1ZP5A

Crystal structure of the complex between mmp-8 and a n-hydroxyurea inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
163
Chain Sequence
MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Neutrophil collagenase
publication title N-Hydroxyurea as zinc binding group in matrix metalloproteinase inhibition: Mode of binding in a complex with MMP-8.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1zp5A00
2X3BA 3E8RA 1JJ9A 3NX7A 1B8YA 1BKCA 2Y6CA 3KEKA 1ATLA 5D1UA 2W0DA 1IADA 3KECA 4AUOA 3AYKA 2Y6DA 1BQOA 4PKUA 5LABA 1USNA 2AIGP 4L19A 4WF6A 4GR8A 3VI1A 1MNCA 1GE6A 3LEAA 3KRYA 4DV8A 4JIJA 1IABA 1QIAA 4PKTA 3P1VA 3K7LA 1JAPA 2TCLA 1JAQA 3EWJA 1IAAA 2OY2A 3HYGA 3LJTA 5D7WA 3LILA 4WK7A 5BPAA 2JIHA 1JIZA 4FU4A 2OXZA 1QICA 1BUDA 3OHOA 1XUCA 1SLMA 2E2DA 4L6TA 3I7IA 1RM8A 1G05A 1G49A 1CAQA 2EROA 3RTTA 1Y0VA 3WV3A 1BM6A 2MLSA 4GWNA 1GKDA 1CIZA 3ZUKA 4XCTA 4ON1A 2CKIA 1Y8JA 4IJOA 3BA0A 2OY4A 1D5JA 1CGLA 3USNA 1XUDA 1HFSA 3LQBA 4EFSA 3LIRA 3L0VA 5D3CA 4XM7A 2MZEA 3EDZA 1Q3AA 3WV1A 1I76A 3LGPA 4I35A 3HDBA 1OS2A 2OVZA 1KUGA 1KUKA 1ZP5A 1I73A 2XS3A 1G9KA 3F1AA 5I3MA 4I03A 1R55A 1MMPA 3I7GA 1K7GA 1KUIA 1YQYA 3AYUA 4A3WA 1IACA 5I4OA 5CUHA 1ZTQA 3KMEA 1MMBA 4IUWA 1K7QA 1AF0A 1FBLA 1UEAA 4J4MA 2WOAA 1O0TA 3V96B 2N8RA 1KUFA 1YOUA 4XM8A 5B5PA 1L6JA 1H71P 2Z2DA 3EDIA 2K9CA 1SMPA 3HY9A 4HX3A 1ASTA 2OW9A 4H30A 1BQQM 2DW1A 2YB9A 3O64A 1ROSA 4DPEA 1K7IA 2YIGA 1GXDA 4QKZA 4ZR5A 1CGFA 1C3IA 3TSKA 1J7NA 1JK3A 1XURA 3TT4A 1GE7A 1KAPP 3HDAP 3HBVP 1SU3A 4JP4A 1C7KA 4FXYP 1DTHA 4G9LA 1HTDA 1O0QA 1XFXA 2JT6A 2MZIA 2PJTA 4GUYA 1FM1A 1ZVXA 2WO9A 1OO9A 1QJIA 2RJPA 1HY7A 2QPJA 1SRPA 1GKCA 3ELMA 3LQ0A 1JKYA 2OI0A 1DMTA 5D1TA 4WZVA 1R54A 1R1HA 2JSDA 3P24A 1Y93A 1YP1A 1MMQA 4G0DA 1BZSA 1SATA 1UMTA 1XFWA 3G42A 1CQRA 5I2ZA 3MA2A 3N2UA 2X7MA 3LIKA 4A7BA 3AIGA 3DWBA 4DD8A 1PWPA 4WKEA 3CKIA 2HU6A 3LJGA 3KWVC 1OS9A 1AKLA 1JIWP 4GWMA 5D1SA 1IAEA 3WV2A 1JANA 4H2EA 1BUVM 3L0TA 2USNA 4GQLA 1MMRA 1ZXCA 4H49A 1CXVA 3HY7A 4HMAA 1UMSA 3O2XA 5I0LA 1UTTA 4WKIA 1G12A 3HBUP 5L7FA 5L79A 4AYKA 2X3CA 2X3AA 3F15A 2D1NA 1QIBA 2OXWA 1GO7P 3LUMA 4Q1LA 1OMJA 3LMCA 4H1QA 1S4BP 2I47A 3EDHA 1HFCA 3Q2HA 3B8ZA 2FV5A 3KEJA 3DSLA 2OW0A 1SLNA 3F17A 3LK8A 2O3EA 1JAOA 1XFYA 3F18A 2ERPA 2WO8A 4PKQA 3U1RA 3RTSA 2V4BA 3VTGA 1CGEA 1EAKA 3LE9A 3OHLA 1UTZA 2A8HA 2OXUA 3HB2P 1JH1A 2DW2A 1YCMA 4ILWD 4FVLA 1KBCA 2FV9A 1FLSA 2OW1A 1RMZA 4AXQA 2DDFA 4GR3A 4PKWA 1IAGA 3K7NA 1OM6A 2AYKA 3ZVSA 3G5CA 4H84A 4AIGA 1BKCE 1A85A 4JA1A 2ERQA 2SRTA 3TS4A 5H8XA 4CTHA 4GF1A 2JNPA 3GBOA 966CA 1BKCI 5D2BA 1OM7A 2OZRA 3KMCA 2D1OA 1R1JA 2MZHA 2MLRA 1C8TA 2CLTA 1Z3JA 2POJA 5I43A 4H82A 2J0TA 1PWUA 4DF9A 3LKAA 3LUNA 4JQGA 1OM8A 1GO8P 1BIWA 2W13A 4H3XA 1B3DA 5BOYA 1ND1A 5JMYA 3DNGA 3TVCA 1ZS0A 