3NX7A

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor n-hydroxy-2-(n-(2-hydroxyethyl)4-methoxyphenylsulfonamido)acetamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Exploring the subtleties of drug-receptor interactions: the case of matrix metalloproteinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3nx7A00
2N8RA 3ELMA 1JAPA 2WOAA 1GO7P 2OW9A 2YB9A 1Y8JA 4H49A 2KRJA 3F17A 1RM8A 1OS9A 456CA 2O36A 2FV9A 1JK3A 1CGLA 1G12A 2SRTA 3U1RA 2W12A 5I3MA 3LIKA 1JIWP 3F16A 1D8FA 2K9CA 1D5JA 1IABA 1EAKA 4GF1A 2RJQA 4PKRA 4H1QA 3LILA 5L79A 4JA1A 2OXWA 2V4BA 1ZVXA 1HV5A 1K7IA 2I47A 1I73A 5L7FA 1SU3A 3RTSA 2JSDA 3AYUA 4WKEA 1USNA 3EWJA 4IUWA 3F19A 1XUDA 1ZXVA 2MLSA 2MZEA 2MZIA 1FLSA 4JPAA 1O0QA 2DW0A 3AIGA 3USNA 4XCTA 5CUHA 1I1IP 4ILWD 1BUDA 3ZUKA 3ZXHA 1XFVA 5I12A 2CLTA 3MA2A 1HTDA 2E2DA 4GR3A 4I35A 5CZMA 1Y93A 1L6JA 3RTTA 3HB2P 2WO8A 1AF0A 1G49A 3Q2GA 2W15A 4DD8A 3WV1A 1YOUA 4XBHA 2OXUA 2OVZA 1Y0VA 1BKCE 1QUAA 3O2XA 4H3XA 3K7LA 4JQGA 4AIGA 2OW1A 3HYGA 4EFSA 5CXAA 1BQQM 4J4MA 2Z2DA 3LUNA 2DDYA 2WO9A 2HU6A 4XM8A 1YP1A 1XURA 4XM6A 4H76A 1I76A 3BA0A 3HDAP 3B8ZA 1KBCA 1UTZA 1WNIA 1J7NA 1XFYA 1DMTA 3WV3A 3I7GA 2POJA 4XM7A 1QJJA 4FXQA 1OO9A 1JKYA 1UEAA 2OXZA 2Y6CA 1CGFA 3LK8A 4HMAA 5LABA 1Z3JA 1GKCA 3TT4A 4PKUA 1K7GA 3B92A 1R1JA 1OS2A 2AYKA 3CKIA 966CA 1G9KA 2OZRA 3DWBA 1ATLA 1QJIA 4DV8A 1JIZA 1C7KA 1MMQA 3TSKA 3ZVSA 3AYKA 2XS4A 1AYKA 1RMZA 1R1IA 5D7WA 1SLNA 1SATA 4AXQA 1R1HA 1OM7A 4JIJA 4HX3A 1FBLA 4ZR5A 2EROA 4GWNA 3KRYA 4DF9A 3SHIA 1G4KA 1KAPP 4H2EA 1XFZA 4PKSA 1QICA 1QIBA 3N2VA 1MMBA 1BSWA 4R3VA 1XUCA 2OY4A 4CTHA 2Y6DA 3HBVP 2FV5A 1K7QA 3WV2A 3OHLA 1CAQA 5BOYA 3G5CA 1O0TA 2XS3A 1OMJA 1UMSA 4WZVA 2OY2A 5JMYA 1BM6A 5I2ZA 2DW2A 3EHYA 1KUIA 1ND1A 1D8MA 3TVCA 2X3AA 3VI1A 4G9LA 1R55A 3KEKA 2ERPA 4AUOA 3P1VA 5B5OA 2J83A 4L6TA 1MMPA 4PKVA 1CIZA 1PWQA 4PKWA 1ZTQA 3LIRA 1FM1A 1DTHA 3UVCA 5D2BA 3E8RA 3EDHA 4IJOA 1OM6A 2JIHA 4QKZA 2W13A 1SMPA 1S4BP 5H8XA 1HFCA 1A86A 4JP4A 1OM8A 2RJPA 5BPAA 5I43A 1B8YA 3DNGA 2JNPA 1ZP5A 1HFSA 1JANA 4WK7A 1GE6A 1MNCA 3KWVC 1BIWA 3OHOA 3LQ0A 1AKLA 4GWMA 2L0RA 5D3CA 3P24A 2X3BA 1UMTA 3DPFA 3LEAA 1IACA 1KUHA 1CK7A 2OI0A 1CQRA 3EDGA 4GQLA 3G42A 2W14A 1SLMA 4IN9A 1XFWA 1CXVA 1ZS0A 3LJZA 2TCLA 3V96B 4G0DA 1GO8P 1C8TA 1EB6A 1H71P 1B3DA 1GE5A 3F15A 3KMEA 4H84A 4L19A 1JAQA 4PKQA 3EHXA 2OW2A 3KMCA 3LUMA 4H30A 4I03A 2D1OA 2D1NA 1R54A 3HDBA 3VTGA 1EUBA 1BUVM 4ON1A 1PWPA 1KUKA 4FU4A 3GBOA 2DW1A 1XFUA 3LKAA 2MZHA 5B5PA 1HY7A 1IAGA 2PJTA 2CKIA 4PKTA 3HY9A 1IAAA 1PWVA 4DPEA 3L0TA 1A85A 1C3IA 1ASTA 3LGPA 1UTTA 2O3EA 1JH1A 3TS4A 3NX7A 5D1UA 1GE7A 3LJTA 4GR8A 3HY7A 3F18A 3KEJA 3I7IA 4A7BA 1HOVA 2QPJA 2USNA 3LQBA 3LE9A 4GR0A 2A8HA 3L0VA 4GUYA 1Q3AA 3LMCA 4Q1LA 2JT6A 1XFXA 3LJGA 1MMRA 2W0DA 3DPEA 2DDFA 4FXYP 1IADA 4AYKA 5D1TA 1GXDA 1JJ9A 1KUGA 1JAOA 2K2GA 1BQOA 2X7MA 1G05A 1QIAA 3N2UA 1D7XA 2MLRA 1SRPA 2YIGA 2ERQA 4FVLA 1YCMA 3DL1A 3KHIA 2JT5A 3HBUP 4L63A 3B2ZA 3O64A 4WF6A 1PWUA 3K7NA 830CA 1ZXCA 1BKCI 1YQYA 2OW0A 5BOTA 4H82A 3KECA 2OVXA 3EDZA 1IAEA 2X3CA 2J0TA 3EDIA 1GKDA 5D1SA 5I4OA 1ROSA 3F1AA 2E3XA 4WKIA 1PWWA 3Q2HA 2AIGP 1KUFA 5I0LA 4A3WA 1BKCA 1CGEA 1BZSA 3DSLA
