3NX7A

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor n-hydroxy-2-(n-(2-hydroxyethyl)4-methoxyphenylsulfonamido)acetamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Macrophage metalloelastase
publication title Exploring the subtleties of drug-receptor interactions: the case of matrix metalloproteinases
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3nx7A00
1IAEA 1EB6A 2DW1A 2MZEA 3DWBA 3EHXA 3DSLA 1PWPA 3B92A 3E8RA 5I3MA 1EUBA 3MA2A 4PKQA 1JJ9A 2J0TA 5LABA 2OZRA 3B8ZA 3ZVSA 2X3BA 1JAOA 4H30A 2V4BA 4PKRA 4GR3A 4H49A 2USNA 3OHOA 3SHIA 3P1VA 4PKTA 3KEJA 1ZVXA 4CTHA 1ZS0A 1R1HA 1XFVA 2OY2A 4JA1A 3HB2P 4J4MA 1WNIA 1ROSA 5BOYA 4XM6A 1JKYA 3EHYA 2N8RA 4L6TA 3DPEA 1BKCI 1O0TA 1CQRA 3LILA 4GUYA 1SATA 1MMPA 5BPAA 2I47A 1PWVA 1BZSA 1YQYA 3AYUA 1ZXVA 456CA 2X3CA 5D3CA 3N2VA 2O36A 2YB9A 3HY7A 3LIKA 4GR8A 2QPJA 3GBOA 4IJOA 1G9KA 4XM8A 3KMCA 5D1SA 3LQBA 1I76A 3O64A 2MLSA 1KUFA 1JH1A 3ZXHA 1GE6A 1R1JA 2OW0A 1KUIA 1OS2A 830CA 2K2GA 3F17A 1KUKA 3WV2A 2AIGP 4XM7A 2HU6A 1EAKA 4GWNA 4JQGA 3Q2GA 3L0VA 3F19A 5CXAA 1XFUA 1BM6A 4DD8A 1USNA 1G49A 1YOUA 2OI0A 1ND1A 4H82A 1ATLA 1SU3A 3V96B 1AYKA 4QKZA 3G5CA 3LEAA 1B3DA 4WKIA 1R1IA 3TS4A 2X7MA 3KHIA 2ERPA 4ILWD 4JIJA 2K9CA 4PKVA 4XCTA 1DTHA 5I2ZA 1UTTA 2FV9A 4I03A 3LQ0A 1BKCE 3LUMA 4A3WA 1RMZA 3P24A 1FBLA 1PWUA 4WKEA 3O2XA 4H76A 2XS3A 3VI1A 1BSWA 1KUHA 1OO9A 3HYGA 1ZP5A 1K7IA 2DW2A 2XS4A 2JIHA 5H8XA 1JAQA 3RTTA 4AXQA 4H1QA 1K7QA 1QIAA 3TVCA 5JMYA 1J7NA 1B8YA 4H3XA 1JANA 4DF9A 5D7WA 1OM7A 2JSDA 5CUHA 5I0LA 3LGPA 1ZTQA 1I73A 2D1OA 1D5JA 2OW1A 1Q3AA 1KBCA 3DL1A 3B2ZA 3KMEA 4WF6A 1O0QA 2MZIA 3AIGA 2YIGA 5D2BA 1OM6A 1BIWA 4JPAA 1IAAA 3KWVC 1GXDA 4PKSA 2MLRA 3USNA 1HOVA 1R54A 3KECA 2E3XA 4H84A 2RJQA 3KEKA 1D7XA 1UMTA 5I4OA 2AYKA 3BA0A 2ERQA 4FVLA 1XUCA 3L0TA 3DPFA 2OW9A 4ZR5A 1KUGA 4EFSA 1H71P 3EDGA 1BUVM 3LJTA 1FM1A 1ZXCA 2W13A 4AUOA 5I43A 3EWJA 4IN9A 3UVCA 4I35A 4FXYP 4HMAA 1XFZA 1G12A 1I1IP 2SRTA 2PJTA 2CLTA 1FLSA 1UEAA 1PWQA 1C8TA 1IAGA 1IADA 5B5OA 1C7KA 2X3AA 1BQOA 5CZMA 2OW2A 2OXZA 2MZHA 966CA 2OVZA 4FU4A 1K7GA 5L7FA 1CGLA 1SLMA 4DPEA 1A85A 4FXQA 4A7BA 1JIZA 2E2DA 4R3VA 2EROA 1OS9A 3KRYA 3HY9A 1BQQM 1GE5A 4GQLA 2OXWA 3ELMA 1HTDA 1HY7A 5L79A 1AF0A 2KRJA 2D1NA 3OHLA 1A86A 1C3IA 2A8HA 3AYKA 1GO7P 4PKUA 2L0RA 2W15A 1MMRA 1GO8P 4JP4A 3F16A 3LMCA 1BUDA 5I12A 1Y0VA 1BKCA 3Q2HA 1XFYA 2DW0A 2OXUA 1KAPP 2Y6DA 1IABA 1SLNA 2Y6CA 4G0DA 2W0DA 1SMPA 3F18A 5D1UA 1JAPA 4L63A 3I7IA 4WZVA 1CAQA 1MMBA 1QJIA 1QUAA 1QICA 3NX7A 3K7NA 3VTGA 3LIRA 3ZUKA 2W14A 3K7LA 1AKLA 3EDZA 4WK7A 4AYKA 2O3EA 1HFSA 1CGEA 1GKDA 1QIBA 1UTZA 5BOTA 3LE9A 1OM8A 2JT6A 1PWWA 3DNGA 4Q1LA 1CGFA 1XUDA 3F1AA 1MMQA 2CKIA 1S4BP 1RM8A 2W12A 2RJPA 3G42A 3N2UA 1CIZA 1QJJA 2WOAA 1Z3JA 1IACA 1L6JA 2OVXA 2DDFA 