JQGA 4GWNA 5I43A 1CK7A 2DW2A 5D1SA 1S4BP 4H1QA 3WV2A 2Y6DA 3RTSA 4HX3A 1I1IP 4AUOA 2W12A 5D2BA 3TVCA 2HU6A 1SU3A 3LILA 1EB6A 3TS4A 1ZXVA 5CZMA 3LIRA 1XM5A 3G42A 1GXDA 4AXQA 3EDIA 2OXUA 3OHOA 4JP4A 1OMJA 2MZHA 1KUFA 4IN9A 5D7WA 4WKEA 4H82A 4AYKA 4J4MA 1JK3A 4H49A 1BKCE 3E8RA 4JPAA 4WZVA 4PKRA 3ZXHA 4GF1A 1UEAA 2CLTA 1UTZA 3LIKA 1YCMA 5BOYA
chains in the Genus database with same CATH topology
3KHIA 2JT5A 1XUDA 1GKCA 4XM6A 2ERQA 3LK8A 4CTHA 2K2GA 1C7KA 1KBCA 1QUAA 2YUFA 2OVXA 2ERPA 1GO8P 3GBOA 3SHIA 2AYKA 1PWPA 4L7AA 4ZR5A 3HY9A 1J7NA 2L0RA 4A3WA 1YQYA 1ASTA 4EFSA 3U1RA 3LJTA 1PWWA 3N2VA 3BA0A 2OXZA 2OY2A 1C3IA 1MMPA 3HBVP 4IUWA 1HFCA 1HY7A 1G4KA 4GR0A 1GE7A 3AYUA 1PWUA 3VI1A 1OM7A 1G49A 2MZIA 3KMCA 5B5PA 3RTTA 3DTKA 4DPEA 2W15A 4FU4A 2OY4A 1GO7P 1ZTQA 1BM6A 4FXQA 1KUIA 1MMRA 1BUDA 1IACA 830CA 5CXAA 3LUMA 1RMZA 3K7NA 2E3XA 2J0TA 4IJOA 2O36A 1SMPA 5I0LA 1HOVA 4DV8A 1O0QA 1Y8JA 1I76A 1YP1A 1ATLA 2Z2DA 1Y0VA 1CAQA 1AKLA 2CKIA 1BQOA 1OS2A 4H84A 4GUYA 2DW0A 4PKTA 3WV3A 1XURA 2E2DA 2A8HA 1JIWP 3OHLA 2DW1A 4AIGA 3P1VA 3LKAA 4WK7A 2KRJA 1BKCI 3Q2GA 4Q1LA 3EWJA 1Z3JA 2EROA 5B5OA 1JH1A 5JMYA 1ZS0A 1A85A 1ZXCA 4DF9A 4FXYP 1XFZA 3AIGA 2AIGP 4JIJA 1CGEA 3WV1A 1JJ9A 1O0TA 1SATA 2MZEA 4H76A 3EHXA 1G05A 3DPFA 2YIGA 2X7MA 2JSDA 1UTTA 5BPAA 3KEJA 1KUHA 3ELMA 2Y6CA 1XFVA 966CA 1QICA 5BOTA 1QJJA 3HB2P 3B92A 1ND1A 1YOUA 4FVLA 5L7FA 3DWBA 3EDGA 4DD8A 1UMTA 2JT6A 3HDAP 3NX7A 3ZVSA 4I35A 1B8YA 2D1NA 4A7BA 1JANA 4PKUA 1KAPP 1SRPA 1JAPA 4G9LA 3F19A 5I12A 1SLNA 2K9CA 1D5JA 4QKZA 3DTIA 4H30A 3AYKA 4GQLA 3I7GA 3LQBA 3L0VA 1FM1A 2J83A 3LUNA 4L6TA 1L6JA 2PJTA 1HTDA 4H2EA 2OZRA 2N8RA 1AYKA 4R3VA 1I73A 1K7GA 3G5CA 3VTGA 3I7IA 2XS3A 1CGFA 2OXWA 2O3EA 1OO9A 1XFUA 1BQQM 1D7XA 2DDFA 5I3MA 2D1OA 3L0TA 3F18A 3B2ZA 1MNCA 1CQRA 3HYGA 1DTHA 3HBUP 2MLSA 1WNIA 3N2UA 1B3DA 1USNA 4PKQA 2SRTA 1JKYA 1G9KA 1C8TA 3V96B 4GR3A 4GWMA 1Q3AA 2RJQA 4H3XA 2USNA 5CUHA 3LJGA 1EAKA 2OW2A 2DDYA 1FLSA 1K7IA 1R54A 2WO9A 3DPEA 2RJPA 1BSWA 2OI0A 3CKIA 3DL1A 2W13A 3UVCA 3LJZA 1QJIA 