3KHIA 1A86A 2KRJA 1QUAA 4FXQA 1AYKA 2DW0A 2W14A 2L0RA 1GE5A 1EB6A 1XFVA 1KUHA 1ZXVA 1WNIA 1PWWA 5I12A 4PKRA 456CA 3DPEA 1D8FA 2K2GA 3N2VA 2RJQA 1D8MA 2E3XA 3EHYA 3F19A 5BOTA 3B2ZA 3Q2GA 4PKVA 4H76A 5B5OA 3LJZA 1XFUA 3EDGA 1PWQA 1I1IP 3UVCA 2OW2A 1R1IA 2XS4A 4JPAA 2W12A 1XFZA 2J83A 4XM6A 1PWVA 1G4KA 3DPFA 1BSWA 3EHXA 4IN9A 2W15A 1CK7A 3ZXHA 2DDYA 1HV5A 1QJJA 1HOVA 4PKSA 4R3VA 2JT5A 4GR0A 4L63A 1D7XA 5CZMA 5CXAA 3B92A 2OVXA 3DL1A 4XBHA 3SHIA 3F16A 830CA 2O36A 1EUBA
chains in the Genus database with same CATH superfamily
2X3BA 3E8RA 1JJ9A 3NX7A 1B8YA 1BKCA 2Y6CA 3KEKA 1ATLA 5D1UA 2W0DA 1IADA 3KECA 4AUOA 3AYKA 2Y6DA 1BQOA 4PKUA 3DTIA 5LABA 1USNA 2AIGP 4L19A 4WF6A 4GR8A 3VI1A 1MNCA 1GE6A 3LEAA 3KRYA 4DV8A 4JIJA 1IABA 1QIAA 4PKTA 3P1VA 3K7LA 1JAPA 2TCLA 1JAQA 3EWJA 1IAAA 2OY2A 3HYGA 3LJTA 5D7WA 3LILA 4WK7A 5BPAA 2JIHA 1JIZA 4FU4A 2OXZA 1QICA 1BUDA 3OHOA 1XUCA 1SLMA 2E2DA 4L6TA 3I7IA 1RM8A 1G05A 1G49A 1CAQA 2EROA 3RTTA 1Y0VA 3WV3A 1BM6A 2MLSA 4GWNA 1GKDA 1CIZA 3ZUKA 4XCTA 4ON1A 2CKIA 1Y8JA 4IJOA 3BA0A 2OY4A 1D5JA 1CGLA 3USNA 3DTKA 1XUDA 1HFSA 3LQBA 4EFSA 3LIRA 3L0VA 5D3CA 4XM7A 2MZEA 3EDZA 1Q3AA 3WV1A 1I76A 3LGPA 4I35A 3HDBA 1OS2A 2OVZA 1KUGA 1KUKA 1ZP5A 1I73A 2XS3A 1G9KA 3F1AA 5I3MA 4I03A 3DTEA 1R55A 1MMPA 3I7GA 1K7GA 1KUIA 1YQYA 3AYUA 4A3WA 1IACA 5I4OA 5CUHA 1ZTQA 3KMEA 1MMBA 4IUWA 1K7QA 1AF0A 1FBLA 1UEAA 4J4MA 2WOAA 1O0TA 3V96B 2N8RA 1KUFA 1YOUA 4XM8A 5B5PA 1L6JA 1H71P 2Z2DA 3EDIA 2K9CA 1SMPA 3HY9A 4HX3A 1ASTA 2OW9A 4H30A 1BQQM 2DW1A 2YB9A 3O64A 1ROSA 4DPEA 1K7IA 2YIGA 1GXDA 4QKZA 4ZR5A 1CGFA 1C3IA 3TSKA 1J7NA 1JK3A 1XURA 3TT4A 1GE7A 1KAPP 3HDAP 3HBVP 1SU3A 4JP4A 1C7KA 4FXYP 1DTHA 4G9LA 1HTDA 1O0QA 1XFXA 2JT6A 2MZIA 2PJTA 4GUYA 1FM1A 1ZVXA 2WO9A 1OO9A 1QJIA 2RJPA 1HY7A 2QPJA 1SRPA 1GKCA 3ELMA 3LQ0A 1JKYA 2OI0A 1DMTA 5D1TA 4WZVA 1R54A 1R1HA 2JSDA 3P24A 1Y93A 1YP1A 1MMQA 4G0DA 1BZSA 1SATA 1UMTA 1XFWA 3G42A 1CQRA 5I2ZA 3MA2A 3N2UA 2X7MA 3LIKA 4A7BA 3AIGA 3DWBA 4DD8A 1PWPA 4WKEA 3CKIA 2HU6A 3LJGA 3KWVC 1OS9A 1AKLA 1JIWP 4GWMA 5D1SA 1IAEA 3WV2A 1JANA 4H2EA 1BUVM 3L0TA 2USNA 4GQLA 1MMRA 1ZXCA 4H49A 1CXVA 3HY7A 4HMAA 1UMSA 3O2XA 5I0LA 1UTTA 4WKIA 1G12A 3HBUP 5L7FA 5L79A 4AYKA 2X3CA 2X3AA 3F15A 2D1NA 1QIBA 2OXWA 1GO7P 3LUMA 1XAXA 4Q1LA 1OMJA 3LMCA 4H1QA 1S4BP 2I47A 3EDHA 1HFCA 3Q2HA 3B8ZA 2FV5A 3KEJA 3DSLA 2OW0A 1SLNA 3F17A 3LK8A 2O3EA 1JAOA 1XFYA 3F18A 2ERPA 2WO8A 4PKQA 3U1RA 3RTSA 2V4BA 3VTGA 1CGEA 1EAKA 3LE9A 3OHLA 1UTZA 2A8HA 2OXUA 3HB2P 1JH1A 2DW2A 1YCMA 4ILWD 4FVLA 1KBCA 2FV9A 1FLSA 1TVIA 2OW1A 1RMZA 4AXQA 2DDFA 4GR3A 4PKWA 1IAGA 3K7NA 1OM6A 2AYKA 3ZVSA 3G5CA 4H84A 4AIGA 1BKCE 1A85A 4JA1A 2ERQA 2SRTA 3TS4A 5H8XA 4CTHA 4GF1A 2YUFA 2JNPA 3GBOA 966CA 1BKCI 5D2BA 1OM7A 2OZRA 3KMCA 2D1OA 1R1JA 2MZHA 2MLRA 