chains in the Genus database with same CATH superfamily
2N8RA 3ELMA 1JAPA 2WOAA 1GO7P 2OW9A 2YB9A 1Y8JA 4H49A 2KRJA 3F17A 1RM8A 1OS9A 456CA 2O36A 2FV9A 1JK3A 1CGLA 1G12A 2SRTA 3U1RA 2W12A 5I3MA 3LIKA 1JIWP 3F16A 1D8FA 2K9CA 1D5JA 1IABA 1EAKA 4GF1A 2RJQA 4PKRA 4H1QA 3LILA 5L79A 4JA1A 2OXWA 2V4BA 1ZVXA 1HV5A 1K7IA 2I47A 1I73A 5L7FA 1SU3A 3RTSA 2JSDA 3AYUA 4WKEA 1USNA 3EWJA 4IUWA 3F19A 1XUDA 1ZXVA 2MLSA 2MZEA 2MZIA 1FLSA 4JPAA 1O0QA 2DW0A 3AIGA 3USNA 4XCTA 5CUHA 1I1IP 2YUFA 4ILWD 1BUDA 3ZUKA 3ZXHA 1XFVA 5I12A 2CLTA 3MA2A 1HTDA 2E2DA 4GR3A 4I35A 5CZMA 1Y93A 1L6JA 3RTTA 1XM5A 3HB2P 2WO8A 1AF0A 1G49A 3Q2GA 2W15A 4DD8A 3WV1A 1YOUA 4XBHA 4L7AA 2OXUA 2OVZA 1Y0VA 1BKCE 1QUAA 3O2XA 4H3XA 3K7LA 4JQGA 4AIGA 2OW1A 3HYGA 4EFSA 5CXAA 1BQQM 4J4MA 2Z2DA 3LUNA 2DDYA 2WO9A 2HU6A 4XM8A 1YP1A 1XURA 4XM6A 4H76A 1I76A 3BA0A 3HDAP 3B8ZA 1KBCA 1UTZA 1WNIA 1J7NA 1XFYA 1DMTA 3WV3A 3I7GA 2POJA 4XM7A 1QJJA 4FXQA 1OO9A 1JKYA 1UEAA 2OXZA 2Y6CA 1CGFA 3LK8A 4HMAA 5LABA 1Z3JA 1GKCA 3TT4A 4PKUA 1K7GA 3B92A 1R1JA 1OS2A 2AYKA 3CKIA 966CA 1XAXA 1G9KA 2OZRA 3DWBA 1ATLA 1QJIA 4DV8A 1JIZA 1C7KA 1MMQA 3TSKA 3ZVSA 3AYKA 2XS4A 1AYKA 1RMZA 1R1IA 5D7WA 1SLNA 1SATA 4AXQA 1R1HA 1OM7A 4JIJA 4HX3A 1FBLA 4ZR5A 2EROA 4GWNA 3KRYA 4DF9A 3SHIA 1G4KA 1KAPP 4H2EA 1XFZA 4PKSA 3DTIA 1QICA 1QIBA 3N2VA 1MMBA 1BSWA 4R3VA 1XUCA 2OY4A 4CTHA 2Y6DA 3HBVP 2FV5A 1K7QA 3WV2A 3OHLA 1CAQA 5BOYA 3G5CA 1O0TA 2XS3A 1OMJA 1UMSA 4WZVA 2OY2A 5JMYA 1BM6A 5I2ZA 2DW2A 3EHYA 1KUIA 1ND1A 1D8MA 3TVCA 2X3AA 3VI1A 4G9LA 1R55A 3KEKA 2ERPA 4AUOA 3P1VA 5B5OA 2J83A 3DTEA 4L6TA 1MMPA 4PKVA 1CIZA 1PWQA 4PKWA 1ZTQA 3LIRA 1FM1A 1DTHA 3UVCA 5D2BA 3E8RA 3EDHA 4IJOA 1OM6A 2JIHA 4QKZA 2W13A 1SMPA 1S4BP 5H8XA 1HFCA 1A86A 4JP4A 1OM8A 2RJPA 5BPAA 5I43A 1B8YA 3DNGA 2JNPA 1ZP5A 1HFSA 1JANA 4WK7A 1GE6A 1MNCA 3KWVC 1BIWA 3OHOA 3LQ0A 1AKLA 4GWMA 2L0RA 5D3CA 3P24A 2X3BA 1UMTA 3DPFA 3LEAA 1IACA 1KUHA 1CK7A 2OI0A 1CQRA 3EDGA 4GQLA 3G42A 2W14A 1SLMA 4IN9A 1XFWA 1CXVA 1ZS0A 3LJZA 2TCLA 3V96B 4G0DA 1GO8P 1C8TA 1EB6A 1H71P 1B3DA 1GE5A 3F15A 3KMEA 4H84A 4L19A 3DTKA 1JAQA 4PKQA 3EHXA 2OW2A 3KMCA 3LUMA 4H30A 4I03A 2D1OA 2D1NA 1R54A 3HDBA 3VTGA 1EUBA 1TVIA 1BUVM 4ON1A 1PWPA 1KUKA 4FU4A 3GBOA 2DW1A 1XFUA 3LKAA 2MZHA 5B5PA 1HY7A 1IAGA 2PJTA 2CKIA 4PKTA 3HY9A 1IAAA 1PWVA 4DPEA 3L0TA 1A85A 1C3IA 1ASTA 3LGPA 1UTTA 2O3EA 