2MLRA 1JAQA 1ZVXA 1OS9A 3ZUKA 1JAOA 1A86A 1GKDA 1AF0A 4HMAA 1BIWA 2V4BA 5I4OA 1IAAA 3Q2HA 456CA 3USNA 1IABA 3LGPA 1IADA 3TSKA 1PWVA 2QPJA 2WOAA 1UMSA 2OW0A 1XFYA 1HV5A 2POJA 4XCTA 2OW1A 1OM8A 1PWQA 1QIBA 3KECA 3O2XA 3MA2A 1OM6A 3P24A 1ROSA 4I03A 1H71P 2X3BA 3DSLA 3LE9A 4L19A 1BUVM 5L79A 2WO8A 4XM7A 4PKWA 3LQ0A 1GE6A 3EDHA 1BZSA 1FBLA 1BKCA 3KEKA 2OW9A 2W0DA 1JIZA 1D8FA 4PKSA 2I47A 5D1TA 2JNPA 3LMCA 3HY7A 1D8MA 3TT4A 4WKIA 1SLMA 2OVZA 5I2ZA 1R1HA 3F15A 1XFXA 2JIHA 3F1AA 1ZP5A 1KUGA 1IAGA 1GE5A 5LABA 1HFSA 1XUCA 5H8XA 3HDBA 1EUBA 5D1UA 1XFWA 4GR8A 1R1JA 1CGLA 4JA1A 1MMQA 3EDZA 1Y93A 2W14A 5D3CA 1MMBA 2XS4A 1G12A 3KMEA 1CIZA 3O64A 2X3AA 1DMTA 3KRYA 1K7QA 2X3CA 3B8ZA 4L63A 2TCLA 3F16A 1QIAA 2YB9A 4ILWD 3KWVC 2FV9A 3DNGA 1KUKA 3LEAA 1IAEA 1RM8A 1R1IA 3K7LA 3EHYA 4PKVA 3DTEA 2FV5A 4XM8A 4XBHA 4G0DA 4ON1A 3F17A 1R55A 4WF6A 1CXVA 4JQGA 4GWNA 5I43A 1CK7A 2DW2A 5D1SA 1S4BP 4H1QA 3WV2A 2Y6DA 3RTSA 4HX3A 1I1IP 4AUOA 2W12A 5D2BA 3TVCA 2HU6A 1SU3A 3LILA 1EB6A 3TS4A 1ZXVA 5CZMA 3LIRA 3G42A 1GXDA 4AXQA 3EDIA 2OXUA 3OHOA 4JP4A 1OMJA 2MZHA 1KUFA 4IN9A 5D7WA 4WKEA 4H82A 4AYKA 4J4MA 1JK3A 4H49A 1BKCE 3E8RA 4JPAA 4WZVA 4PKRA 3ZXHA 4GF1A 1UEAA 2CLTA 1UTZA 3LIKA 1YCMA 5BOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHI A;  2JT5 A;  1XUD A;  1GKC A;  4XM6 A;  2ERQ A;  3LK8 A;  4CTH A;  2K2G A;  1C7K A;  1KBC A;  1QUA A;  2OVX A;  2ERP A;  1GO8 P;  3GBO A;  3SHI A;  2AYK A;  1PWP A;  4ZR5 A;  3HY9 A;  1J7N A;  2L0R A;  4A3W A;  1YQY A;  1AST A;  4EFS A;  3U1R A;  3LJT A;  1PWW A;  3N2V A;  3BA0 A;  2OXZ A;  2OY2 A;  1C3I A;  1MMP A;  3HBV P;  4IUW A;  1HFC A;  1HY7 A;  1G4K A;  4GR0 A;  1GE7 A;  3AYU A;  1PWU A;  3VI1 A;  1OM7 A;  1G49 A;  2MZI A;  3KMC A;  5B5P A;  3RTT A;  4DPE A;  2W15 A;  4FU4 A;  2OY4 A;  1GO7 P;  1ZTQ A;  1BM6 A;  4FXQ A;  1KUI A;  1MMR A;  1BUD A;  1IAC A;  830C A;  5CXA A;  3LUM A;  1RMZ A;  3K7N A;  2E3X A;  2J0T A;  4IJO A;  2O36 A;  1SMP A;  5I0L A;  1HOV A;  4DV8 A;  1O0Q A;  1Y8J A;  1I76 A;  1YP1 A;  