1JK3A 1UMSA 2WO9A 3WV3A 3LKAA 1OMJA 4DV8A 1DMTA 4ON1A 2JNPA 3HBUP 1MNCA 4GF1A 3HDAP 3LK8A 4HX3A 4AIGA 4H2EA 1YP1A 2J83A 2Z2DA 3LJGA 4L19A 4XBHA 1D8MA 3LJZA 1ASTA 1CXVA 1R55A 3EDIA 1G4KA 4G9LA 2OY4A 2FV5A 3HDBA 2POJA 3TSKA 3TT4A 4IUWA 1GE7A 3F15A 3EDHA 3RTSA 3U1RA 1XFXA 4PKWA 1G05A 4GR0A 5D1TA 1XURA 4GWMA 1GKCA 1HFCA 2WO8A 3I7GA 1Y8JA 1Y93A 1SRPA 1CK7A 3WV1A 1D8FA 3CKIA 1XFWA 1HV5A 5B5PA 2DDYA 1JIWP 3HBVP 3LUNA 1YCMA 2JT5A 2TCLA
chains in the Genus database with same CATH superfamily
1IAEA 1EB6A 2DW1A 2MZEA 3DWBA 3EHXA 3DSLA 1PWPA 3B92A 3E8RA 5I3MA 1EUBA 3MA2A 4PKQA 1JJ9A 2J0TA 5LABA 2OZRA 3B8ZA 3ZVSA 2X3BA 1JAOA 4H30A 2V4BA 4PKRA 4GR3A 4H49A 2USNA 3OHOA 3SHIA 3P1VA 4PKTA 3KEJA 1ZVXA 4CTHA 1ZS0A 1R1HA 1XFVA 2OY2A 4JA1A 3HB2P 4J4MA 1WNIA 1ROSA 5BOYA 4XM6A 1JKYA 3EHYA 2N8RA 4L6TA 3DTEA 3DPEA 1BKCI 1O0TA 1CQRA 3LILA 4GUYA 1SATA 1MMPA 5BPAA 2I47A 1PWVA 1BZSA 1YQYA 3AYUA 1ZXVA 456CA 2X3CA 5D3CA 3N2VA 2O36A 2YB9A 3HY7A 3LIKA 4GR8A 2QPJA 3GBOA 4IJOA 1G9KA 4XM8A 3KMCA 5D1SA 3LQBA 1I76A 3O64A 2MLSA 1KUFA 1JH1A 3ZXHA 1GE6A 1R1JA 2OW0A 1KUIA 3DTKA 1OS2A 830CA 2K2GA 3F17A 1KUKA 3WV2A 1OZ9A 2AIGP 4XM7A 2HU6A 1EAKA 1XM5A 4GWNA 4JQGA 3Q2GA 3L0VA 3F19A 5CXAA 1XFUA 1BM6A 4DD8A 1USNA 1G49A 1YOUA 2OI0A 1ND1A 4H82A 1ATLA 1SU3A 3V96B 1AYKA 4QKZA 3G5CA 3LEAA 1B3DA 4WKIA 1R1IA 3TS4A 2X7MA 3KHIA 2ERPA 4ILWD 4JIJA 2K9CA 4PKVA 4XCTA 1DTHA 5I2ZA 1UTTA 2FV9A 4I03A 3LQ0A 1BKCE 3LUMA 4A3WA 1RMZA 3P24A 1FBLA 1PWUA 4WKEA 3O2XA 4H76A 2XS3A 3VI1A 1BSWA 1KUHA 1OO9A 3DTIA 3HYGA 1ZP5A 1K7IA 2DW2A 2XS4A 2JIHA 5H8XA 1JAQA 3RTTA 4AXQA 4H1QA 1K7QA 1QIAA 3TVCA 5JMYA 1J7NA 1B8YA 4H3XA 1JANA 4DF9A 5D7WA 1OM7A 2JSDA 5CUHA 5I0LA 3LGPA 1ZTQA 1I73A 4L7AA 2D1OA 1D5JA 2OW1A 1Q3AA 1KBCA 3DL1A 3B2ZA 3KMEA 4WF6A 1O0QA 2MZIA 3AIGA 2YIGA 5D2BA 1OM6A 1BIWA 4JPAA 1IAAA 3KWVC 1GXDA 4PKSA 2MLRA 3USNA 1HOVA 1R54A 3KECA 2E3XA 4H84A 2RJQA 3KEKA 1D7XA 1UMTA 5I4OA 2AYKA 3BA0A 2ERQA 4FVLA 1XUCA 3L0TA 3DPFA 2OW9A 4ZR5A 1KUGA 4EFSA 1H71P 3EDGA 1BUVM 3LJTA 1FM1A 1ZXCA 2W13A 4AUOA 5I43A 3EWJA 4IN9A 3UVCA 4I35A 4FXYP 4HMAA 1XFZA 1G12A 1I1IP 2SRTA 2PJTA 2CLTA 1FLSA 1UEAA 1PWQA 1C8TA 1IAGA 1IADA 5B5OA 1C7KA 2X3AA 1BQOA 2YUFA 5CZMA 2OW2A 2OXZA 2MZHA 966CA 2OVZA 4FU4A 1K7GA 5L7FA 1CGLA 1SLMA 4DPEA 1A85A 4FXQA 4A7BA 1JIZA 2E2DA 4R3VA 2EROA 1OS9A 3KRYA 3HY9A 1BQQM 1GE5A 4GQLA 2OXWA 3ELMA 1HTDA 1HY7A 5L79A 1AF0A 2KRJA 2D1NA 3OHLA 1A86A 1C3IA 2A8HA 3AYKA 1GO7P 4PKUA 2L0RA 2W15A 1MMRA 1GO8P 4JP4A 1TVIA 3F16A 3LMCA 1BUDA 5I12A 1Y0VA 1BKCA 3Q2HA 1XFYA 2DW0A 2OXUA 1KAPP 2Y6DA 1IABA 1SLNA 2Y6CA 4G0DA 2W0DA 1SMPA 3F18A 5D1UA 1JAPA 4L63A 3I7IA 4WZVA 1CAQA 1MMBA 1QJIA 1QUAA 1QICA 3NX7A 3K7NA 3VTGA 3LIRA 3ZUKA 2W14A 3K7LA 1AKLA 3EDZA 4WK7A 4AYKA 2O3EA 1HFSA 1CGEA 1GKDA 1QIBA 