1JH1A 3TS4A 3NX7A 5D1UA 1GE7A 3LJTA 4GR8A 3HY7A 3F18A 3KEJA 3I7IA 4A7BA 1HOVA 2QPJA 2USNA 3LQBA 3LE9A 4GR0A 2A8HA 3L0VA 4GUYA 1Q3AA 3LMCA 4Q1LA 2JT6A 1XFXA 3LJGA 1MMRA 2W0DA 3DPEA 2DDFA 4FXYP 1IADA 4AYKA 5D1TA 1GXDA 1JJ9A 1KUGA 1JAOA 2K2GA 1BQOA 2X7MA 1G05A 1QIAA 3N2UA 1D7XA 2MLRA 1SRPA 2YIGA 2ERQA 4FVLA 1YCMA 3DL1A 3KHIA 2JT5A 3HBUP 4L63A 3B2ZA 3O64A 4WF6A 1PWUA 3K7NA 830CA 1ZXCA 1BKCI 1YQYA 2OW0A 5BOTA 4H82A 3KECA 1OZ9A 2OVXA 3EDZA 1IAEA 2X3CA 2J0TA 3EDIA 1GKDA 5D1SA 5I4OA 1ROSA 3F1AA 2E3XA 4WKIA 1PWWA 3Q2HA 2AIGP 1KUFA 5I0LA 4A3WA 1BKCA 1CGEA 1BZSA 3DSLA
chains in the Genus database with same CATH topology
2N8RA 3ELMA 1JAPA 2WOAA 1GO7P 2OW9A 2YB9A 1Y8JA 4H49A 2KRJA 3F17A 1RM8A 1OS9A 456CA 2O36A 2FV9A 1JK3A 1CGLA 1G12A 2SRTA 3U1RA 2W12A 5I3MA 3LIKA 1JIWP 3F16A 1D8FA 2K9CA 1D5JA 1IABA 1EAKA 4GF1A 2RJQA 4PKRA 4H1QA 3LILA 5L79A 4JA1A 2OXWA 2V4BA 1ZVXA 1HV5A 1K7IA 2I47A 1I73A 5L7FA 1SU3A 3RTSA 2JSDA 3AYUA 4WKEA 1USNA 3EWJA 4IUWA 3F19A 1XUDA 1ZXVA 2MLSA 2MZEA 2MZIA 1FLSA 4JPAA 1O0QA 2DW0A 3AIGA 3USNA 4XCTA 5CUHA 1I1IP 2YUFA 4ILWD 1BUDA 3ZUKA 3ZXHA 1XFVA 5I12A 2CLTA 3MA2A 1HTDA 2E2DA 4GR3A 4I35A 5CZMA 1Y93A 1L6JA 3RTTA 3HB2P 2WO8A 1AF0A 1G49A 3Q2GA 2W15A 4DD8A 3WV1A 1YOUA 4XBHA 4L7AA 2OXUA 2OVZA 1Y0VA 1BKCE 1QUAA 3O2XA 4H3XA 3K7LA 4JQGA 4AIGA 2OW1A 3HYGA 4EFSA 5CXAA 1BQQM 4J4MA 2Z2DA 3LUNA 2DDYA 2WO9A 2HU6A 4XM8A 1YP1A 1XURA 4XM6A 4H76A 1I76A 3BA0A 3HDAP 3B8ZA 1KBCA 1UTZA 1WNIA 1J7NA 1XFYA 1DMTA 3WV3A 3I7GA 2POJA 4XM7A 1QJJA 4FXQA 1OO9A 1JKYA 1UEAA 2OXZA 2Y6CA 1CGFA 3LK8A 4HMAA 5LABA 1Z3JA 1GKCA 3TT4A 4PKUA 1K7GA 3B92A 1R1JA 1OS2A 2AYKA 3CKIA 966CA 1G9KA 2OZRA 3DWBA 1ATLA 1QJIA 4DV8A 1JIZA 1C7KA 1MMQA 3TSKA 3ZVSA 3AYKA 2XS4A 1AYKA 1RMZA 1R1IA 5D7WA 1SLNA 1SATA 4AXQA 1R1HA 1OM7A 4JIJA 4HX3A 1FBLA 4ZR5A 2EROA 4GWNA 3KRYA 4DF9A 3SHIA 1G4KA 1KAPP 4H2EA 1XFZA 4PKSA 3DTIA 1QICA 1QIBA 3N2VA 1MMBA 1BSWA 4R3VA 1XUCA 2OY4A 4CTHA 2Y6DA 3HBVP 2FV5A 1K7QA 3WV2A 3OHLA 1CAQA 5BOYA 3G5CA 1O0TA 2XS3A 1OMJA 1UMSA 4WZVA 2OY2A 5JMYA 1BM6A 5I2ZA 2DW2A 3EHYA 1KUIA 1ND1A 1D8MA 3TVCA 2X3AA 3VI1A 4G9LA 1R55A 3KEKA 2ERPA 4AUOA 3P1VA 5B5OA 2J83A 3DTEA 4L6TA 1MMPA 4PKVA 1CIZA 1PWQA 4PKWA 1ZTQA 3LIRA 1FM1A 1DTHA 3UVCA 5D2BA 3E8RA 3EDHA 4IJOA 1OM6A 2JIHA 4QKZA 2W13A 1SMPA 1S4BP 5H8XA 1HFCA 1A86A 4JP4A 1OM8A 2RJPA 5BPAA 5I43A 1B8YA 3DNGA 2JNPA 1ZP5A 1HFSA 1JANA 4WK7A 1GE6A 1MNCA 3KWVC 1BIWA 3OHOA 3LQ0A 1AKLA 4GWMA 2L0RA 5D3CA 3P24A 2X3BA 1UMTA 3DPFA 3LEAA 1IACA 1KUHA 1CK7A 2OI0A 1CQRA 3EDGA 4GQLA 3G42A 2W14A 1SLMA 4IN9A 1XFWA 1CXVA 1ZS0A 3LJZA 2TCLA 3V96B 4G0DA 1GO8P 1C8TA 1EB6A 1H71P 1B3DA 1GE5A 3F15A 3KMEA 4H84A 4L19A 3DTKA 1JAQA 4PKQA 3EHXA 2OW2A 3KMCA 3LUMA 4H30A 4I03A 2D1OA 2D1NA 1R54A 3HDBA 3VTGA 1EUBA 1BUVM 4ON1A 