1C8TA 2CLTA 1Z3JA 2POJA 5I43A 4H82A 2J0TA 1PWUA 4DF9A 1XM5A 3LKAA 3LUNA 4JQGA 1OM8A 1GO8P 1BIWA 4L7AA 2W13A 4H3XA 1B3DA 5BOYA 1ND1A 5JMYA 3DNGA 3TVCA 1ZS0A 3KHIA 1A86A 2KRJA 1QUAA 4FXQA 1AYKA 2DW0A 2W14A 2L0RA 1GE5A 1EB6A 1XFVA 1KUHA 1ZXVA 1WNIA 1PWWA 5I12A 4PKRA 456CA 3DPEA 1D8FA 2K2GA 3N2VA 2RJQA 1D8MA 2E3XA 3EHYA 3F19A 5BOTA 3B2ZA 3Q2GA 4PKVA 4H76A 5B5OA 3LJZA 1XFUA 3EDGA 1OZ9A 1PWQA 1I1IP 3UVCA 2OW2A 1R1IA 2XS4A 4JPAA 2W12A 1XFZA 2J83A 4XM6A 1PWVA 1G4KA 3DPFA 1BSWA 3EHXA 4IN9A 2W15A 1CK7A 3ZXHA 2DDYA 1HV5A 1QJJA 1HOVA 4PKSA 4R3VA 2JT5A 4GR0A 4L63A 1D7XA 5CZMA 5CXAA 3B92A 2OVXA 3DL1A 4XBHA 3SHIA 3F16A 830CA 2O36A 1EUBA
chains in the Genus database with same CATH topology
2X3BA 3E8RA 1JJ9A 3NX7A 1B8YA 1BKCA 2Y6CA 3KEKA 1ATLA 5D1UA 2W0DA 1IADA 3KECA 4AUOA 3AYKA 2Y6DA 1BQOA 4PKUA 3DTIA 5LABA 1USNA 2AIGP 4L19A 4WF6A 4GR8A 3VI1A 1MNCA 1GE6A 3LEAA 3KRYA 4DV8A 4JIJA 1IABA 1QIAA 4PKTA 3P1VA 3K7LA 1JAPA 2TCLA 1JAQA 3EWJA 1IAAA 2OY2A 3HYGA 3LJTA 5D7WA 3LILA 4WK7A 5BPAA 2JIHA 1JIZA 4FU4A 2OXZA 1QICA 1BUDA 3OHOA 1XUCA 1SLMA 2E2DA 4L6TA 3I7IA 1RM8A 1G05A 1G49A 1CAQA 2EROA 3RTTA 1Y0VA 3WV3A 1BM6A 2MLSA 4GWNA 1GKDA 1CIZA 3ZUKA 4XCTA 4ON1A 2CKIA 1Y8JA 4IJOA 3BA0A 2OY4A 1D5JA 1CGLA 3USNA 3DTKA 1XUDA 1HFSA 3LQBA 4EFSA 3LIRA 3L0VA 5D3CA 4XM7A 2MZEA 3EDZA 1Q3AA 3WV1A 1I76A 3LGPA 4I35A 3HDBA 1OS2A 2OVZA 1KUGA 1KUKA 1ZP5A 1I73A 2XS3A 1G9KA 3F1AA 5I3MA 4I03A 3DTEA 1R55A 1MMPA 3I7GA 1K7GA 1KUIA 1YQYA 3AYUA 4A3WA 1IACA 5I4OA 5CUHA 1ZTQA 3KMEA 1MMBA 4IUWA 1K7QA 1AF0A 1FBLA 1UEAA 4J4MA 2WOAA 1O0TA 3V96B 2N8RA 1KUFA 1YOUA 4XM8A 5B5PA 1L6JA 1H71P 2Z2DA 3EDIA 2K9CA 1SMPA 3HY9A 4HX3A 1ASTA 2OW9A 4H30A 1BQQM 2DW1A 2YB9A 3O64A 1ROSA 4DPEA 1K7IA 2YIGA 1GXDA 4QKZA 4ZR5A 1CGFA 1C3IA 3TSKA 1J7NA 1JK3A 1XURA 3TT4A 1GE7A 1KAPP 3HDAP 3HBVP 1SU3A 4JP4A 1C7KA 4FXYP 1DTHA 4G9LA 1HTDA 1O0QA 1XFXA 2JT6A 2MZIA 2PJTA 4GUYA 1FM1A 1ZVXA 2WO9A 1OO9A 1QJIA 2RJPA 1HY7A 2QPJA 1SRPA 1GKCA 3ELMA 3LQ0A 1JKYA 2OI0A 1DMTA 5D1TA 4WZVA 1R54A 1R1HA 2JSDA 3P24A 1Y93A 1YP1A 1MMQA 4G0DA 1BZSA 1SATA 1UMTA 1XFWA 3G42A 1CQRA 5I2ZA 3MA2A 3N2UA 2X7MA 3LIKA 4A7BA 3AIGA 3DWBA 4DD8A 1PWPA 4WKEA 3CKIA 2HU6A 3LJGA 3KWVC 1OS9A 1AKLA 1JIWP 4GWMA 5D1SA 1IAEA 3WV2A 1JANA 4H2EA 1BUVM 3L0TA 2USNA 4GQLA 1MMRA 1ZXCA 4H49A 1CXVA 3HY7A 4HMAA 1UMSA 3O2XA 5I0LA 1UTTA 4WKIA 1G12A 3HBUP 5L7FA 5L79A 4AYKA 2X3CA 2X3AA 3F15A 2D1NA 1QIBA 2OXWA 1GO7P 3LUMA 4Q1LA 1OMJA 3LMCA 4H1QA 1S4BP 2I47A 3EDHA 1HFCA 3Q2HA 3B8ZA 2FV5A 3KEJA 3DSLA 2OW0A 1SLNA 3F17A 3LK8A 2O3EA 1JAOA 1XFYA 3F18A 2ERPA 2WO8A 4PKQA 3U1RA 3RTSA 2V4BA 3VTGA 1CGEA 1EAKA 3LE9A 3OHLA 1UTZA 2A8HA 2OXUA 3HB2P 1JH1A 2DW2A 1YCMA 4ILWD 4FVLA 1KBCA 2FV9A 1FLSA 2OW1A 1RMZA 4AXQA 2DDFA 4GR3A 4PKWA 1IAGA 3K7NA 1OM6A 2AYKA 3ZVSA 3G5CA 