1UTZA 5BOTA 3LE9A 1XAXA 1OM8A 2JT6A 1PWWA 3DNGA 4Q1LA 1CGFA 1XUDA 3F1AA 1MMQA 2CKIA 1S4BP 1RM8A 2W12A 2RJPA 3G42A 3N2UA 1CIZA 1QJJA 2WOAA 1Z3JA 1IACA 1L6JA 2OVXA 2DDFA 1JK3A 1UMSA 2WO9A 3WV3A 3LKAA 1OMJA 4DV8A 1DMTA 4ON1A 2JNPA 3HBUP 1MNCA 4GF1A 3HDAP 3LK8A 4HX3A 4AIGA 4H2EA 1YP1A 2J83A 2Z2DA 3LJGA 4L19A 4XBHA 1D8MA 3LJZA 1ASTA 1CXVA 1R55A 3EDIA 1G4KA 4G9LA 2OY4A 2FV5A 3HDBA 2POJA 3TSKA 3TT4A 4IUWA 1GE7A 3F15A 3EDHA 3RTSA 3U1RA 1XFXA 4PKWA 1G05A 4GR0A 5D1TA 1XURA 4GWMA 1GKCA 1HFCA 2WO8A 3I7GA 1Y8JA 1Y93A 1SRPA 1CK7A 3WV1A 1D8FA 3CKIA 1XFWA 1HV5A 5B5PA 2DDYA 1JIWP 3HBVP 3LUNA 1YCMA 2JT5A 2TCLA
chains in the Genus database with same CATH topology
1IAEA 1EB6A 2DW1A 2MZEA 3DWBA 3EHXA 3DSLA 1PWPA 3B92A 3E8RA 5I3MA 1EUBA 3MA2A 4PKQA 1JJ9A 2J0TA 5LABA 2OZRA 3B8ZA 3ZVSA 2X3BA 1JAOA 4H30A 2V4BA 4PKRA 4GR3A 4H49A 2USNA 3OHOA 3SHIA 3P1VA 4PKTA 3KEJA 1ZVXA 4CTHA 1ZS0A 1R1HA 1XFVA 2OY2A 4JA1A 3HB2P 4J4MA 1WNIA 1ROSA 5BOYA 4XM6A 1JKYA 3EHYA 2N8RA 4L6TA 3DTEA 3DPEA 1BKCI 1O0TA 1CQRA 3LILA 4GUYA 1SATA 1MMPA 5BPAA 2I47A 1PWVA 1BZSA 1YQYA 3AYUA 1ZXVA 456CA 2X3CA 5D3CA 3N2VA 2O36A 2YB9A 3HY7A 3LIKA 4GR8A 2QPJA 3GBOA 4IJOA 1G9KA 4XM8A 3KMCA 5D1SA 3LQBA 1I76A 3O64A 2MLSA 1KUFA 1JH1A 3ZXHA 1GE6A 1R1JA 2OW0A 1KUIA 3DTKA 1OS2A 830CA 2K2GA 3F17A 1KUKA 3WV2A 2AIGP 4XM7A 2HU6A 1EAKA 4GWNA 4JQGA 3Q2GA 3L0VA 3F19A 5CXAA 1XFUA 1BM6A 4DD8A 1USNA 1G49A 1YOUA 2OI0A 1ND1A 4H82A 1ATLA 1SU3A 3V96B 1AYKA 4QKZA 3G5CA 3LEAA 1B3DA 4WKIA 1R1IA 3TS4A 2X7MA 3KHIA 2ERPA 4ILWD 4JIJA 2K9CA 4PKVA 4XCTA 1DTHA 5I2ZA 1UTTA 2FV9A 4I03A 3LQ0A 1BKCE 3LUMA 4A3WA 1RMZA 3P24A 1FBLA 1PWUA 4WKEA 3O2XA 4H76A 2XS3A 3VI1A 1BSWA 1KUHA 1OO9A 3DTIA 3HYGA 1ZP5A 1K7IA 2DW2A 2XS4A 2JIHA 5H8XA 1JAQA 3RTTA 4AXQA 4H1QA 1K7QA 1QIAA 3TVCA 5JMYA 1J7NA 1B8YA 4H3XA 1JANA 4DF9A 5D7WA 1OM7A 2JSDA 5CUHA 5I0LA 3LGPA 1ZTQA 1I73A 4L7AA 2D1OA 1D5JA 2OW1A 1Q3AA 1KBCA 3DL1A 3B2ZA 3KMEA 4WF6A 1O0QA 2MZIA 3AIGA 2YIGA 5D2BA 1OM6A 1BIWA 4JPAA 1IAAA 3KWVC 1GXDA 4PKSA 2MLRA 3USNA 1HOVA 1R54A 3KECA 2E3XA 4H84A 2RJQA 3KEKA 1D7XA 1UMTA 5I4OA 2AYKA 3BA0A 2ERQA 4FVLA 1XUCA 3L0TA 3DPFA 2OW9A 4ZR5A 1KUGA 4EFSA 1H71P 3EDGA 1BUVM 3LJTA 1FM1A 1ZXCA 2W13A 4AUOA 5I43A 3EWJA 4IN9A 3UVCA 4I35A 4FXYP 4HMAA 1XFZA 1G12A 1I1IP 2SRTA 2PJTA 2CLTA 1FLSA 1UEAA 1PWQA 1C8TA 1IAGA 1IADA 5B5OA 1C7KA 2X3AA 1BQOA 2YUFA 5CZMA 2OW2A 2OXZA 2MZHA 966CA 2OVZA 4FU4A 1K7GA 5L7FA 1CGLA 1SLMA 4DPEA 1A85A 4FXQA 4A7BA 1JIZA 2E2DA 4R3VA 2EROA 1OS9A 3KRYA 3HY9A 1BQQM 1GE5A 4GQLA 2OXWA 3ELMA 1HTDA 1HY7A 5L79A 1AF0A 2KRJA 2D1NA 3OHLA 1A86A 1C3IA 2A8HA 3AYKA 1GO7P 4PKUA 2L0RA 2W15A 1MMRA 1GO8P 4JP4A 3F16A 3LMCA 1BUDA 5I12A 1Y0VA 1BKCA 3Q2HA 1XFYA 2DW0A 2OXUA 1KAPP 2Y6DA 1IABA 1SLNA 2Y6CA 4G0DA 2W0DA 1SMPA 3F18A 5D1UA 1JAPA 