1PWPA 1KUKA 4FU4A 3GBOA 2DW1A 1XFUA 3LKAA 2MZHA 5B5PA 1HY7A 1IAGA 2PJTA 2CKIA 4PKTA 3HY9A 1IAAA 1PWVA 4DPEA 3L0TA 1A85A 1C3IA 1ASTA 3LGPA 1UTTA 2O3EA 1JH1A 3TS4A 3NX7A 5D1UA 1GE7A 3LJTA 4GR8A 3HY7A 3F18A 3KEJA 3I7IA 4A7BA 1HOVA 2QPJA 2USNA 3LQBA 3LE9A 4GR0A 2A8HA 3L0VA 4GUYA 1Q3AA 3LMCA 4Q1LA 2JT6A 1XFXA 3LJGA 1MMRA 2W0DA 3DPEA 2DDFA 4FXYP 1IADA 4AYKA 5D1TA 1GXDA 1JJ9A 1KUGA 1JAOA 2K2GA 1BQOA 2X7MA 1G05A 1QIAA 3N2UA 1D7XA 2MLRA 1SRPA 2YIGA 2ERQA 4FVLA 1YCMA 3DL1A 3KHIA 2JT5A 3HBUP 4L63A 3B2ZA 3O64A 4WF6A 1PWUA 3K7NA 830CA 1ZXCA 1BKCI 1YQYA 2OW0A 5BOTA 4H82A 3KECA 2OVXA 3EDZA 1IAEA 2X3CA 2J0TA 3EDIA 1GKDA 5D1SA 5I4OA 1ROSA 3F1AA 2E3XA 4WKIA 1PWWA 3Q2HA 2AIGP 1KUFA 5I0LA 4A3WA 1BKCA 1CGEA 1BZSA 3DSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N8R A;  3ELM A;  1JAP A;  2WOA A;  1GO7 P;  2OW9 A;  2YB9 A;  1Y8J A;  4H49 A;  2KRJ A;  3F17 A;  1RM8 A;  1OS9 A;  456C A;  2O36 A;  2FV9 A;  1JK3 A;  1CGL A;  1G12 A;  2SRT A;  3U1R A;  2W12 A;  5I3M A;  3LIK A;  1JIW P;  3F16 A;  1D8F A;  2K9C A;  1D5J A;  1IAB A;  1EAK A;  4GF1 A;  2RJQ A;  4PKR A;  4H1Q A;  3LIL A;  5L79 A;  4JA1 A;  2OXW A;  2V4B A;  1ZVX A;  1HV5 A;  1K7I A;  2I47 A;  1I73 A;  5L7F A;  1SU3 A;  3RTS A;  2JSD A;  3AYU A;  4WKE A;  1USN A;  3EWJ A;  4IUW A;  3F19 A;  1XUD A;  1ZXV A;  2MLS A;  2MZE A;  2MZI A;  1FLS A;  4JPA A;  1O0Q A;  2DW0 A;  3AIG A;  3USN A;  4XCT A;  5CUH A;  1I1I P;  4ILW D;  1BUD A;  3ZUK A;  3ZXH A;  1XFV A;  5I12 A;  2CLT A;  3MA2 A;  1HTD A;  2E2D A;  4GR3 A;  4I35 A;  5CZM A;  1Y93 A;  1L6J A;  3RTT A;  3HB2 P;  2WO8 A;  1AF0 A;  1G49 A;  3Q2G A;  2W15 A;  4DD8 A;  3WV1 A;  1YOU A;  4XBH A;  2OXU A;  2OVZ A;  1Y0V A;  1BKC E;  1QUA A;  3O2X A;  4H3X A;  3K7L A;  4JQG A;  4AIG A;  2OW1 A;  3HYG A;  4EFS A;  5CXA A;  1BQQ M;  4J4M A;  2Z2D A;  3LUN A;  2DDY A;  2WO9 A;  2HU6 A;  4XM8 A;  1YP1 A;  1XUR A;  4XM6 A;  4H76 A;  1I76 A;  3BA0 A;  3HDA P;  3B8Z A;  1KBC A;  1UTZ A;  1WNI A;  1J7N A;  1XFY A;  1DMT A;  3WV3 A;  3I7G A;  2POJ A;  4XM7 A;  1QJJ A;  4FXQ A;  1OO9 A;  1JKY A;  1UEA A;  2OXZ A;  2Y6C A;  1CGF A;  3LK8 A;  4HMA A;  5LAB A;  1Z3J A;  1GKC A;  3TT4 A;  4PKU A;  1K7G A;  3B92 A;  1R1J A;  1OS2 A;  2AYK A;  3CKI A;  966C A;  1G9K A;  2OZR A;  3DWB A;  1ATL A;  1QJI A;  4DV8 A;  1JIZ A;  1C7K A;  1MMQ A;  3TSK A;  3ZVS A;  3AYK A;  2XS4 A;  1AYK A;  1RMZ A;  1R1I A;  5D7W A;  1SLN A;  1SAT A;  4AXQ A;  1R1H A;  1OM7 A;  4JIJ A;  4HX3 A;  1FBL A;  4ZR5 A;  2ERO A;  4GWN A;  3KRY A;  4DF9 A;  3SHI A;  1G4K A;  1KAP P;  4H2E A;  1XFZ A;  4PKS A;  1QIC A;  1QIB A;  3N2V A;  1MMB A;  1BSW A;  4R3V A;  1XUC A;  2OY4 A;  4CTH A;  2Y6D A;  3HBV P;  2FV5 A;  1K7Q A;  3WV2 A;  3OHL A;  1CAQ A;  5BOY A;  3G5C A;  1O0T A;  2XS3 A;  1OMJ A;  1UMS A;  4WZV A;  2OY2 A;  5JMY A;  1BM6 A;  5I2Z A;  2DW2 A;  3EHY A;  1KUI A;  1ND1 A;  1D8M A;  3TVC A;  2X3A A;  3VI1 A;  4G9L A;  1R55 A;  3KEK A;  2ERP A;  4AUO A;  3P1V A;  5B5O A;  2J83 A;  4L6T A;  1MMP A;  4PKV A;  1CIZ A;  1PWQ A;  4PKW A;  1ZTQ A;  3LIR A;  1FM1 A;  1DTH A;  3UVC A;  5D2B A;  3E8R A;  3EDH A;  4IJO A;  1OM6 A;  2JIH A;  4QKZ A;  2W13 A;  1SMP A;  1S4B P;  5H8X A;  1HFC A;  1A86 A;  4JP4 A;  1OM8 A;  2RJP A;  5BPA A;  5I43 A;  1B8Y A;  3DNG A;  2JNP A;  1ZP5 A;  1HFS A;  1JAN A;  4WK7 A;  1GE6 A;  1MNC A;  3KWV C;  1BIW A;  3OHO A;  3LQ0 A;  1AKL A;  4GWM A;  2L0R A;  5D3C A;  3P24 A;  2X3B A;  1UMT A;  3DPF A;  3LEA A;  1IAC A;  1KUH A;  1CK7 A;  2OI0 A;  1CQR A;  3EDG A;  4GQL A;  3G42 A;  2W14 A;  1SLM A;  4IN9 A;  1XFW A;  1CXV A;  1ZS0 A;  3LJZ A;  2TCL A;  3V96 B;  4G0D A;  1GO8 P;  1C8T A;  1EB6 A;  1H71 P;  1B3D A;  1GE5 A;  3F15 A;  3KME A;  4H84 A;  4L19 A;  1JAQ A;  4PKQ A;  3EHX A;  2OW2 A;  3KMC A;  3LUM A;  4H30 A;  4I03 A;  2D1O A;  2D1N A;  1R54 A;  3HDB A;  3VTG A;  1EUB A;  1BUV M;  4ON1 A;  1PWP A;  1KUK A;  4FU4 A;  3GBO A;  2DW1 A;  1XFU A;  3LKA A;  2MZH A;  5B5P A;  1HY7 A;  1IAG A;  2PJT A;  2CKI A;  4PKT A;  3HY9 A;  1IAA A;  1PWV A;  4DPE A;  3L0T A;  1A85 A;  1C3I A;  1AST A;  3LGP A;  1UTT A;  2O3E A;  1JH1 A;  3TS4 A;  3NX7 A;  5D1U A;  1GE7 A;  3LJT A;  4GR8 A;  3HY7 A;  3F18 A;  3KEJ A;  3I7I A;  4A7B A;  1HOV A;  2QPJ A;  2USN A;  3LQB A;  3LE9 A;  4GR0 A;  2A8H A;  3L0V A;  4GUY A;  1Q3A A;  3LMC A;  4Q1L A;  2JT6 A;  1XFX A;  3LJG A;  1MMR A;  2W0D A;  3DPE A;  2DDF A;  4FXY P;  1IAD A;  4AYK A;  5D1T A;  1GXD A;  1JJ9 A;  1KUG A;  1JAO A;  2K2G A;  1BQO A;  2X7M A;  1G05 A;  1QIA A;  3N2U A;  1D7X A;  2MLR A;  1SRP A;  2YIG A;  2ERQ A;  4FVL A;  1YCM A;  3DL1 A;  3KHI A;  2JT5 A;  3HBU P;  4L63 A;  3B2Z A;  3O64 A;  4WF6 A;  1PWU A;  3K7N A;  830C A;  1ZXC A;  1BKC I;  1YQY A;  2OW0 A;  5BOT A;  4H82 A;  3KEC A;  2OVX A;  3EDZ A;  1IAE A;  2X3C A;  2J0T A;  3EDI A;  1GKD A;  5D1S A;  5I4O A;  1ROS A;  3F1A A;  2E3X A;  4WKI A;  1PWW A;  3Q2H A;  2AIG P;  1KUF A;  5I0L A;  4A3W A;  1BKC A;  1CGE A;  1BZS A;  3DSL A; 
#chains in the Genus database with same CATH topology
 2N8R A;  3ELM A;  1JAP A;  2WOA A;  1GO7 P;  2OW9 A;  2YB9 A;  1Y8J A;  4H49 A;  2KRJ A;  3F17 A;  1RM8 A;  1OS9 A;  456C A;  2O36 A;  2FV9 A;  1JK3 A;  1CGL A;  1G12 A;  2SRT A;  3U1R A;  2W12 A;  5I3M A;  3LIK A;  1JIW P;  3F16 A;  1D8F A;  2K9C A;  1D5J A;  1IAB A;  1EAK A;  4GF1 A;  2RJQ A;  4PKR A;  4H1Q A;  3LIL A;  5L79 A;  4JA1 A;  2OXW A;  2V4B A;  1ZVX A;  1HV5 A;  1K7I A;  2I47 A;  1I73 A;  5L7F A;  