4H84A 4AIGA 1BKCE 1A85A 4JA1A 2ERQA 2SRTA 3TS4A 5H8XA 4CTHA 4GF1A 2YUFA 2JNPA 3GBOA 966CA 1BKCI 5D2BA 1OM7A 2OZRA 3KMCA 2D1OA 1R1JA 2MZHA 2MLRA 1C8TA 2CLTA 1Z3JA 2POJA 5I43A 4H82A 2J0TA 1PWUA 4DF9A 3LKAA 3LUNA 4JQGA 1OM8A 1GO8P 1BIWA 4L7AA 2W13A 4H3XA 1B3DA 5BOYA 1ND1A 5JMYA 3DNGA 3TVCA 1ZS0A 3KHIA 1A86A 2KRJA 1QUAA 4FXQA 1AYKA 2DW0A 2W14A 2L0RA 1GE5A 1EB6A 1XFVA 1KUHA 1ZXVA 1WNIA 1PWWA 5I12A 4PKRA 456CA 3DPEA 1D8FA 2K2GA 3N2VA 2RJQA 1D8MA 2E3XA 3EHYA 3F19A 5BOTA 3B2ZA 3Q2GA 4PKVA 4H76A 5B5OA 3LJZA 1XFUA 3EDGA 1PWQA 1I1IP 3UVCA 2OW2A 1R1IA 2XS4A 4JPAA 2W12A 1XFZA 2J83A 4XM6A 1PWVA 1G4KA 3DPFA 1BSWA 3EHXA 4IN9A 2W15A 1CK7A 3ZXHA 2DDYA 1HV5A 1QJJA 1HOVA 4PKSA 4R3VA 2JT5A 4GR0A 4L63A 1D7XA 5CZMA 5CXAA 3B92A 2OVXA 3DL1A 4XBHA 3SHIA 3F16A 830CA 2O36A 1EUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3B A;  3E8R A;  1JJ9 A;  3NX7 A;  1B8Y A;  1BKC A;  2Y6C A;  3KEK A;  1ATL A;  5D1U A;  2W0D A;  1IAD A;  3KEC A;  4AUO A;  3AYK A;  2Y6D A;  1BQO A;  4PKU A;  5LAB A;  1USN A;  2AIG P;  4L19 A;  4WF6 A;  4GR8 A;  3VI1 A;  1MNC A;  1GE6 A;  3LEA A;  3KRY A;  4DV8 A;  4JIJ A;  1IAB A;  1QIA A;  4PKT A;  3P1V A;  3K7L A;  1JAP A;  2TCL A;  1JAQ A;  3EWJ A;  1IAA A;  2OY2 A;  3HYG A;  3LJT A;  5D7W A;  3LIL A;  4WK7 A;  5BPA A;  2JIH A;  1JIZ A;  4FU4 A;  2OXZ A;  1QIC A;  1BUD A;  3OHO A;  1XUC A;  1SLM A;  2E2D A;  4L6T A;  3I7I A;  1RM8 A;  1G05 A;  1G49 A;  1CAQ A;  2ERO A;  3RTT A;  1Y0V A;  3WV3 A;  1BM6 A;  2MLS A;  4GWN A;  1GKD A;  1CIZ A;  3ZUK A;  4XCT A;  4ON1 A;  2CKI A;  1Y8J A;  4IJO A;  3BA0 A;  2OY4 A;  1D5J A;  1CGL A;  3USN A;  1XUD A;  1HFS A;  3LQB A;  4EFS A;  3LIR A;  3L0V A;  5D3C A;  4XM7 A;  2MZE A;  3EDZ A;  1Q3A A;  3WV1 A;  1I76 A;  3LGP A;  4I35 A;  3HDB A;  1OS2 A;  2OVZ A;  1KUG A;  1KUK A;  1ZP5 A;  1I73 A;  2XS3 A;  1G9K A;  3F1A A;  5I3M A;  4I03 A;  1R55 A;  1MMP A;  3I7G A;  1K7G A;  1KUI A;  1YQY A;  3AYU A;  4A3W A;  1IAC A;  5I4O A;  5CUH A;  1ZTQ A;  3KME A;  1MMB A;  4IUW A;  1K7Q A;  1AF0 A;  1FBL A;  1UEA A;  4J4M A;  2WOA A;  1O0T A;  3V96 B;  2N8R A;  1KUF A;  1YOU A;  4XM8 A;  5B5P A;  1L6J A;  1H71 P;  2Z2D A;  3EDI A;  2K9C A;  1SMP A;  3HY9 A;  4HX3 A;  1AST A;  2OW9 A;  4H30 A;  1BQQ M;  2DW1 A;  2YB9 A;  3O64 A;  1ROS A;  4DPE A;  1K7I A;  2YIG A;  1GXD A;  4QKZ A;  4ZR5 A;  1CGF A;  1C3I A;  3TSK A;  1J7N A;  1JK3 A;  1XUR A;  3TT4 A;  1GE7 A;  1KAP P;  3HDA P;  3HBV P;  1SU3 A;  4JP4 A;  1C7K A;  4FXY P;  1DTH A;  4G9L A;  1HTD A;  1O0Q A;  1XFX A;  2JT6 A;  2MZI A;  2PJT A;  4GUY A;  1FM1 A;  1ZVX A;  2WO9 A;  1OO9 A;  1QJI A;  2RJP A;  1HY7 A;  2QPJ A;  1SRP A;  1GKC A;  3ELM A;  3LQ0 A;  1JKY A;  2OI0 A;  1DMT A;  5D1T A;  4WZV A;  1R54 A;  1R1H