4L63A 3I7IA 4WZVA 1CAQA 1MMBA 1QJIA 1QUAA 1QICA 3NX7A 3K7NA 3VTGA 3LIRA 3ZUKA 2W14A 3K7LA 1AKLA 3EDZA 4WK7A 4AYKA 2O3EA 1HFSA 1CGEA 1GKDA 1QIBA 1UTZA 5BOTA 3LE9A 1OM8A 2JT6A 1PWWA 3DNGA 4Q1LA 1CGFA 1XUDA 3F1AA 1MMQA 2CKIA 1S4BP 1RM8A 2W12A 2RJPA 3G42A 3N2UA 1CIZA 1QJJA 2WOAA 1Z3JA 1IACA 1L6JA 2OVXA 2DDFA 1JK3A 1UMSA 2WO9A 3WV3A 3LKAA 1OMJA 4DV8A 1DMTA 4ON1A 2JNPA 3HBUP 1MNCA 4GF1A 3HDAP 3LK8A 4HX3A 4AIGA 4H2EA 1YP1A 2J83A 2Z2DA 3LJGA 4L19A 4XBHA 1D8MA 3LJZA 1ASTA 1CXVA 1R55A 3EDIA 1G4KA 4G9LA 2OY4A 2FV5A 3HDBA 2POJA 3TSKA 3TT4A 4IUWA 1GE7A 3F15A 3EDHA 3RTSA 3U1RA 1XFXA 4PKWA 1G05A 4GR0A 5D1TA 1XURA 4GWMA 1GKCA 1HFCA 2WO8A 3I7GA 1Y8JA 1Y93A 1SRPA 1CK7A 3WV1A 1D8FA 3CKIA 1XFWA 1HV5A 5B5PA 2DDYA 1JIWP 3HBVP 3LUNA 1YCMA 2JT5A 2TCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IAE A;  1EB6 A;  2DW1 A;  2MZE A;  3DWB A;  3EHX A;  3DSL A;  1PWP A;  3B92 A;  3E8R A;  5I3M A;  1EUB A;  3MA2 A;  4PKQ A;  1JJ9 A;  2J0T A;  5LAB A;  2OZR A;  3B8Z A;  3ZVS A;  2X3B A;  1JAO A;  4H30 A;  2V4B A;  4PKR A;  4GR3 A;  4H49 A;  2USN A;  3OHO A;  3SHI A;  3P1V A;  4PKT A;  3KEJ A;  1ZVX A;  4CTH A;  1ZS0 A;  1R1H A;  1XFV A;  2OY2 A;  4JA1 A;  3HB2 P;  4J4M A;  1WNI A;  1ROS A;  5BOY A;  4XM6 A;  1JKY A;  3EHY A;  2N8R A;  4L6T A;  3DPE A;  1BKC I;  1O0T A;  1CQR A;  3LIL A;  4GUY A;  1SAT A;  1MMP A;  5BPA A;  2I47 A;  1PWV A;  1BZS A;  1YQY A;  3AYU A;  1ZXV A;  456C A;  2X3C A;  5D3C A;  3N2V A;  2O36 A;  2YB9 A;  3HY7 A;  3LIK A;  4GR8 A;  2QPJ A;  3GBO A;  4IJO A;  1G9K A;  4XM8 A;  3KMC A;  5D1S A;  3LQB A;  1I76 A;  3O64 A;  2MLS A;  1KUF A;  1JH1 A;  3ZXH A;  1GE6 A;  1R1J A;  2OW0 A;  1KUI A;  1OS2 A;  830C A;  2K2G A;  3F17 A;  1KUK A;  3WV2 A;  2AIG P;  4XM7 A;  2HU6 A;  1EAK A;  4GWN A;  4JQG A;  3Q2G A;  3L0V A;  3F19 A;  5CXA A;  1XFU A;  1BM6 A;  4DD8 A;  1USN A;  1G49 A;  1YOU A;  2OI0 A;  1ND1 A;  4H82 A;  1ATL A;  1SU3 A;  3V96 B;  1AYK A;  4QKZ A;  3G5C A;  3LEA A;  1B3D A;  4WKI A;  1R1I A;  3TS4 A;  2X7M A;  3KHI A;  2ERP A;  4ILW D;  4JIJ A;  2K9C A;  4PKV A;  4XCT A;  1DTH A;  5I2Z A;  1UTT A;  2FV9 A;  4I03 A;  3LQ0 A;  1BKC E;  3LUM A;  4A3W A;  1RMZ A;  3P24 A;  1FBL A;  1PWU A;  4WKE A;  3O2X A;  4H76 A;  2XS3 A;  3VI1 A;  1BSW A;  1KUH A;  1OO9 A;  3HYG A;  1ZP5 A;  1K7I A;  2DW2 A;  2XS4 A;  2JIH A;  5H8X A;  1JAQ A;  3RTT A;  4AXQ A;  4H1Q A;  1K7Q A;  1QIA A;  3TVC A;  5JMY A;  1J7N A;  1B8Y A;  4H3X A;  1JAN A;  4DF9 A;  5D7W A;  1OM7 A;  2JSD A;  5CUH A;  5I0L A;  3LGP A;  1ZTQ A;  1I73 A;  2D1O A;  1D5J A;  2OW1 A;  1Q3A A;  1KBC A;  3DL1 A;  3B2Z A;  3KME A;  4WF6 A;  1O0Q A;  2MZI A;  3AIG A;  2YIG A;  5D2B A;  1OM6 A;  1BIW A;  4JPA A;  1IAA A;  3KWV C;  1GXD A;  4PKS A;  