1BKCA

Catalytic domain of tnf-alpha converting enzyme (tace)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
255
structure length
255
Chain Sequence
b'DPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTAWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSQCSKQSIYKTIESKAQECFQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR NECROSIS FACTOR-ALPHA-CONVERTING ENZYME
publication title Crystal structure of the catalytic domain of human tumor necrosis factor-alpha-converting enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Zn-endopeptidase
total genus 84
structure length 255
sequence length 255
chains with identical sequence C
ec nomenclature ec 3.4.24.86: ADAM 17 endopeptidase.
pdb deposition date 1998-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13688 Reprolysin_5 Metallo-peptidase family M12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1bkcA00
2J0TA 1MMQA 3DPFA 1ATLA 4GR8A 3ZUKA 1D8MA 1G49A 3LJGA 4WZVA 2YB9A 3TSKA 1H71P 4GWNA 1YP1A 1D7XA 1J7NA 3HDAP 1DTHA 1KBCA 2AYKA 4PKQA 3F17A 1R55A 4G0DA 1BKCE 4JPAA 1AKLA 2POJA 4XM7A 3KECA 4JQGA 2KRJA 3DSLA 3P1VA 4PKVA 2X3CA 1USNA 1PWQA 1R1JA 3KMEA 1OS9A 1PWUA 1ZTQA 5I4OA 4L19A 1FM1A 1I73A 1R54A 5D1TA 1K7IA 3AYKA 2ERQA 4R3VA 3OHLA 1HFCA 2OVZA 1CK7A 2V4BA 3GBOA 3LKAA 1I1IP 2L0RA 3B92A 4PKUA 3WV2A 2W15A 1G05A 3O2XA 4EFSA 3AIGA 3F15A 3F18A 5D1SA 1QJJA 3NX7A 1GO8P 1MMPA 1MMRA 3LQBA 2DW1A 3KEJA 3E8RA 3P24A 2MLSA 2CLTA 5LABA 1CXVA 1XFXA 3G42A 5I43A 2YIGA 2MZIA 2OY4A 1MNCA 1PWVA 1D8FA 5CZMA 1G9KA 2DW0A 2WOAA 3DPEA 3AYUA 3B8ZA 4QKZA 1JIZA 5I3MA 1CGEA 1SATA 4ILWD 1B8YA 2A8HA 1SMPA 456CA 1HOVA 1CQRA 4FXQA 1JAQA 3HB2P 5BOYA 3LMCA 1BUVM 1IABA 1SLMA 3HY7A 4DV8A 3USNA 1OS2A 3DNGA 3LGPA 2O3EA 3HBVP 1CGFA 2JSDA 3I7IA 4JA1A 3Q2HA 1CAQA 2QPJA 3EDGA 3VI1A 1ZS0A 3OHOA 1HTDA 1GKCA 4XCTA 3LQ0A 1EB6A 3TT4A 2MZEA 