1SU3 A;  3RTS A;  2JSD A;  3AYU A;  4WKE A;  1USN A;  3EWJ A;  4IUW A;  3F19 A;  1XUD A;  1ZXV A;  2MLS A;  2MZE A;  2MZI A;  1FLS A;  4JPA A;  1O0Q A;  2DW0 A;  3AIG A;  3USN A;  4XCT A;  5CUH A;  1I1I P;  2YUF A;  4ILW D;  1BUD A;  3ZUK A;  3ZXH A;  1XFV A;  5I12 A;  2CLT A;  3MA2 A;  1HTD A;  2E2D A;  4GR3 A;  4I35 A;  5CZM A;  1Y93 A;  1L6J A;  3RTT A;  1XM5 A;  3HB2 P;  2WO8 A;  1AF0 A;  1G49 A;  3Q2G A;  2W15 A;  4DD8 A;  3WV1 A;  1YOU A;  4XBH A;  4L7A A;  2OXU A;  2OVZ A;  1Y0V A;  1BKC E;  1QUA A;  3O2X A;  4H3X A;  3K7L A;  4JQG A;  4AIG A;  2OW1 A;  3HYG A;  4EFS A;  5CXA A;  1BQQ M;  4J4M A;  2Z2D A;  3LUN A;  2DDY A;  2WO9 A;  2HU6 A;  4XM8 A;  1YP1 A;  1XUR A;  4XM6 A;  4H76 A;  1I76 A;  3BA0 A;  3HDA P;  3B8Z A;  1KBC A;  1UTZ A;  1WNI A;  1J7N A;  1XFY A;  1DMT A;  3WV3 A;  3I7G A;  2POJ A;  4XM7 A;  1QJJ A;  4FXQ A;  1OO9 A;  1JKY A;  1UEA A;  2OXZ A;  2Y6C A;  1CGF A;  3LK8 A;  4HMA A;  5LAB A;  1Z3J A;  1GKC A;  3TT4 A;  4PKU A;  1K7G A;  3B92 A;  1R1J A;  1OS2 A;  2AYK A;  3CKI A;  966C A;  1XAX A;  1G9K A;  2OZR A;  3DWB A;  1ATL A;  1QJI A;  4DV8 A;  1JIZ A;  1C7K A;  1MMQ A;  3TSK A;  3ZVS A;  3AYK A;  2XS4 A;  1AYK A;  1RMZ A;  1R1I A;  5D7W A;  1SLN A;  1SAT A;  4AXQ A;  1R1H A;  1OM7 A;  4JIJ A;  4HX3 A;  1FBL A;  4ZR5 A;  2ERO A;  4GWN A;  3KRY A;  4DF9 A;  3SHI A;  1G4K A;  1KAP P;  4H2E A;  1XFZ A;  4PKS A;  3DTI A;  1QIC A;  1QIB A;  3N2V A;  1MMB A;  1BSW A;  4R3V A;  1XUC A;  2OY4 A;  4CTH A;  2Y6D A;  3HBV P;  2FV5 A;  1K7Q A;  3WV2 A;  3OHL A;  1CAQ A;  5BOY A;  3G5C A;  1O0T A;  2XS3 A;  1OMJ A;  1UMS A;  4WZV A;  2OY2 A;  5JMY A;  1BM6 A;  5I2Z A;  2DW2 A;  3EHY A;  1KUI A;  1ND1 A;  1D8M A;  3TVC A;  2X3A A;  3VI1 A;  4G9L A;  1R55 A;  3KEK A;  2ERP A;  4AUO A;  3P1V A;  5B5O A;  2J83 A;  3DTE A;  4L6T A;  1MMP A;  4PKV A;  1CIZ A;  1PWQ A;  4PKW A;  1ZTQ A;  3LIR A;  1FM1 A;  1DTH A;  3UVC A;  5D2B A;  3E8R A;  3EDH A;  4IJO A;  1OM6 A;  2JIH A;  4QKZ A;  2W13 A;  1SMP A;  1S4B P;  5H8X A;  1HFC A;  1A86 A;  4JP4 A;  1OM8 A;  2RJP A;  5BPA A;  5I43 A;  1B8Y A;  3DNG A;  2JNP A;  1ZP5 A;  1HFS A;  1JAN A;  4WK7 A;  1GE6 A;  1MNC A;  3KWV C;  1BIW A;  3OHO A;  3LQ0 A;  1AKL A;  4GWM A;  2L0R A;  5D3C A;  3P24 A;  2X3B A;  1UMT A;  3DPF A;  3LEA A;  1IAC A;  1KUH A;  1CK7 A;  2OI0 A;  1CQR A;  3EDG A;  4GQL A;  3G42 A;  2W14 A;  1SLM A;  4IN9 A;  1XFW A;  1CXV A;  1ZS0 A;  3LJZ A;  2TCL A;  3V96 B;  4G0D A;  1GO8 P;  1C8T A;  1EB6 A;  1H71 P;  1B3D A;  1GE5 A;  3F15 A;  3KME A;  4H84 A;  4L19 A;  3DTK A;  1JAQ A;  4PKQ A;  3EHX A;  2OW2 A;  3KMC A;  3LUM A;  4H30 A;  4I03 A;  2D1O A;  2D1N A;  1R54 A;  3HDB A;  3VTG A;  1EUB A;  1TVI A;  1BUV M;  4ON1 