2MLR A;  3USN A;  1HOV A;  1R54 A;  3KEC A;  2E3X A;  4H84 A;  2RJQ A;  3KEK A;  1D7X A;  1UMT A;  5I4O A;  2AYK A;  3BA0 A;  2ERQ A;  4FVL A;  1XUC A;  3L0T A;  3DPF A;  2OW9 A;  4ZR5 A;  1KUG A;  4EFS A;  1H71 P;  3EDG A;  1BUV M;  3LJT A;  1FM1 A;  1ZXC A;  2W13 A;  4AUO A;  5I43 A;  3EWJ A;  4IN9 A;  3UVC A;  4I35 A;  4FXY P;  4HMA A;  1XFZ A;  1G12 A;  1I1I P;  2SRT A;  2PJT A;  2CLT A;  1FLS A;  1UEA A;  1PWQ A;  1C8T A;  1IAG A;  1IAD A;  5B5O A;  1C7K A;  2X3A A;  1BQO A;  5CZM A;  2OW2 A;  2OXZ A;  2MZH A;  966C A;  2OVZ A;  4FU4 A;  1K7G A;  5L7F A;  1CGL A;  1SLM A;  4DPE A;  1A85 A;  4FXQ A;  4A7B A;  1JIZ A;  2E2D A;  4R3V A;  2ERO A;  1OS9 A;  3KRY A;  3HY9 A;  1BQQ M;  1GE5 A;  4GQL A;  2OXW A;  3ELM A;  1HTD A;  1HY7 A;  5L79 A;  1AF0 A;  2KRJ A;  2D1N A;  3OHL A;  1A86 A;  1C3I A;  2A8H A;  3AYK A;  1GO7 P;  4PKU A;  2L0R A;  2W15 A;  1MMR A;  1GO8 P;  4JP4 A;  3F16 A;  3LMC A;  1BUD A;  5I12 A;  1Y0V A;  1BKC A;  3Q2H A;  1XFY A;  2DW0 A;  2OXU A;  1KAP P;  2Y6D A;  1IAB A;  1SLN A;  2Y6C A;  4G0D A;  2W0D A;  1SMP A;  3F18 A;  5D1U A;  1JAP A;  4L63 A;  3I7I A;  4WZV A;  1CAQ A;  1MMB A;  1QJI A;  1QUA A;  1QIC A;  3NX7 A;  3K7N A;  3VTG A;  3LIR A;  3ZUK A;  2W14 A;  3K7L A;  1AKL A;  3EDZ A;  4WK7 A;  4AYK A;  2O3E A;  1HFS A;  1CGE A;  1GKD A;  1QIB A;  1UTZ A;  5BOT A;  3LE9 A;  1OM8 A;  2JT6 A;  1PWW A;  3DNG A;  4Q1L A;  1CGF A;  1XUD A;  3F1A A;  1MMQ A;  2CKI A;  1S4B P;  1RM8 A;  2W12 A;  2RJP A;  3G42 A;  3N2U A;  1CIZ A;  1QJJ A;  2WOA A;  1Z3J A;  1IAC A;  1L6J A;  2OVX A;  2DDF A;  1JK3 A;  1UMS A;  2WO9 A;  3WV3 A;  3LKA A;  1OMJ A;  4DV8 A;  1DMT A;  4ON1 A;  2JNP A;  3HBU P;  1MNC A;  4GF1 A;  3HDA P;  3LK8 A;  4HX3 A;  4AIG A;  4H2E A;  1YP1 A;  2J83 A;  2Z2D A;  3LJG A;  4L19 A;  4XBH A;  1D8M A;  3LJZ A;  1AST A;  1CXV A;  1R55 A;  3EDI A;  1G4K A;  4G9L A;  2OY4 A;  2FV5 A;  3HDB A;  2POJ A;  3TSK A;  3TT4 A;  4IUW A;  1GE7 A;  3F15 A;  3EDH A;  3RTS A;  3U1R A;  1XFX A;  4PKW A;  1G05 A;  4GR0 A;  5D1T A;  1XUR A;  4GWM A;  1GKC A;  1HFC A;  2WO8 A;  3I7G A;  1Y8J A;  1Y93 A;  1SRP A;  1CK7 A;  3WV1 A;  1D8F A;  3CKI A;  1XFW A;  1HV5 A;  5B5P A;  2DDY A;  1JIW P;  3HBV P;  3LUN A;  1YCM A;  2JT5 A;  2TCL A; 
#chains in the Genus database with same CATH topology
 1IAE A;  1EB6 A;  2DW1 A;  2MZE A;  3DWB A;  3EHX A;  3DSL A;  1PWP A;  3B92 A;  3E8R A;  5I3M A;  1EUB A;  3MA2 A;  4PKQ A;  1JJ9 A;  2J0T A;  5LAB A;  2OZR A;  3B8Z A;  3ZVS A;  2X3B A;  1JAO A;  4H30 A;  2V4B A;  4PKR A;  4GR3 A;  4H49 A;  2USN A;  3OHO A;  3SHI A;  3P1V A;  4PKT A;  3KEJ A;  1ZVX A;  4CTH A;  1ZS0 A;  1R1H A;  1XFV A;  2OY2 A;  4JA1 A;  3HB2 P;  4J4M A;  1WNI A;  1ROS A;  