1FLSA 2D1NA 1B3DA 1XURA 2JT6A 3U1RA 5I2ZA 1KUHA 1Y8JA 1BM6A 1GE5A 1OM6A 4H49A 1RMZA 4AIGA 1OO9A 2W12A 1G4KA 3LK8A 4H2EA 4H82A 3DL1A 1G12A 2DW2A 1XFWA 1KAPP 3N2UA 5D1UA 1ZP5A 2W13A 4GQLA 1XUDA 3KMCA 4WKIA 2J83A 3UVCA 1IACA 5JMYA 1BKCI 3B2ZA 3LJZA 3LUMA 2MLRA 2WO8A 1ND1A 2RJPA 2USNA 2OW9A 1SLNA 2JIHA 2OW1A 4DF9A 1BSWA 4A7BA 3ZXHA 3F19A 4XM6A 1GO7P 1JH1A 4IN9A 4CTHA 4G9LA 1A86A 3LIKA 1Z3JA 4GR3A 3RTTA 3LIRA 4L63A 2EROA 2RJQA 1I76A 3EHXA 3LEAA 1ZVXA 2XS3A 1QIAA 1DMTA 1BQQM 3LJTA 2XS4A 1GXDA 2Y6CA 1PWPA 3F16A 1IAGA 1JK3A 2MZHA 3LE9A 2E2DA 2FV9A 2WO9A 5CUHA 1KUFA 1A85A 4L6TA 1IADA 2K2GA 2OY2A 1Y0VA 1BIWA 1S4BP 2OW0A 1XFZA 2OI0A 5D3CA 2X3BA 2JT5A 3MA2A 1KUIA 4GF1A 1EUBA 2DDFA 2CKIA 2Z2DA 4Q1LA 1GE6A 4H3XA 1JAOA 1WNIA 2JNPA 1PWWA 4FXYP 2W0DA 4JIJA 3K7LA 4HMAA 1HV5A 1XFYA 5B5OA 1EAKA 1MMBA 3KWVC 3HBUP 2DDYA 2X7MA 5BOTA 4IUWA 3DWBA 3KRYA 1AYKA 1YQYA 3O64A 2D1OA 4PKWA 1UTTA 4DPEA 1O0TA 1SRPA 1KUGA 1OM7A 3L0VA 1ZXVA 1UMSA 1XFVA 3KHIA 2N8RA 1ASTA 5D2BA 2OXUA 1K7GA 3F1AA 5B5PA 5I0LA 4H76A 3TVCA 4WK7A 1D5JA 2OXWA 1JAPA 4IJOA 1K7QA 3V96B 1RM8A 4GWMA 3WV1A 1HY7A 2PJTA 4FVLA 1R1IA 1UEAA 5CXAA 4WKEA 4J4MA 4PKSA 3Q2GA 2AIGP 2SRTA 1HFSA 2OXZA 5H8XA 2TCLA 4AYKA 2ERPA 1AF0A 4ZR5A 3EDIA 1QJIA 3HDBA 3EWJA 4XM8A 3LILA 2OZRA 1BQOA 2E3XA 3BA0A 4I35A 3HY9A 830CA 1JKYA 3TS4A 4H1QA 1XFUA 1XUCA 4I03A 1C7KA 4GR0A 3ZVSA 1CIZA 3G5CA 4FU4A 966CA 3VTGA 3WV3A 2W14A 4HX3A 3EDZA 2O36A 1KUKA 2OW2A 5L79A 3CKIA 1FBLA 2FV5A 1OM8A 2X3AA 2OVXA 4XBHA 1JANA 1CGLA 3ELMA 4WF6A 1Q3AA 4JP4A 4H30A 1C3IA 4AUOA 1ZXCA 1QUAA 5BPAA 2I47A 1IAEA 3RTSA 5L7FA 1SU3A 3EDHA 3K7NA 1JIWP 5I12A 4PKRA 1ROSA 3HYGA 2K9CA 3LUNA 1JJ9A 1UTZA 1GKDA 1YCMA 1L6JA 4A3WA 1R1HA 1BKCA 4AXQA 2HU6A 1YOUA 1QICA 1OMJA 1BZSA 3I7GA 4H84A 4DD8A 1UMTA 5D7WA 1O0QA 1BUDA 4GUYA 1C8TA 3EHYA 1GE7A 2Y6DA 1IAAA 3KEKA 1Y93A 3L0TA 3SHIA 1QIBA 3N2VA 4PKTA 4ON1A