A;  1PWP A;  1KUK A;  4FU4 A;  3GBO A;  2DW1 A;  1XFU A;  3LKA A;  2MZH A;  5B5P A;  1HY7 A;  1IAG A;  2PJT A;  2CKI A;  4PKT A;  3HY9 A;  1IAA A;  1PWV A;  4DPE A;  3L0T A;  1A85 A;  1C3I A;  1AST A;  3LGP A;  1UTT A;  2O3E A;  1JH1 A;  3TS4 A;  3NX7 A;  5D1U A;  1GE7 A;  3LJT A;  4GR8 A;  3HY7 A;  3F18 A;  3KEJ A;  3I7I A;  4A7B A;  1HOV A;  2QPJ A;  2USN A;  3LQB A;  3LE9 A;  4GR0 A;  2A8H A;  3L0V A;  4GUY A;  1Q3A A;  3LMC A;  4Q1L A;  2JT6 A;  1XFX A;  3LJG A;  1MMR A;  2W0D A;  3DPE A;  2DDF A;  4FXY P;  1IAD A;  4AYK A;  5D1T A;  1GXD A;  1JJ9 A;  1KUG A;  1JAO A;  2K2G A;  1BQO A;  2X7M A;  1G05 A;  1QIA A;  3N2U A;  1D7X A;  2MLR A;  1SRP A;  2YIG A;  2ERQ A;  4FVL A;  1YCM A;  3DL1 A;  3KHI A;  2JT5 A;  3HBU P;  4L63 A;  3B2Z A;  3O64 A;  4WF6 A;  1PWU A;  3K7N A;  830C A;  1ZXC A;  1BKC I;  1YQY A;  2OW0 A;  5BOT A;  4H82 A;  3KEC A;  1OZ9 A;  2OVX A;  3EDZ A;  1IAE A;  2X3C A;  2J0T A;  3EDI A;  1GKD A;  5D1S A;  5I4O A;  1ROS A;  3F1A A;  2E3X A;  4WKI A;  1PWW A;  3Q2H A;  2AIG P;  1KUF A;  5I0L A;  4A3W A;  1BKC A;  1CGE A;  1BZS A;  3DSL A; 
#chains in the Genus database with same CATH homology
 2N8R A;  3ELM A;  1JAP A;  2WOA A;  1GO7 P;  2OW9 A;  2YB9 A;  1Y8J A;  4H49 A;  2KRJ A;  3F17 A;  1RM8 A;  1OS9 A;  456C A;  2O36 A;  2FV9 A;  1JK3 A;  1CGL A;  1G12 A;  2SRT A;  3U1R A;  2W12 A;  5I3M A;  3LIK A;  1JIW P;  3F16 A;  1D8F A;  2K9C A;  1D5J A;  1IAB A;  1EAK A;  4GF1 A;  2RJQ A;  4PKR A;  4H1Q A;  3LIL A;  5L79 A;  4JA1 A;  2OXW A;  2V4B A;  1ZVX A;  1HV5 A;  1K7I A;  2I47 A;  1I73 A;  5L7F A;  1SU3 A;  3RTS A;  2JSD A;  3AYU A;  4WKE A;  1USN A;  3EWJ A;  4IUW A;  3F19 A;  1XUD A;  1ZXV A;  2MLS A;  2MZE A;  2MZI A;  1FLS A;  4JPA A;  1O0Q A;  2DW0 A;  3AIG A;  3USN A;  4XCT A;  5CUH A;  1I1I P;  2YUF A;  4ILW D;  1BUD A;  3ZUK A;  3ZXH A;  1XFV A;  5I12 A;  2CLT A;  3MA2 A;  1HTD A;  2E2D A;  4GR3 A;  4I35 A;  5CZM A;  1Y93 A;  1L6J A;  3RTT A;  3HB2 P;  2WO8 A;  1AF0 A;  1G49 A;  3Q2G A;  2W15 A;  4DD8 A;  3WV1 A;  1YOU A;  4XBH A;  4L7A A;  2OXU A;  2OVZ A;  1Y0V A;  1BKC E;  1QUA A;  3O2X A;  4H3X A;  3K7L A;  4JQG A;  4AIG A;  2OW1 A;  3HYG A;  4EFS A;  5CXA A;  1BQQ M;  4J4M A;  2Z2D A;  3LUN A;  2DDY A;  2WO9 A;  2HU6 A;  4XM8 A;  1YP1 A;  1XUR A;  4XM6 A;  4H76 A;  1I76 A;  3BA0 A;  3HDA P;  3B8Z A;  1KBC A;  1UTZ A;  1WNI A;  1J7N A;  1XFY A;  1DMT A;  3WV3 A;  3I7G A;  2POJ A;  4XM7 A;  1QJJ A;  4FXQ A;  1OO9 A;  1JKY A;  1UEA A;  2OXZ A;  2Y6C A;  1CGF A;  3LK8 A;  4HMA A;  5LAB A;  1Z3J A;  1GKC A;  3TT4 A;  4PKU A;  1K7G A;  3B92 A;  1R1J A;  1OS2 A;  2AYK A;  3CKI A;  966C A;  1G9K A;  2OZR A;  3DWB A;  1ATL A;  1QJI A;  4DV8 A;  1JIZ A;  1C7K A;  