1ATL A;  2Z2D A;  1Y0V A;  1CAQ A;  1AKL A;  2CKI A;  1BQO A;  1OS2 A;  4H84 A;  4GUY A;  2DW0 A;  4PKT A;  3WV3 A;  1XUR A;  2E2D A;  2A8H A;  1JIW P;  3OHL A;  2DW1 A;  4AIG A;  3P1V A;  3LKA A;  4WK7 A;  2KRJ A;  1BKC I;  3Q2G A;  4Q1L A;  3EWJ A;  1Z3J A;  2ERO A;  5B5O A;  1JH1 A;  5JMY A;  1ZS0 A;  1A85 A;  1ZXC A;  4DF9 A;  4FXY P;  1XFZ A;  3AIG A;  2AIG P;  4JIJ A;  1CGE A;  3WV1 A;  1JJ9 A;  1O0T A;  1SAT A;  2MZE A;  4H76 A;  3EHX A;  1G05 A;  3DPF A;  2YIG A;  2X7M A;  2JSD A;  1UTT A;  5BPA A;  3KEJ A;  1KUH A;  3ELM A;  2Y6C A;  1XFV A;  966C A;  1QIC A;  5BOT A;  1QJJ A;  3HB2 P;  3B92 A;  1ND1 A;  1YOU A;  4FVL A;  5L7F A;  3DWB A;  3EDG A;  4DD8 A;  1UMT A;  2JT6 A;  3HDA P;  3NX7 A;  3ZVS A;  4I35 A;  1B8Y A;  2D1N A;  4A7B A;  1JAN A;  4PKU A;  1KAP P;  1SRP A;  1JAP A;  4G9L A;  3F19 A;  5I12 A;  1SLN A;  2K9C A;  1D5J A;  4QKZ A;  4H30 A;  3AYK A;  4GQL A;  3I7G A;  3LQB A;  3L0V A;  1FM1 A;  2J83 A;  3LUN A;  4L6T A;  1L6J A;  2PJT A;  1HTD A;  4H2E A;  2OZR A;  2N8R A;  1AYK A;  4R3V A;  1I73 A;  1K7G A;  3G5C A;  3VTG A;  3I7I A;  2XS3 A;  1CGF A;  2OXW A;  2O3E A;  1OO9 A;  1XFU A;  1BQQ M;  1D7X A;  2DDF A;  5I3M A;  2D1O A;  3L0T A;  3F18 A;  3B2Z A;  1MNC A;  1CQR A;  3HYG A;  1DTH A;  3HBU P;  2MLS A;  1WNI A;  3N2U A;  1B3D A;  1USN A;  4PKQ A;  2SRT A;  1JKY A;  1G9K A;  1C8T A;  3V96 B;  4GR3 A;  4GWM A;  1Q3A A;  2RJQ A;  4H3X A;  2USN A;  5CUH A;  3LJG A;  1EAK A;  2OW2 A;  2DDY A;  1FLS A;  1K7I A;  1R54 A;  2WO9 A;  3DPE A;  2RJP A;  1BSW A;  2OI0 A;  3CKI A;  3DL1 A;  2W13 A;  3UVC A;  3LJZ A;  1QJI A;  2MLR A;  1JAQ A;  1ZVX A;  1OS9 A;  3ZUK A;  1JAO A;  1A86 A;  1GKD A;  1AF0 A;  4HMA A;  1BIW A;  2V4B A;  5I4O A;  1IAA A;  3Q2H A;  456C A;  3USN A;  1IAB A;  3LGP A;  1IAD A;  3TSK A;  1PWV A;  2QPJ A;  2WOA A;  1UMS A;  2OW0 A;  1XFY A;  1HV5 A;  2POJ A;  4XCT A;  2OW1 A;  1OM8 A;  1PWQ A;  1QIB A;  3KEC A;  3O2X A;  3MA2 A;  1OM6 A;  3P24 A;  1ROS A;  4I03 A;  1H71 P;  2X3B A;  3DSL A;  3LE9 A;  4L19 A;  1BUV M;  5L79 A;  2WO8 A;  4XM7 A;  4PKW A;  3LQ0 A;  1GE6 A;  3EDH A;  1BZS A;  1FBL A;  1BKC A;  3KEK A;  2OW9 A;  2W0D A;  1JIZ A;  1D8F A;  4PKS A;  2I47 A;  5D1T A;  2JNP A;  3LMC A;  3HY7 A;  1D8M A;  3TT4 A;  4WKI A;  1SLM A;  2OVZ A;  5I2Z A;  1R1H A;  3F15 A;  1XFX A;  2JIH A;  3F1A A;  1ZP5 A;  1KUG A;  1IAG A;  1GE5 A;  5LAB A;  1HFS A;  1XUC A;  5H8X A;  3HDB A;  1EUB A;  5D1U A;  1XFW A;  4GR8 A;  1R1J A;  1CGL A;  4JA1 A;  1MMQ A;  3EDZ A;  1Y93 A;  2W14 A;  5D3C A;  1MMB A;  2XS4 A;  1G12 A;  3KME A;  1CIZ A;  3O64 A;  2X3A A;  1DMT A;  3KRY A;  1K7Q A;  2X3C A;  3B8Z A;  4L63 A;  2TCL A;  3F16 A;  1QIA A;  2YB9 A;  4ILW D;  3KWV C;  2FV9 A;  3DNG A;  1KUK A;  3LEA A;  1IAE A;  1RM8 A;  1R1I A;  3K7L A;  3EHY A;  4PKV A;  2FV5 A;  4XM8 A;  4XBH A;  4G0D A;  4ON1 A;  3F17 A;  1R55 A;  4WF6 A;  1CXV A;  4JQG A;  4GWN A;  5I43 A;  1CK7 A;  2DW2 A;  5D1S A;  1S4B P;  4H1Q A;  3WV2 A;  2Y6D A;  3RTS A;  4HX3 A;  1I1I P;  4AUO A;  2W12 A;  5D2B A;  3TVC A;  2HU6 A;  1SU3 A;  3LIL A;  1EB6 A;  3TS4 A;  1ZXV A;  5CZM A;  3LIR A;  3G42 A;  1GXD A;  4AXQ A;  3EDI A;  2OXU A;  3OHO A;  4JP4 A;  1OMJ A;  2MZH A;  1KUF A;  4IN9 A;  5D7W A;  4WKE A;  4H82 A;  4AYK A;  4J4M A;  1JK3 A;  4H49 A;  1BKC E;  3E8R A;  4JPA A;  4WZV A;  4PKR A;  3ZXH A;  4GF1 A;  1UEA A;  2CLT A;  1UTZ A;  3LIK A;  1YCM A;  5BOY A; 
#chains in the Genus database with same CATH topology
 3KHI A;  2JT5 A;  1XUD A;  1GKC A;  4XM6 A;  2ERQ A;  3LK8 A;  4CTH A;  2K2G A;  1C7K A;  1KBC A;  1QUA A;  2YUF A;  2OVX A;  2ERP A;  1GO8 P;  3GBO A;  3SHI A;  2AYK A;  1PWP A;  4L7A A;  4ZR5 A;  3HY9 A;  1J7N A;  2L0R A;  4A3W A;  1YQY A;  1AST A;  4EFS A;  3U1R A;  3LJT A;  1PWW A;  3N2V A;  3BA0 A;  2OXZ A;  2OY2 A;  1C3I A;  1MMP A;  3HBV P;  4IUW A;  1HFC A;  1HY7 A;  1G4K A;  4GR0 A;  1GE7 A;  3AYU A;  1PWU A;  3VI1 A;  1OM7 A;  1G49 A;  2MZI A;  3KMC A;  5B5P A;  3RTT A;  3DTK A;  4DPE A;  2W15 A;  4FU4 A;  2OY4 