A;  2JSD A;  3P24 A;  1Y93 A;  1YP1 A;  1MMQ A;  4G0D A;  1BZS A;  1SAT A;  1UMT A;  1XFW A;  3G42 A;  1CQR A;  5I2Z A;  3MA2 A;  3N2U A;  2X7M A;  3LIK A;  4A7B A;  3AIG A;  3DWB A;  4DD8 A;  1PWP A;  4WKE A;  3CKI A;  2HU6 A;  3LJG A;  3KWV C;  1OS9 A;  1AKL A;  1JIW P;  4GWM A;  5D1S A;  1IAE A;  3WV2 A;  1JAN A;  4H2E A;  1BUV M;  3L0T A;  2USN A;  4GQL A;  1MMR A;  1ZXC A;  4H49 A;  1CXV A;  3HY7 A;  4HMA A;  1UMS A;  3O2X A;  5I0L A;  1UTT A;  4WKI A;  1G12 A;  3HBU P;  5L7F A;  5L79 A;  4AYK A;  2X3C A;  2X3A A;  3F15 A;  2D1N A;  1QIB A;  2OXW A;  1GO7 P;  3LUM A;  4Q1L A;  1OMJ A;  3LMC A;  4H1Q A;  1S4B P;  2I47 A;  3EDH A;  1HFC A;  3Q2H A;  3B8Z A;  2FV5 A;  3KEJ A;  3DSL A;  2OW0 A;  1SLN A;  3F17 A;  3LK8 A;  2O3E A;  1JAO A;  1XFY A;  3F18 A;  2ERP A;  2WO8 A;  4PKQ A;  3U1R A;  3RTS A;  2V4B A;  3VTG A;  1CGE A;  1EAK A;  3LE9 A;  3OHL A;  1UTZ A;  2A8H A;  2OXU A;  3HB2 P;  1JH1 A;  2DW2 A;  1YCM A;  4ILW D;  4FVL A;  1KBC A;  2FV9 A;  1FLS A;  2OW1 A;  1RMZ A;  4AXQ A;  2DDF A;  4GR3 A;  4PKW A;  1IAG A;  3K7N A;  1OM6 A;  2AYK A;  3ZVS A;  3G5C A;  4H84 A;  4AIG A;  1BKC E;  1A85 A;  4JA1 A;  2ERQ A;  2SRT A;  3TS4 A;  5H8X A;  4CTH A;  4GF1 A;  2JNP A;  3GBO A;  966C A;  1BKC I;  5D2B A;  1OM7 A;  2OZR A;  3KMC A;  2D1O A;  1R1J A;  2MZH A;  2MLR A;  1C8T A;  2CLT A;  1Z3J A;  2POJ A;  5I43 A;  4H82 A;  2J0T A;  1PWU A;  4DF9 A;  3LKA A;  3LUN A;  4JQG A;  1OM8 A;  1GO8 P;  1BIW A;  2W13 A;  4H3X A;  1B3D A;  5BOY A;  1ND1 A;  5JMY A;  3DNG A;  3TVC A;  1ZS0 A;  3KHI A;  1A86 A;  2KRJ A;  1QUA A;  4FXQ A;  1AYK A;  2DW0 A;  2W14 A;  2L0R A;  1GE5 A;  1EB6 A;  1XFV A;  1KUH A;  1ZXV A;  1WNI A;  1PWW A;  5I12 A;  4PKR A;  456C A;  3DPE A;  1D8F A;  2K2G A;  3N2V A;  2RJQ A;  1D8M A;  2E3X A;  3EHY A;  3F19 A;  5BOT A;  3B2Z A;  3Q2G A;  4PKV A;  4H76 A;  5B5O A;  3LJZ A;  1XFU A;  3EDG A;  1PWQ A;  1I1I P;  3UVC A;  2OW2 A;  1R1I A;  2XS4 A;  4JPA A;  2W12 A;  1XFZ A;  2J83 A;  4XM6 A;  1PWV A;  1G4K A;  3DPF A;  1BSW A;  3EHX A;  4IN9 A;  2W15 A;  1CK7 A;  3ZXH A;  2DDY A;  1HV5 A;  1QJJ A;  1HOV A;  4PKS A;  4R3V A;  2JT5 A;  4GR0 A;  4L63 A;  1D7X A;  5CZM A;  5CXA A;  3B92 A;  2OVX A;  3DL1 A;  4XBH A;  3SHI A;  3F16 A;  830C A;  2O36 A;  1EUB A; 
#chains in the Genus database with same CATH topology