chains in the Genus database with same CATH superfamily
2J0TA 1MMQA 3DPFA 1ATLA 4GR8A 3ZUKA 1D8MA 1G49A 3LJGA 4WZVA 2YB9A 3TSKA 1H71P 4GWNA 1YP1A 1D7XA 1J7NA 3HDAP 1DTHA 1KBCA 2AYKA 4PKQA 3F17A 1R55A 4G0DA 1BKCE 4JPAA 1AKLA 2POJA 4XM7A 3KECA 4JQGA 2KRJA 3DSLA 3P1VA 4PKVA 2X3CA 1USNA 1PWQA 1R1JA 3KMEA 1OS9A 1PWUA 1ZTQA 5I4OA 4L19A 1FM1A 1I73A 1R54A 5D1TA 1K7IA 3AYKA 1XM5A 2ERQA 4R3VA 3OHLA 1HFCA 2OVZA 1CK7A 2V4BA 3GBOA 3LKAA 1I1IP 2L0RA 3B92A 4PKUA 4L7AA 3WV2A 2W15A 1G05A 3O2XA 4EFSA 3AIGA 3F15A 3F18A 5D1SA 3DTKA 1QJJA 3NX7A 1GO8P 1MMPA 1MMRA 3LQBA 2DW1A 3KEJA 3E8RA 3P24A 2MLSA 2CLTA 5LABA 1CXVA 1XFXA 3G42A 5I43A 2YIGA 1OZ9A 2MZIA 2OY4A 1MNCA 1PWVA 1D8FA 5CZMA 1G9KA 2DW0A 2WOAA 3DPEA 3AYUA 3B8ZA 4QKZA 1JIZA 5I3MA 1CGEA 1SATA 4ILWD 1B8YA 2A8HA 1SMPA 456CA 1HOVA 1CQRA 4FXQA 1JAQA 3HB2P 5BOYA 3LMCA 1BUVM 1IABA 1SLMA 3HY7A 4DV8A 3USNA 1OS2A 3DNGA 3LGPA 2O3EA 3HBVP 1CGFA 2JSDA 3I7IA 4JA1A 3Q2HA 1CAQA 2QPJA 3EDGA 3VI1A 1ZS0A 3OHOA 1HTDA 1GKCA 4XCTA 3LQ0A 1EB6A 3TT4A 2MZEA 1FLSA 2D1NA 1B3DA 1XURA 2JT6A 3U1RA 5I2ZA 1KUHA 1Y8JA 1BM6A 1GE5A 1OM6A 4H49A 1RMZA 4AIGA 1OO9A 2W12A 1G4KA 3LK8A 4H2EA 4H82A 3DL1A 1G12A 2DW2A 1XFWA 1KAPP 3N2UA 5D1UA 1ZP5A 2W13A 4GQLA 1XUDA 3KMCA 4WKIA 2J83A 3UVCA 1IACA 5JMYA 1BKCI 3B2ZA 3LJZA 3LUMA 2MLRA 2WO8A 1ND1A 2RJPA 2USNA 2OW9A 1SLNA 2JIHA 2OW1A 4DF9A 1BSWA 4A7BA 3ZXHA 3F19A 4XM6A 1GO7P 1JH1A 4IN9A 4CTHA 4G9LA 1A86A 3LIKA 1Z3JA 4GR3A 3RTTA 3LIRA 4L63A 2EROA 2RJQA 1I76A 3EHXA 3LEAA 1XAXA 1ZVXA 2XS3A 1QIAA 1DMTA 1BQQM 3LJTA 2XS4A 1GXDA 2Y6CA 1PWPA 3F16A 1IAGA 1JK3A 2MZHA 3LE9A 2E2DA 2FV9A 2WO9A 5CUHA 1KUFA 1A85A 4L6TA 1IADA 2K2GA 2OY2A 1Y0VA 1BIWA 1S4BP 2OW0A 1XFZA 2OI0A 5D3CA 2X3BA 2JT5A 3MA2A 1KUIA 4GF1A 1EUBA 2DDFA 2CKIA 2Z2DA 4Q1LA 1GE6A 4H3XA 1JAOA 1WNIA 2JNPA 1PWWA 4FXYP 2W0DA 4JIJA 3K7LA 4HMAA 1HV5A 1XFYA 5B5OA 1EAKA 1MMBA 3KWVC 3HBUP 