A;  1GO7 P;  1ZTQ A;  1BM6 A;  4FXQ A;  1KUI A;  1MMR A;  1BUD A;  1IAC A;  830C A;  5CXA A;  3LUM A;  1RMZ A;  3K7N A;  2E3X A;  2J0T A;  4IJO A;  2O36 A;  1SMP A;  5I0L A;  1HOV A;  4DV8 A;  1O0Q A;  1Y8J A;  1I76 A;  1YP1 A;  1ATL A;  2Z2D A;  1Y0V A;  1CAQ A;  1AKL A;  2CKI A;  1BQO A;  1OS2 A;  4H84 A;  4GUY A;  2DW0 A;  4PKT A;  3WV3 A;  1XUR A;  2E2D A;  2A8H A;  1JIW P;  3OHL A;  2DW1 A;  4AIG A;  3P1V A;  3LKA A;  4WK7 A;  2KRJ A;  1BKC I;  3Q2G A;  4Q1L A;  3EWJ A;  1Z3J A;  2ERO A;  5B5O A;  1JH1 A;  5JMY A;  1ZS0 A;  1A85 A;  1ZXC A;  4DF9 A;  4FXY P;  1XFZ A;  3AIG A;  2AIG P;  4JIJ A;  1CGE A;  3WV1 A;  1JJ9 A;  1O0T A;  1SAT A;  2MZE A;  4H76 A;  3EHX A;  1G05 A;  3DPF A;  2YIG A;  2X7M A;  2JSD A;  1UTT A;  5BPA A;  3KEJ A;  1KUH A;  3ELM A;  2Y6C A;  1XFV A;  966C A;  1QIC A;  5BOT A;  1QJJ A;  3HB2 P;  3B92 A;  1ND1 A;  1YOU A;  4FVL A;  5L7F A;  3DWB A;  3EDG A;  4DD8 A;  1UMT A;  2JT6 A;  3HDA P;  3NX7 A;  3ZVS A;  4I35 A;  1B8Y A;  2D1N A;  4A7B A;  1JAN A;  4PKU A;  1KAP P;  1SRP A;  1JAP A;  4G9L A;  3F19 A;  5I12 A;  1SLN A;  2K9C A;  1D5J A;  4QKZ A;  1TVI A;  3DTI A;  4H30 A;  3AYK A;  4GQL A;  3I7G A;  3LQB A;  3L0V A;  1FM1 A;  2J83 A;  3LUN A;  4L6T A;  1L6J A;  2PJT A;  1HTD A;  4H2E A;  2OZR A;  2N8R A;  1AYK A;  4R3V A;  1I73 A;  1K7G A;  3G5C A;  3VTG A;  3I7I A;  2XS3 A;  1CGF A;  2OXW A;  2O3E A;  1OO9 A;  1XFU A;  1BQQ M;  1D7X A;  2DDF A;  5I3M A;  2D1O A;  3L0T A;  3F18 A;  3B2Z A;  1MNC A;  1CQR A;  3HYG A;  1DTH A;  3HBU P;  2MLS A;  1WNI A;  3N2U A;  1B3D A;  1USN A;  4PKQ A;  2SRT A;  1JKY A;  1G9K A;  1C8T A;  3V96 B;  4GR3 A;  4GWM A;  1Q3A A;  2RJQ A;  4H3X A;  2USN A;  5CUH A;  3LJG A;  1EAK A;  2OW2 A;  2DDY A;  1FLS A;  1K7I A;  1R54 A;  2WO9 A;  3DPE A;  2RJP A;  1BSW A;  2OI0 A;  3CKI A;  3DL1 A;  2W13 A;  3UVC A;  3LJZ A;  1QJI A;  2MLR A;  1JAQ A;  1ZVX A;  1OS9 A;  3ZUK A;  1JAO A;  1A86 A;  1GKD A;  1AF0 A;  4HMA A;  1BIW A;  2V4B A;  5I4O A;  1IAA A;  3Q2H