5BOY A;  4XM6 A;  1JKY A;  3EHY A;  2N8R A;  4L6T A;  3DTE A;  3DPE A;  1BKC I;  1O0T A;  1CQR A;  3LIL A;  4GUY A;  1SAT A;  1MMP A;  5BPA A;  2I47 A;  1PWV A;  1BZS A;  1YQY A;  3AYU A;  1ZXV A;  456C A;  2X3C A;  5D3C A;  3N2V A;  2O36 A;  2YB9 A;  3HY7 A;  3LIK A;  4GR8 A;  2QPJ A;  3GBO A;  4IJO A;  1G9K A;  4XM8 A;  3KMC A;  5D1S A;  3LQB A;  1I76 A;  3O64 A;  2MLS A;  1KUF A;  1JH1 A;  3ZXH A;  1GE6 A;  1R1J A;  2OW0 A;  1KUI A;  3DTK A;  1OS2 A;  830C A;  2K2G A;  3F17 A;  1KUK A;  3WV2 A;  1OZ9 A;  2AIG P;  4XM7 A;  2HU6 A;  1EAK A;  1XM5 A;  4GWN A;  4JQG A;  3Q2G A;  3L0V A;  3F19 A;  5CXA A;  1XFU A;  1BM6 A;  4DD8 A;  1USN A;  1G49 A;  1YOU A;  2OI0 A;  1ND1 A;  4H82 A;  1ATL A;  1SU3 A;  3V96 B;  1AYK A;  4QKZ A;  3G5C A;  3LEA A;  1B3D A;  4WKI A;  1R1I A;  3TS4 A;  2X7M A;  3KHI A;  2ERP A;  4ILW D;  4JIJ A;  2K9C A;  4PKV A;  4XCT A;  1DTH A;  5I2Z A;  1UTT A;  2FV9 A;  4I03 A;  3LQ0 A;  1BKC E;  3LUM A;  4A3W A;  1RMZ A;  3P24 A;  1FBL A;  1PWU A;  4WKE A;  3O2X A;  4H76 A;  2XS3 A;  3VI1 A;  1BSW A;  1KUH A;  1OO9 A;  3DTI A;  3HYG A;  1ZP5 A;  1K7I A;  2DW2 A;  2XS4 A;  2JIH A;  5H8X A;  1JAQ A;  3RTT A;  4AXQ A;  4H1Q A;  1K7Q A;  1QIA A;  3TVC A;  5JMY A;  1J7N A;  1B8Y A;  4H3X A;  1JAN A;  4DF9 A;  5D7W A;  1OM7 A;  2JSD A;  5CUH A;  5I0L A;  3LGP A;  1ZTQ A;  1I73 A;  4L7A A;  2D1O A;  1D5J A;  2OW1 A;  1Q3A A;  1KBC A;  3DL1 A;  3B2Z A;  3KME A;  4WF6 A;  1O0Q A;  2MZI A;  3AIG A;  2YIG A;  5D2B A;  1OM6 A;  1BIW A;  4JPA A;  1IAA A;  3KWV C;  1GXD A;  4PKS A;  2MLR A;  3USN A;  1HOV A;  1R54 A;  3KEC A;  2E3X A;  4H84 A;  2RJQ A;  3KEK A;  1D7X A;  1UMT A;  5I4O A;  2AYK A;  3BA0 A;  2ERQ A;  4FVL A;  1XUC A;  3L0T A;  3DPF A;  2OW9 A;  4ZR5 A;  1KUG A;  4EFS A;  1H71 P;  3EDG A;  1BUV M;  3LJT A;  1FM1 A;  1ZXC A;  2W13 A;  4AUO A;  5I43 A;  3EWJ A;  4IN9 A;  3UVC A;  4I35 A;  4FXY P;  4HMA A;  1XFZ A;  1G12 A;  1I1I P;  2SRT A;  2PJT A;  2CLT A;  1FLS A;  1UEA A;  1PWQ A;  1C8T A;  1IAG A;  1IAD A;  5B5O A;  1C7K A;  2X3A A;  1BQO A;  2YUF A;  5CZM A;  2OW2 A;  2OXZ A;  2MZH A;  966C A;  2OVZ A;  4FU4 A;  1K7G A;  5L7F A;  1CGL A;  1SLM A;  4DPE A;  1A85 A;  4FXQ A;  4A7B A;  1JIZ A;  2E2D A;  4R3V A;  2ERO A;  1OS9 A;  3KRY A;  3HY9 A;  1BQQ M;  1GE5 A;  4GQL A;  2OXW A;  3ELM A;  1HTD A;  1HY7 A;  5L79 A;  1AF0 A;  2KRJ A;  2D1N A;  3OHL A;  1A86 A;  1C3I A;  2A8H A;  3AYK A;  1GO7 P;  4PKU A;  2L0R A;  2W15 A;  1MMR A;  1GO8 P;  4JP4 A;  1TVI A;  3F16 A;  3LMC A;  1BUD A;  5I12 A;  1Y0V A;  1BKC A;  3Q2H A;  1XFY A;  2DW0 A;  2OXU A;  1KAP P;  2Y6D A;  1IAB A;  1SLN A;  2Y6C A;  4G0D A;  2W0D A;  1SMP A;  3F18 A;  5D1U A;  1JAP A;  4L63 A;  3I7I A;  4WZV A;  