2DDYA 2X7MA 5BOTA 4IUWA 3DWBA 3KRYA 1AYKA 1YQYA 3O64A 2D1OA 4PKWA 1UTTA 4DPEA 1O0TA 1SRPA 1KUGA 1OM7A 3L0VA 1TVIA 1ZXVA 1UMSA 1XFVA 3KHIA 2N8RA 1ASTA 5D2BA 2OXUA 1K7GA 3F1AA 5B5PA 5I0LA 4H76A 3TVCA 4WK7A 1D5JA 2OXWA 1JAPA 4IJOA 1K7QA 3V96B 1RM8A 4GWMA 3WV1A 1HY7A 2PJTA 4FVLA 1R1IA 1UEAA 5CXAA 4WKEA 4J4MA 4PKSA 3Q2GA 2AIGP 2SRTA 1HFSA 2OXZA 5H8XA 2TCLA 4AYKA 2ERPA 2YUFA 1AF0A 4ZR5A 3EDIA 1QJIA 3HDBA 3EWJA 4XM8A 3LILA 2OZRA 1BQOA 2E3XA 3BA0A 4I35A 3HY9A 830CA 1JKYA 3TS4A 4H1QA 1XFUA 1XUCA 4I03A 1C7KA 4GR0A 3ZVSA 1CIZA 3DTEA 3G5CA 4FU4A 966CA 3VTGA 3WV3A 2W14A 4HX3A 3EDZA 2O36A 1KUKA 2OW2A 5L79A 3CKIA 1FBLA 2FV5A 1OM8A 2X3AA 2OVXA 4XBHA 1JANA 1CGLA 3ELMA 4WF6A 1Q3AA 4JP4A 4H30A 1C3IA 4AUOA 1ZXCA 1QUAA 5BPAA 2I47A 1IAEA 3RTSA 5L7FA 1SU3A 3EDHA 3K7NA 1JIWP 5I12A 4PKRA 1ROSA 3HYGA 2K9CA 3LUNA 1JJ9A 1UTZA 1GKDA 1YCMA 1L6JA 4A3WA 1R1HA 1BKCA 4AXQA 2HU6A 1YOUA 1QICA 1OMJA 1BZSA 3I7GA 4H84A 4DD8A 1UMTA 5D7WA 1O0QA 1BUDA 4GUYA 1C8TA 3EHYA 1GE7A 2Y6DA 1IAAA 3KEKA 1Y93A 3DTIA 3L0TA 3SHIA 1QIBA 3N2VA 4PKTA 4ON1A
chains in the Genus database with same CATH topology
2J0TA 1MMQA 3DPFA 1ATLA 4GR8A 3ZUKA 1D8MA 1G49A 3LJGA 4WZVA 2YB9A 3TSKA 1H71P 4GWNA 1YP1A 1D7XA 1J7NA 3HDAP 1DTHA 1KBCA 2AYKA 4PKQA 3F17A 1R55A 4G0DA 1BKCE 4JPAA 1AKLA 2POJA 4XM7A 3KECA 4JQGA 2KRJA 3DSLA 3P1VA 4PKVA 2X3CA 1USNA 1PWQA 1R1JA 3KMEA 1OS9A 1PWUA 1ZTQA 5I4OA 4L19A 1FM1A 1I73A 1R54A 5D1TA 1K7IA 3AYKA 2ERQA 4R3VA 3OHLA 1HFCA 2OVZA 1CK7A 2V4BA 3GBOA 3LKAA 1I1IP 2L0RA 3B92A 4PKUA 4L7AA 3WV2A 2W15A 1G05A 3O2XA 4EFSA 3AIGA 3F15A 3F18A 5D1SA 3DTKA 1QJJA 3NX7A 1GO8P 1MMPA 1MMRA 3LQBA 2DW1A 3KEJA 3E8RA 3P24A 2MLSA 2CLTA 5LABA 1CXVA 1XFXA 3G42A 5I43A 2YIGA 2MZIA 2OY4A 1MNCA 1PWVA 1D8FA 5CZMA 1G9KA 2DW0A 2WOAA 3DPEA 3AYUA 3B8ZA 4QKZA 1JIZA 5I3MA 1CGEA 1SATA 4ILWD 1B8YA 2A8HA 1SMPA 456CA 1HOVA 1CQRA 4FXQA 1JAQA 3HB2P 