 2X3B A;  3E8R A;  1JJ9 A;  3NX7 A;  1B8Y A;  1BKC A;  2Y6C A;  3KEK A;  1ATL A;  5D1U A;  2W0D A;  1IAD A;  3KEC A;  4AUO A;  3AYK A;  2Y6D A;  1BQO A;  4PKU A;  3DTI A;  5LAB A;  1USN A;  2AIG P;  4L19 A;  4WF6 A;  4GR8 A;  3VI1 A;  1MNC A;  1GE6 A;  3LEA A;  3KRY A;  4DV8 A;  4JIJ A;  1IAB A;  1QIA A;  4PKT A;  3P1V A;  3K7L A;  1JAP A;  2TCL A;  1JAQ A;  3EWJ A;  1IAA A;  2OY2 A;  3HYG A;  3LJT A;  5D7W A;  3LIL A;  4WK7 A;  5BPA A;  2JIH A;  1JIZ A;  4FU4 A;  2OXZ A;  1QIC A;  1BUD A;  3OHO A;  1XUC A;  1SLM A;  2E2D A;  4L6T A;  3I7I A;  1RM8 A;  1G05 A;  1G49 A;  1CAQ A;  2ERO A;  3RTT A;  1Y0V A;  3WV3 A;  1BM6 A;  2MLS A;  4GWN A;  1GKD A;  1CIZ A;  3ZUK A;  4XCT A;  4ON1 A;  2CKI A;  1Y8J A;  4IJO A;  3BA0 A;  2OY4 A;  1D5J A;  1CGL A;  3USN A;  3DTK A;  1XUD A;  1HFS A;  3LQB A;  4EFS A;  3LIR A;  3L0V A;  5D3C A;  4XM7 A;  2MZE A;  3EDZ A;  1Q3A A;  3WV1 A;  1I76 A;  3LGP A;  4I35 A;  3HDB A;  1OS2 A;  2OVZ A;  1KUG A;  1KUK A;  1ZP5 A;  1I73 A;  2XS3 A;  1G9K A;  3F1A A;  5I3M A;  4I03 A;  3DTE A;  1R55 A;  1MMP A;  3I7G A;  1K7G A;  1KUI A;  1YQY A;  3AYU A;  4A3W A;  1IAC A;  5I4O A;  5CUH A;  1ZTQ A;  3KME A;  1MMB A;  4IUW A;  1K7Q A;  1AF0 A;  1FBL A;  1UEA A;  4J4M A;  2WOA A;  1O0T A;  3V96 B;  2N8R A;  1KUF A;  1YOU A;  4XM8 A;  5B5P A;  1L6J A;  1H71 P;  2Z2D A;  3EDI A;  2K9C A;  1SMP A;  3HY9 A;  4HX3 A;  1AST A;  2OW9 A;  4H30 A;  1BQQ M;  2DW1 A;  2YB9 A;  3O64 A;  1ROS A;  4DPE A;  1K7I A;  2YIG A;  1GXD A;  4QKZ A;  4ZR5 A;  1CGF A;  1C3I A;  3TSK A;  1J7N A;  1JK3 A;  1XUR A;  3TT4 A;  1GE7 A;  1KAP P;  3HDA P;  3HBV P;  1SU3 A;  4JP4 A;  1C7K A;  4FXY P;  1DTH A;  4G9L A;  1HTD A;  1O0Q A;  1XFX A;  2JT6 A;  2MZI A;  2PJT A;  4GUY A;  1FM1 A;  1ZVX A;  2WO9 A;  1OO9 A;  1QJI A;  2RJP A;  1HY7 A;  2QPJ A;  1SRP A;  1GKC A;  3ELM A;  3LQ0 A;  1JKY A;  2OI0 A;  1DMT A;  5D1T A;  4WZV A;  1R54 A;  1R1H A;  2JSD A;  3P24 A;  1Y93 A;  1YP1 A;  1MMQ A;  4G0D A;  1BZS A;  1SAT A;  1UMT A;  1XFW A;  3G42 A;  1CQR A;  5I2Z A;  3MA2 A;  3N2U A;  2X7M A;  3LIK A;  4A7B A;  3AIG A;  3DWB A;  4DD8 A;  1PWP A;  4WKE A;  3CKI A;  2HU6 A;  3LJG A;  3KWV C;  1OS9 A;  1AKL A;  1JIW P;  4GWM A;  5D1S A;  1IAE A;  3WV2 A;  1JAN A;  4H2E A;  1BUV M;  3L0T A;  2USN A;  4GQL A;  1MMR A;  1ZXC A;  4H49 A;  1CXV A;  3HY7 A;  4HMA A;  1UMS A;  3O2X A;  5I0L A;  1UTT A;  4WKI A;  1G12 A;  3HBU P;  5L7F A;  5L79 A;  4AYK A;  2X3C A;  2X3A A;  3F15 A;  2D1N A;  1QIB A;  2OXW A;  1GO7 P;  3LUM A;  1XAX A;  4Q1L A;  1OMJ A;  3LMC A;  4H1Q A;  1S4B P;  2I47 A;  3EDH A;  1HFC A;  3Q2H A;  3B8Z A;  2FV5 A;  3KEJ A;  3DSL A;  2OW0 A;  1SLN A;  3F17 A;  3LK8 A;  2O3E A;  1JAO A;  1XFY A;  3F18 A;  2ERP A;  2WO8 A;  4PKQ A;  3U1R A;  3RTS A;  2V4B A;  3VTG A;  1CGE A;  1EAK A;  3LE9 A;  3OHL A;  1UTZ A;  2A8H A;  2OXU A;  3HB2 P;  1JH1 A;  2DW2 A;  1YCM A;  4ILW D;  4FVL A;  1KBC A;  2FV9 A;  1FLS A;  1TVI A;  2OW1 A;  1RMZ A;  4AXQ A;  2DDF A;  4GR3 A;  4PKW A;  1IAG A;  3K7N A;  1OM6 A;  2AYK A;  3ZVS A;  3G5C A;  4H84 A;  4AIG A;  1BKC E;  1A85 A;  4JA1 A;  2ERQ A;  2SRT A;  