1CAQ A;  1MMB A;  1QJI A;  1QUA A;  1QIC A;  3NX7 A;  3K7N A;  3VTG A;  3LIR A;  3ZUK A;  2W14 A;  3K7L A;  1AKL A;  3EDZ A;  4WK7 A;  4AYK A;  2O3E A;  1HFS A;  1CGE A;  1GKD A;  1QIB A;  1UTZ A;  5BOT A;  3LE9 A;  1XAX A;  1OM8 A;  2JT6 A;  1PWW A;  3DNG A;  4Q1L A;  1CGF A;  1XUD A;  3F1A A;  1MMQ A;  2CKI A;  1S4B P;  1RM8 A;  2W12 A;  2RJP A;  3G42 A;  3N2U A;  1CIZ A;  1QJJ A;  2WOA A;  1Z3J A;  1IAC A;  1L6J A;  2OVX A;  2DDF A;  1JK3 A;  1UMS A;  2WO9 A;  3WV3 A;  3LKA A;  1OMJ A;  4DV8 A;  1DMT A;  4ON1 A;  2JNP A;  3HBU P;  1MNC A;  4GF1 A;  3HDA P;  3LK8 A;  4HX3 A;  4AIG A;  4H2E A;  1YP1 A;  2J83 A;  2Z2D A;  3LJG A;  4L19 A;  4XBH A;  1D8M A;  3LJZ A;  1AST A;  1CXV A;  1R55 A;  3EDI A;  1G4K A;  4G9L A;  2OY4 A;  2FV5 A;  3HDB A;  2POJ A;  3TSK A;  3TT4 A;  4IUW A;  1GE7 A;  3F15 A;  3EDH A;  3RTS A;  3U1R A;  1XFX A;  4PKW A;  1G05 A;  4GR0 A;  5D1T A;  1XUR A;  4GWM A;  1GKC A;  1HFC A;  2WO8 A;  3I7G A;  1Y8J A;  1Y93 A;  1SRP A;  1CK7 A;  3WV1 A;  1D8F A;  3CKI A;  1XFW A;  1HV5 A;  5B5P A;  2DDY A;  1JIW P;  3HBV P;  3LUN A;  1YCM A;  2JT5 A;  2TCL A; 
#chains in the Genus database with same CATH homology
 1IAE A;  1EB6 A;  2DW1 A;  2MZE A;  3DWB A;  3EHX A;  3DSL A;  1PWP A;  3B92 A;  3E8R A;  5I3M A;  1EUB A;  3MA2 A;  4PKQ A;  1JJ9 A;  2J0T A;  5LAB A;  2OZR A;  3B8Z A;  3ZVS A;  2X3B A;  1JAO A;  4H30 A;  2V4B A;  4PKR A;  4GR3 A;  4H49 A;  2USN A;  3OHO A;  3SHI A;  3P1V A;  4PKT A;  3KEJ A;  1ZVX A;  4CTH A;  1ZS0 A;  1R1H A;  1XFV A;  2OY2 A;  4JA1 A;  3HB2 P;  4J4M A;  1WNI A;  1ROS A;  5BOY A;  4XM6 A;  1JKY A;  3EHY A;  2N8R A;  4L6T A;  3DTE A;  3DPE A;  1BKC I;  1O0T A;  1CQR A;  3LIL A;  4GUY A;  1SAT A;  1MMP A;  5BPA A;  2I47 A;  1PWV A;  1BZS A;  1YQY A;  3AYU A;  1ZXV A;  456C A;  2X3C A;  5D3C A;  3N2V A;  2O36 A;  2YB9 A;  3HY7 A;  3LIK A;  4GR8 A;  2QPJ A;  3GBO A;  4IJO A;  1G9K A;  4XM8 A;  3KMC A;  5D1S A;  3LQB A;  1I76 A;  3O64 A;  2MLS A;  1KUF A;  1JH1 A;  3ZXH A;  1GE6 A;  1R1J A;  2OW0 A;  1KUI A;  3DTK A;  1OS2 A;  830C A;  2K2G A;  3F17 A;  1KUK A;  3WV2 A;  2AIG P;  4XM7 A;  2HU6 A;  1EAK A;  4GWN A;  4JQG A;  3Q2G A;  3L0V A;  3F19 A;  5CXA A;  1XFU A;  1BM6 A;  4DD8 A;  1USN A;  1G49 A;  1YOU A;  2OI0 A;  1ND1 A;  4H82 A;  1ATL A;  1SU3 A;  3V96 B;  1AYK A;  4QKZ A;  3G5C A;  3LEA A;  1B3D A;  4WKI A;  1R1I A;  3TS4 A;  2X7M A;  3KHI A;  2ERP A;  4ILW D;  4JIJ A;  2K9C A;  4PKV A;  4XCT A;  1DTH A;  5I2Z A;  1UTT A;  2FV9 A;  4I03 A;  3LQ0 A;  1BKC E;  3LUM A;  4A3W A;  1RMZ A;  3P24 A;  1FBL A;  1PWU A;  4WKE A;  3O2X A;  4H76 A;  2XS3 A;  3VI1 A;  1BSW A;  1KUH A;  1OO9 A;  3DTI A;  3HYG A;  1ZP5 A;  1K7I A;  2DW2 A;  2XS4 A;  2JIH A;  5H8X