A;  456C A;  3USN A;  1IAB A;  3LGP A;  1IAD A;  3TSK A;  1PWV A;  2QPJ A;  2WOA A;  1UMS A;  2OW0 A;  1XFY A;  1HV5 A;  2POJ A;  4XCT A;  2OW1 A;  1OM8 A;  1PWQ A;  1QIB A;  3KEC A;  3O2X A;  3MA2 A;  1OM6 A;  3P24 A;  1ROS A;  4I03 A;  1H71 P;  2X3B A;  3DSL A;  3LE9 A;  4L19 A;  1BUV M;  5L79 A;  2WO8 A;  4XM7 A;  4PKW A;  3LQ0 A;  1GE6 A;  3EDH A;  1BZS A;  1FBL A;  1BKC A;  3KEK A;  2OW9 A;  2W0D A;  1JIZ A;  1D8F A;  4PKS A;  2I47 A;  5D1T A;  2JNP A;  3LMC A;  3HY7 A;  1D8M A;  3TT4 A;  4WKI A;  1SLM A;  2OVZ A;  5I2Z A;  1R1H A;  3F15 A;  1OZ9 A;  1XFX A;  2JIH A;  3F1A A;  1ZP5 A;  1KUG A;  1IAG A;  1GE5 A;  5LAB A;  1HFS A;  1XUC A;  5H8X A;  3HDB A;  1EUB A;  5D1U A;  1XFW A;  4GR8 A;  1R1J A;  1CGL A;  4JA1 A;  1MMQ A;  3EDZ A;  1Y93 A;  2W14 A;  5D3C A;  1MMB A;  2XS4 A;  1G12 A;  1XAX A;  3KME A;  1CIZ A;  3O64 A;  2X3A A;  1DMT A;  3KRY A;  1K7Q A;  2X3C A;  3B8Z A;  4L63 A;  2TCL A;  3F16 A;  1QIA A;  2YB9 A;  4ILW D;  3KWV C;  2FV9 A;  3DNG A;  1KUK A;  3LEA A;  1IAE A;  1RM8 A;  1R1I A;  3K7L A;  3EHY A;  4PKV A;  3DTE A;  2FV5 A;  4XM8 A;  4XBH A;  4G0D A;  4ON1 A;  3F17 A;  1R55 A;  4WF6 A;  1CXV A;  4JQG A;  4GWN A;  5I43 A;  1CK7 A;  2DW2 A;  5D1S A;  1S4B P;  4H1Q A;  3WV2 A;  2Y6D A;  3RTS A;  4HX3 A;  1I1I P;  4AUO A;  2W12 A;  5D2B A;  3TVC A;  2HU6 A;  1SU3 A;  3LIL A;  1EB6 A;  3TS4 A;  1ZXV A;  5CZM A;  3LIR A;  1XM5 A;  3G42 A;  1GXD A;  4AXQ A;  3EDI A;  2OXU A;  3OHO A;  4JP4 A;  1OMJ A;  2MZH A;  1KUF A;  4IN9 A;  5D7W A;  4WKE A;  4H82 A;  4AYK A;  4J4M A;  1JK3 A;  4H49 A;  1BKC E;  3E8R A;  4JPA A;  4WZV A;  4PKR A;  3ZXH A;  4GF1 A;  1UEA A;  2CLT A;  1UTZ A;  3LIK A;  1YCM A;  5BOY A; 
#chains in the Genus database with same CATH homology