3TS4 A;  5H8X A;  4CTH A;  4GF1 A;  2YUF A;  2JNP A;  3GBO A;  966C A;  1BKC I;  5D2B A;  1OM7 A;  2OZR A;  3KMC A;  2D1O A;  1R1J A;  2MZH A;  2MLR A;  1C8T A;  2CLT A;  1Z3J A;  2POJ A;  5I43 A;  4H82 A;  2J0T A;  1PWU A;  4DF9 A;  1XM5 A;  3LKA A;  3LUN A;  4JQG A;  1OM8 A;  1GO8 P;  1BIW A;  4L7A A;  2W13 A;  4H3X A;  1B3D A;  5BOY A;  1ND1 A;  5JMY A;  3DNG A;  3TVC A;  1ZS0 A;  3KHI A;  1A86 A;  2KRJ A;  1QUA A;  4FXQ A;  1AYK A;  2DW0 A;  2W14 A;  2L0R A;  1GE5 A;  1EB6 A;  1XFV A;  1KUH A;  1ZXV A;  1WNI A;  1PWW A;  5I12 A;  4PKR A;  456C A;  3DPE A;  1D8F A;  2K2G A;  3N2V A;  2RJQ A;  1D8M A;  2E3X A;  3EHY A;  3F19 A;  5BOT A;  3B2Z A;  3Q2G A;  4PKV A;  4H76 A;  5B5O A;  3LJZ A;  1XFU A;  3EDG A;  1OZ9 A;  1PWQ A;  1I1I P;  3UVC A;  2OW2 A;  1R1I A;  2XS4 A;  4JPA A;  2W12 A;  1XFZ A;  2J83 A;  4XM6 A;  1PWV A;  1G4K A;  3DPF A;  1BSW A;  3EHX A;  4IN9 A;  2W15 A;  1CK7 A;  3ZXH A;  2DDY A;  1HV5 A;  1QJJ A;  1HOV A;  4PKS A;  4R3V A;  2JT5 A;  4GR0 A;  4L63 A;  1D7X A;  5CZM A;  5CXA A;  3B92 A;  2OVX A;  3DL1 A;  4XBH A;  3SHI A;  3F16 A;  830C A;  2O36 A;  1EUB A; 
#chains in the Genus database with same CATH homology
 2X3B A;  3E8R A;  1JJ9 A;  3NX7 A;  1B8Y A;  1BKC A;  2Y6C A;  3KEK A;  1ATL A;  5D1U A;  2W0D A;  1IAD A;  3KEC A;  4AUO A;  3AYK A;  2Y6D A;  1BQO A;  4PKU A;  3DTI A;  5LAB A;  1USN A;  2AIG P;  4L19 A;  4WF6 A;  4GR8 A;  3VI1 A;  1MNC A;  1GE6 A;  3LEA A;  3KRY A;  4DV8 A;  4JIJ A;  1IAB A;  1QIA A;  4PKT A;  3P1V A;  3K7L A;  1JAP A;  2TCL A;  1JAQ A;  3EWJ A;  1IAA A;  2OY2 A;  3HYG A;  3LJT A;  5D7W A;  3LIL A;  4WK7 A;  5BPA A;  2JIH A;  1JIZ A;  4FU4 A;  2OXZ A;  1QIC A;  1BUD A;  3OHO A;  1XUC A;  1SLM A;  2E2D A;  4L6T A;  3I7I A;  1RM8 A;  1G05 A;  1G49 A;  1CAQ A;  2ERO A;  3RTT A;  1Y0V A;  3WV3 A;  1BM6 A;  2MLS A;  4GWN A;  1GKD A;  1CIZ A;  3ZUK A;  4XCT A;  4ON1 A;  2CKI A;  1Y8J A;  4IJO A;  3BA0 A;  2OY4 A;  1D5J A;  1CGL A;  3USN A;  3DTK A;  1XUD A;  1HFS A;  3LQB A;  4EFS A;  3LIR A;  3L0V A;  5D3C A;  4XM7 A;  2MZE A;  3EDZ A;  1Q3A A;  3WV1 A;  1I76 A;  3LGP A;  4I35 A;  3HDB A;  1OS2 A;  2OVZ A;  1KUG A;  1KUK A;  1ZP5 A;  1I73 A;  2XS3 A;  1G9K A;  3F1A A;  5I3M A;  4I03 A;  3DTE A;  1R55 A;  1MMP A;  3I7G A;  1K7G A;  1KUI A;  1YQY A;  3AYU A;  4A3W A;  1IAC A;  5I4O A;  5CUH A;  1ZTQ A;  3KME A;  1MMB A;  4IUW A;  1K7Q A;  1AF0 A;  1FBL A;  1UEA A;  4J4M A;  2WOA A;  1O0T A;  3V96 B;  2N8R A;  1KUF A;  1YOU A;  4XM8 A;  5B5P A;  1L6J A;  1H71 P;  2Z2D A;  3EDI A;  2K9C A;  1SMP A;  3HY9 A;  4HX3 A;  1AST A;  2OW9 A;  4H30 A;  1BQQ M;  2DW1 A;  2YB9 A;  3O64 A;  1ROS A;  4DPE A;  1K7I A;  2YIG A;  1GXD A;  4QKZ A;  4ZR5 A;  1CGF A;  1C3I