A;  1JAQ A;  3RTT A;  4AXQ A;  4H1Q A;  1K7Q A;  1QIA A;  3TVC A;  5JMY A;  1J7N A;  1B8Y A;  4H3X A;  1JAN A;  4DF9 A;  5D7W A;  1OM7 A;  2JSD A;  5CUH A;  5I0L A;  3LGP A;  1ZTQ A;  1I73 A;  4L7A A;  2D1O A;  1D5J A;  2OW1 A;  1Q3A A;  1KBC A;  3DL1 A;  3B2Z A;  3KME A;  4WF6 A;  1O0Q A;  2MZI A;  3AIG A;  2YIG A;  5D2B A;  1OM6 A;  1BIW A;  4JPA A;  1IAA A;  3KWV C;  1GXD A;  4PKS A;  2MLR A;  3USN A;  1HOV A;  1R54 A;  3KEC A;  2E3X A;  4H84 A;  2RJQ A;  3KEK A;  1D7X A;  1UMT A;  5I4O A;  2AYK A;  3BA0 A;  2ERQ A;  4FVL A;  1XUC A;  3L0T A;  3DPF A;  2OW9 A;  4ZR5 A;  1KUG A;  4EFS A;  1H71 P;  3EDG A;  1BUV M;  3LJT A;  1FM1 A;  1ZXC A;  2W13 A;  4AUO A;  5I43 A;  3EWJ A;  4IN9 A;  3UVC A;  4I35 A;  4FXY P;  4HMA A;  1XFZ A;  1G12 A;  1I1I P;  2SRT A;  2PJT A;  2CLT A;  1FLS A;  1UEA A;  1PWQ A;  1C8T A;  1IAG A;  1IAD A;  5B5O A;  1C7K A;  2X3A A;  1BQO A;  2YUF A;  5CZM A;  2OW2 A;  2OXZ A;  2MZH A;  966C A;  2OVZ A;  4FU4 A;  1K7G A;  5L7F A;  1CGL A;  1SLM A;  4DPE A;  1A85 A;  4FXQ A;  4A7B A;  1JIZ A;  2E2D A;  4R3V A;  2ERO A;  1OS9 A;  3KRY A;  3HY9 A;  1BQQ M;  1GE5 A;  4GQL A;  2OXW A;  3ELM A;  1HTD A;  1HY7 A;  5L79 A;  1AF0 A;  2KRJ A;  2D1N A;  3OHL A;  1A86 A;  1C3I A;  2A8H A;  3AYK A;  1GO7 P;  4PKU A;  2L0R A;  2W15 A;  1MMR A;  1GO8 P;  4JP4 A;  3F16 A;  3LMC A;  1BUD A;  5I12 A;  1Y0V A;  1BKC A;  3Q2H A;  1XFY A;  2DW0 A;  2OXU A;  1KAP P;  2Y6D A;  1IAB A;  1SLN A;  2Y6C A;  4G0D A;  2W0D A;  1SMP A;  3F18 A;  5D1U A;  1JAP A;  4L63 A;  3I7I A;  4WZV A;  1CAQ A;  1MMB A;  1QJI A;  1QUA A;  1QIC A;  3NX7 A;  3K7N A;  3VTG A;  3LIR A;  3ZUK A;  2W14 A;  3K7L A;  1AKL A;  3EDZ A;  4WK7 A;  4AYK A;  2O3E A;  1HFS A;  1CGE A;  1GKD A;  1QIB A;  1UTZ A;  5BOT A;  3LE9 A;  1OM8 A;  2JT6 A;  1PWW A;  3DNG A;  4Q1L A;  1CGF A;  1XUD A;  3F1A A;  1MMQ A;  2CKI A;  1S4B P;  1RM8 A;  2W12 A;  2RJP A;  3G42 A;  3N2U A;  1CIZ A;  1QJJ A;  2WOA A;  1Z3J A;  1IAC A;  1L6J A;  2OVX A;  2DDF A;  1JK3 A;  1UMS A;  2WO9 A;  3WV3 A;  3LKA A;  1OMJ A;  4DV8 A;  1DMT A;  4ON1 A;  2JNP A;  3HBU P;  1MNC A;  4GF1 A;  3HDA P;  3LK8 A;  4HX3 A;  4AIG A;  4H2E A;  1YP1 A;  2J83 A;  2Z2D A;  3LJG A;  4L19 A;  4XBH A;  1D8M A;  3LJZ A;  1AST A;  1CXV A;  1R55 A;  3EDI A;  1G4K A;  4G9L A;  2OY4 A;  2FV5 A;  3HDB A;  2POJ A;  3TSK A;  3TT4 A;  4IUW A;  1GE7 A;  3F15 A;  3EDH A;  3RTS A;  3U1R A;  1XFX A;  4PKW A;  1G05 A;  4GR0 A;  5D1T A;  1XUR A;  4GWM A;  1GKC A;  1HFC A;  2WO8 A;  3I7G A;  1Y8J A;  1Y93 A;  1SRP A;  1CK7 A;  3WV1 A;  1D8F A;  3CKI A;  1XFW A;  1HV5 A;  5B5P A;  2DDY A;  1JIW P;  3HBV P;  3LUN A;  1YCM A;  2JT5 A;  2TCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...