 3KHI A;  2JT5 A;  1XUD A;  1GKC A;  4XM6 A;  2ERQ A;  3LK8 A;  4CTH A;  2K2G A;  1C7K A;  1KBC A;  1QUA A;  2YUF A;  2OVX A;  2ERP A;  1GO8 P;  3GBO A;  3SHI A;  2AYK A;  1PWP A;  4L7A A;  4ZR5 A;  3HY9 A;  1J7N A;  2L0R A;  4A3W A;  1YQY A;  1AST A;  4EFS A;  3U1R A;  3LJT A;  1PWW A;  3N2V A;  3BA0 A;  2OXZ A;  2OY2 A;  1C3I A;  1MMP A;  3HBV P;  4IUW A;  1HFC A;  1HY7 A;  1G4K A;  4GR0 A;  1GE7 A;  3AYU A;  1PWU A;  3VI1 A;  1OM7 A;  1G49 A;  2MZI A;  3KMC A;  5B5P A;  3RTT A;  3DTK A;  4DPE A;  2W15 A;  4FU4 A;  2OY4 A;  1GO7 P;  1ZTQ A;  1BM6 A;  4FXQ A;  1KUI A;  1MMR A;  1BUD A;  1IAC A;  830C A;  5CXA A;  3LUM A;  1RMZ A;  3K7N A;  2E3X A;  2J0T A;  4IJO A;  2O36 A;  1SMP A;  5I0L A;  1HOV A;  4DV8 A;  1O0Q A;  1Y8J A;  1I76 A;  1YP1 A;  1ATL A;  2Z2D A;  1Y0V A;  1CAQ A;  1AKL A;  2CKI A;  1BQO A;  1OS2 A;  4H84 A;  4GUY A;  2DW0 A;  4PKT A;  3WV3 A;  1XUR A;  2E2D A;  2A8H A;  1JIW P;  3OHL A;  2DW1 A;  4AIG A;  3P1V A;  3LKA A;  4WK7 A;  2KRJ A;  1BKC I;  3Q2G A;  4Q1L A;  3EWJ A;  1Z3J A;  2ERO A;  5B5O A;  1JH1 A;  5JMY A;  1ZS0 A;  1A85 A;  1ZXC A;  4DF9 A;  4FXY P;  1XFZ A;  3AIG A;  2AIG P;  4JIJ A;  1CGE A;  3WV1 A;  1JJ9 A;  1O0T A;  1SAT A;  2MZE A;  4H76 A;  3EHX A;  1G05 A;  3DPF A;  2YIG A;  2X7M A;  2JSD A;  1UTT A;  5BPA A;  3KEJ A;  1KUH A;  3ELM A;  2Y6C A;  1XFV A;  966C A;  1QIC A;  5BOT A;  1QJJ A;  3HB2 P;  3B92 A;  1ND1 A;  1YOU A;  4FVL A;  5L7F A;  3DWB A;  3EDG A;  4DD8 A;  1UMT A;  2JT6 A;  3HDA P;  3NX7 A;  3ZVS A;  4I35 A;  1B8Y A;  2D1N A;  4A7B A;  1JAN A;  4PKU A;  1KAP P;  1SRP A;  1JAP A;  4G9L A;  3F19 A;  5I12 A;  1SLN A;  2K9C A;  1D5J A;  4QKZ A;  3DTI A;  4H30 A;  3AYK A;  4GQL A;  3I7G A;  3LQB A;  3L0V A;  1FM1 A;  2J83 A;  3LUN A;  4L6T A;  1L6J A;  2PJT A;  1HTD A;  4H2E A;  2OZR A;  2N8R A;  1AYK A;  4R3V A;  1I73 A;  1K7G A;  3G5C A;  3VTG A;  3I7I A;  2XS3 A;  1CGF A;  2OXW A;  2O3E A;  1OO9 A;  1XFU A;  1BQQ M;  1D7X A;  2DDF A;  5I3M A;  2D1O A;  3L0T A;  3F18 A;  3B2Z A;  1MNC A;  1CQR A;  3HYG A;  1DTH A;  3HBU P;  2MLS A;  1WNI A;  3N2U A;  1B3D A;  1USN A;  4PKQ A;  2SRT A;  1JKY A;  1G9K A;  1C8T A;  3V96 B;  4GR3 A;  4GWM A;  1Q3A A;  2RJQ A;  4H3X A;  2USN A;  5CUH A;  3LJG A;  1EAK A;  