A;  3TSK A;  1J7N A;  1JK3 A;  1XUR A;  3TT4 A;  1GE7 A;  1KAP P;  3HDA P;  3HBV P;  1SU3 A;  4JP4 A;  1C7K A;  4FXY P;  1DTH A;  4G9L A;  1HTD A;  1O0Q A;  1XFX A;  2JT6 A;  2MZI A;  2PJT A;  4GUY A;  1FM1 A;  1ZVX A;  2WO9 A;  1OO9 A;  1QJI A;  2RJP A;  1HY7 A;  2QPJ A;  1SRP A;  1GKC A;  3ELM A;  3LQ0 A;  1JKY A;  2OI0 A;  1DMT A;  5D1T A;  4WZV A;  1R54 A;  1R1H A;  2JSD A;  3P24 A;  1Y93 A;  1YP1 A;  1MMQ A;  4G0D A;  1BZS A;  1SAT A;  1UMT A;  1XFW A;  3G42 A;  1CQR A;  5I2Z A;  3MA2 A;  3N2U A;  2X7M A;  3LIK A;  4A7B A;  3AIG A;  3DWB A;  4DD8 A;  1PWP A;  4WKE A;  3CKI A;  2HU6 A;  3LJG A;  3KWV C;  1OS9 A;  1AKL A;  1JIW P;  4GWM A;  5D1S A;  1IAE A;  3WV2 A;  1JAN A;  4H2E A;  1BUV M;  3L0T A;  2USN A;  4GQL A;  1MMR A;  1ZXC A;  4H49 A;  1CXV A;  3HY7 A;  4HMA A;  1UMS A;  3O2X A;  5I0L A;  1UTT A;  4WKI A;  1G12 A;  3HBU P;  5L7F A;  5L79 A;  4AYK A;  2X3C A;  2X3A A;  3F15 A;  2D1N A;  1QIB A;  2OXW A;  1GO7 P;  3LUM A;  4Q1L A;  1OMJ A;  3LMC A;  4H1Q A;  1S4B P;  2I47 A;  3EDH A;  1HFC A;  3Q2H A;  3B8Z A;  2FV5 A;  3KEJ A;  3DSL A;  2OW0 A;  1SLN A;  3F17 A;  3LK8 A;  2O3E A;  1JAO A;  1XFY A;  3F18 A;  2ERP A;  2WO8 A;  4PKQ A;  3U1R A;  3RTS A;  2V4B A;  3VTG A;  1CGE A;  1EAK A;  3LE9 A;  3OHL A;  1UTZ A;  2A8H A;  2OXU A;  3HB2 P;  1JH1 A;  2DW2 A;  1YCM A;  4ILW D;  4FVL A;  1KBC A;  2FV9 A;  1FLS A;  2OW1 A;  1RMZ A;  4AXQ A;  2DDF A;  4GR3 A;  4PKW A;  1IAG A;  3K7N A;  1OM6 A;  2AYK A;  3ZVS A;  3G5C A;  4H84 A;  4AIG A;  1BKC E;  1A85 A;  4JA1 A;  2ERQ A;  2SRT A;  3TS4 A;  5H8X A;  4CTH A;  4GF1 A;  2YUF A;  2JNP A;  3GBO A;  966C A;  1BKC I;  5D2B A;  1OM7 A;  2OZR A;  3KMC A;  2D1O A;  1R1J A;  2MZH A;  2MLR A;  1C8T A;  2CLT A;  1Z3J A;  2POJ A;  5I43 A;  4H82 A;  2J0T A;  1PWU A;  4DF9 A;  3LKA A;  3LUN A;  4JQG A;  1OM8 A;  1GO8 P;  1BIW A;  4L7A A;  2W13 A;  4H3X A;  1B3D A;  5BOY A;  1ND1 A;  5JMY A;  3DNG A;  3TVC A;  1ZS0 A;  3KHI A;  1A86 A;  2KRJ A;  1QUA A;  4FXQ A;  1AYK A;  2DW0 A;  2W14 A;  2L0R A;  1GE5 A;  1EB6 A;  1XFV A;  1KUH A;  1ZXV A;  1WNI A;  1PWW A;  5I12 A;  4PKR A;  456C A;  3DPE A;  1D8F A;  2K2G A;  3N2V A;  2RJQ A;  1D8M A;  2E3X A;  3EHY A;  3F19 A;  5BOT A;  3B2Z A;  3Q2G A;  4PKV A;  4H76 A;  5B5O A;  3LJZ A;  1XFU A;  3EDG A;  1PWQ A;  1I1I P;  3UVC A;  2OW2 A;  1R1I A;  2XS4 A;  4JPA A;  2W12 A;  1XFZ A;  2J83 A;  4XM6 A;  1PWV A;  1G4K A;  3DPF A;  1BSW A;  3EHX A;  4IN9 A;  2W15 A;  1CK7 A;  3ZXH A;  2DDY A;  1HV5 A;  1QJJ A;  1HOV A;  4PKS A;  4R3V A;  2JT5 A;  4GR0 A;  4L63 A;  1D7X A;  5CZM A;  5CXA A;  3B92 A;  2OVX A;  3DL1 A;  4XBH A;  3SHI A;  3F16 A;  830C A;  2O36 A;  1EUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...