1MMQ A;  3TSK A;  3ZVS A;  3AYK A;  2XS4 A;  1AYK A;  1RMZ A;  1R1I A;  5D7W A;  1SLN A;  1SAT A;  4AXQ A;  1R1H A;  1OM7 A;  4JIJ A;  4HX3 A;  1FBL A;  4ZR5 A;  2ERO A;  4GWN A;  3KRY A;  4DF9 A;  3SHI A;  1G4K A;  1KAP P;  4H2E A;  1XFZ A;  4PKS A;  3DTI A;  1QIC A;  1QIB A;  3N2V A;  1MMB A;  1BSW A;  4R3V A;  1XUC A;  2OY4 A;  4CTH A;  2Y6D A;  3HBV P;  2FV5 A;  1K7Q A;  3WV2 A;  3OHL A;  1CAQ A;  5BOY A;  3G5C A;  1O0T A;  2XS3 A;  1OMJ A;  1UMS A;  4WZV A;  2OY2 A;  5JMY A;  1BM6 A;  5I2Z A;  2DW2 A;  3EHY A;  1KUI A;  1ND1 A;  1D8M A;  3TVC A;  2X3A A;  3VI1 A;  4G9L A;  1R55 A;  3KEK A;  2ERP A;  4AUO A;  3P1V A;  5B5O A;  2J83 A;  3DTE A;  4L6T A;  1MMP A;  4PKV A;  1CIZ A;  1PWQ A;  4PKW A;  1ZTQ A;  3LIR A;  1FM1 A;  1DTH A;  3UVC A;  5D2B A;  3E8R A;  3EDH A;  4IJO A;  1OM6 A;  2JIH A;  4QKZ A;  2W13 A;  1SMP A;  1S4B P;  5H8X A;  1HFC A;  1A86 A;  4JP4 A;  1OM8 A;  2RJP A;  5BPA A;  5I43 A;  1B8Y A;  3DNG A;  2JNP A;  1ZP5 A;  1HFS A;  1JAN A;  4WK7 A;  1GE6 A;  1MNC A;  3KWV C;  1BIW A;  3OHO A;  3LQ0 A;  1AKL A;  4GWM A;  2L0R A;  5D3C A;  3P24 A;  2X3B A;  1UMT A;  3DPF A;  3LEA A;  1IAC A;  1KUH A;  1CK7 A;  2OI0 A;  1CQR A;  3EDG A;  4GQL A;  3G42 A;  2W14 A;  1SLM A;  4IN9 A;  1XFW A;  1CXV A;  1ZS0 A;  3LJZ A;  2TCL A;  3V96 B;  4G0D A;  1GO8 P;  1C8T A;  1EB6 A;  1H71 P;  1B3D A;  1GE5 A;  3F15 A;  3KME A;  4H84 A;  4L19 A;  3DTK A;  1JAQ A;  4PKQ A;  3EHX A;  2OW2 A;  3KMC A;  3LUM A;  4H30 A;  4I03 A;  2D1O A;  2D1N A;  1R54 A;  3HDB A;  3VTG A;  1EUB A;  1BUV M;  4ON1 A;  1PWP A;  1KUK A;  4FU4 A;  3GBO A;  2DW1 A;  1XFU A;  3LKA A;  2MZH A;  5B5P A;  1HY7 A;  1IAG A;  2PJT A;  2CKI A;  4PKT A;  3HY9 A;  1IAA A;  1PWV A;  4DPE A;  3L0T A;  1A85 A;  1C3I A;  1AST A;  3LGP A;  1UTT A;  2O3E A;  1JH1 A;  3TS4 A;  3NX7 A;  5D1U A;  1GE7 A;  3LJT A;  4GR8 A;  3HY7 A;  3F18 A;  3KEJ A;  3I7I A;  4A7B A;  1HOV A;  2QPJ A;  2USN A;  3LQB A;  3LE9 A;  4GR0 A;  2A8H A;  3L0V A;  4GUY A;  1Q3A A;  3LMC A;  4Q1L A;  2JT6 A;  1XFX A;  3LJG A;  1MMR A;  2W0D A;  3DPE A;  2DDF A;  4FXY P;  1IAD A;  4AYK A;  5D1T A;  1GXD A;  1JJ9 A;  1KUG A;  1JAO A;  2K2G A;  1BQO A;  2X7M A;  1G05 A;  1QIA A;  3N2U A;  1D7X A;  2MLR A;  1SRP A;  2YIG A;  2ERQ A;  4FVL A;  1YCM A;  3DL1 A;  3KHI A;  2JT5 A;  3HBU P;  4L63 A;  3B2Z A;  3O64 A;  4WF6 A;  1PWU A;  3K7N A;  830C A;  1ZXC A;  1BKC I;  1YQY A;  2OW0 A;  5BOT A;  4H82 A;  3KEC A;  2OVX A;  3EDZ A;  1IAE A;  2X3C A;  2J0T A;  3EDI A;  1GKD A;  5D1S A;  5I4O A;  1ROS A;  3F1A A;  2E3X A;  4WKI A;  1PWW A;  3Q2H A;  2AIG P;  1KUF A;  5I0L A;  4A3W A;  1BKC A;  1CGE A;  1BZS A;  3DSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...