2OW2 A;  2DDY A;  1FLS A;  1K7I A;  1R54 A;  2WO9 A;  3DPE A;  2RJP A;  1BSW A;  2OI0 A;  3CKI A;  3DL1 A;  2W13 A;  3UVC A;  3LJZ A;  1QJI A;  2MLR A;  1JAQ A;  1ZVX A;  1OS9 A;  3ZUK A;  1JAO A;  1A86 A;  1GKD A;  1AF0 A;  4HMA A;  1BIW A;  2V4B A;  5I4O A;  1IAA A;  3Q2H A;  456C A;  3USN A;  1IAB A;  3LGP A;  1IAD A;  3TSK A;  1PWV A;  2QPJ A;  2WOA A;  1UMS A;  2OW0 A;  1XFY A;  1HV5 A;  2POJ A;  4XCT A;  2OW1 A;  1OM8 A;  1PWQ A;  1QIB A;  3KEC A;  3O2X A;  3MA2 A;  1OM6 A;  3P24 A;  1ROS A;  4I03 A;  1H71 P;  2X3B A;  3DSL A;  3LE9 A;  4L19 A;  1BUV M;  5L79 A;  2WO8 A;  4XM7 A;  4PKW A;  3LQ0 A;  1GE6 A;  3EDH A;  1BZS A;  1FBL A;  1BKC A;  3KEK A;  2OW9 A;  2W0D A;  1JIZ A;  1D8F A;  4PKS A;  2I47 A;  5D1T A;  2JNP A;  3LMC A;  3HY7 A;  1D8M A;  3TT4 A;  4WKI A;  1SLM A;  2OVZ A;  5I2Z A;  1R1H A;  3F15 A;  1XFX A;  2JIH A;  3F1A A;  1ZP5 A;  1KUG A;  1IAG A;  1GE5 A;  5LAB A;  1HFS A;  1XUC A;  5H8X A;  3HDB A;  1EUB A;  5D1U A;  1XFW A;  4GR8 A;  1R1J A;  1CGL A;  4JA1 A;  1MMQ A;  3EDZ A;  1Y93 A;  2W14 A;  5D3C A;  1MMB A;  2XS4 A;  1G12 A;  3KME A;  1CIZ A;  3O64 A;  2X3A A;  1DMT A;  3KRY A;  1K7Q A;  2X3C A;  3B8Z A;  4L63 A;  2TCL A;  3F16 A;  1QIA A;  2YB9 A;  4ILW D;  3KWV C;  2FV9 A;  3DNG A;  1KUK A;  3LEA A;  1IAE A;  1RM8 A;  1R1I A;  3K7L A;  3EHY A;  4PKV A;  3DTE A;  2FV5 A;  4XM8 A;  4XBH A;  4G0D A;  4ON1 A;  3F17 A;  1R55 A;  4WF6 A;  1CXV A;  4JQG A;  4GWN A;  5I43 A;  1CK7 A;  2DW2 A;  5D1S A;  1S4B P;  4H1Q A;  3WV2 A;  2Y6D A;  3RTS A;  4HX3 A;  1I1I P;  4AUO A;  2W12 A;  5D2B A;  3TVC A;  2HU6 A;  1SU3 A;  3LIL A;  1EB6 A;  3TS4 A;  1ZXV A;  5CZM A;  3LIR A;  3G42 A;  1GXD A;  4AXQ A;  3EDI A;  2OXU A;  3OHO A;  4JP4 A;  1OMJ A;  2MZH A;  1KUF A;  4IN9 A;  5D7W A;  4WKE A;  4H82 A;  4AYK A;  4J4M A;  1JK3 A;  4H49 A;  1BKC E;  3E8R A;  4JPA A;  4WZV A;  4PKR A;  3ZXH A;  4GF1 A;  1UEA A;  2CLT A;  1UTZ A;  3LIK A;  1YCM A;  5BOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...