5BOYA 3LMCA 1BUVM 1IABA 1SLMA 3HY7A 4DV8A 3USNA 1OS2A 3DNGA 3LGPA 2O3EA 3HBVP 1CGFA 2JSDA 3I7IA 4JA1A 3Q2HA 1CAQA 2QPJA 3EDGA 3VI1A 1ZS0A 3OHOA 1HTDA 1GKCA 4XCTA 3LQ0A 1EB6A 3TT4A 2MZEA 1FLSA 2D1NA 1B3DA 1XURA 2JT6A 3U1RA 5I2ZA 1KUHA 1Y8JA 1BM6A 1GE5A 1OM6A 4H49A 1RMZA 4AIGA 1OO9A 2W12A 1G4KA 3LK8A 4H2EA 4H82A 3DL1A 1G12A 2DW2A 1XFWA 1KAPP 3N2UA 5D1UA 1ZP5A 2W13A 4GQLA 1XUDA 3KMCA 4WKIA 2J83A 3UVCA 1IACA 5JMYA 1BKCI 3B2ZA 3LJZA 3LUMA 2MLRA 2WO8A 1ND1A 2RJPA 2USNA 2OW9A 1SLNA 2JIHA 2OW1A 4DF9A 1BSWA 4A7BA 3ZXHA 3F19A 4XM6A 1GO7P 1JH1A 4IN9A 4CTHA 4G9LA 1A86A 3LIKA 1Z3JA 4GR3A 3RTTA 3LIRA 4L63A 2EROA 2RJQA 1I76A 3EHXA 3LEAA 1ZVXA 2XS3A 1QIAA 1DMTA 1BQQM 3LJTA 2XS4A 1GXDA 2Y6CA 1PWPA 3F16A 1IAGA 1JK3A 2MZHA 3LE9A 2E2DA 2FV9A 2WO9A 5CUHA 1KUFA 1A85A 4L6TA 1IADA 2K2GA 2OY2A 1Y0VA 1BIWA 1S4BP 2OW0A 1XFZA 2OI0A 5D3CA 2X3BA 2JT5A 3MA2A 1KUIA 4GF1A 1EUBA 2DDFA 2CKIA 2Z2DA 4Q1LA 1GE6A 4H3XA 1JAOA 1WNIA 2JNPA 1PWWA 4FXYP 2W0DA 4JIJA 3K7LA 4HMAA 1HV5A 1XFYA 5B5OA 1EAKA 1MMBA 3KWVC 3HBUP 2DDYA 2X7MA 5BOTA 4IUWA 3DWBA 3KRYA 1AYKA 1YQYA 3O64A 2D1OA 4PKWA 1UTTA 4DPEA 1O0TA 1SRPA 1KUGA 1OM7A 3L0VA 1ZXVA 1UMSA 1XFVA 3KHIA 2N8RA 1ASTA 5D2BA 2OXUA 1K7GA 3F1AA 5B5PA 5I0LA 4H76A 3TVCA 4WK7A 1D5JA 2OXWA 1JAPA 4IJOA 1K7QA 3V96B 1RM8A 4GWMA 3WV1A 1HY7A 2PJTA 4FVLA 1R1IA 1UEAA 5CXAA 4WKEA 4J4MA 4PKSA 3Q2GA 2AIGP 2SRTA 1HFSA 2OXZA 5H8XA 2TCLA 4AYKA 2ERPA 2YUFA 1AF0A 4ZR5A 3EDIA 1QJIA 3HDBA 3EWJA 4XM8A 3LILA 2OZRA 1BQOA 2E3XA 3BA0A 4I35A 3HY9A 830CA 1JKYA 3TS4A 4H1QA 1XFUA 1XUCA 4I03A 1C7KA 4GR0A 3ZVSA 1CIZA 3DTEA 3G5CA 4FU4A 966CA 3VTGA 3WV3A 2W14A 4HX3A 3EDZA 2O36A 1KUKA 2OW2A 5L79A 3CKIA 1FBLA 2FV5A 1OM8A 2X3AA 2OVXA 4XBHA 1JANA 1CGLA 3ELMA 4WF6A 1Q3AA 4JP4A 4H30A 1C3IA 4AUOA 1ZXCA 1QUAA 5BPAA 2I47A 1IAEA 3RTSA 5L7FA 1SU3A 3EDHA 3K7NA 1JIWP 5I12A 4PKRA 1ROSA 3HYGA 2K9CA 3LUNA 1JJ9A 1UTZA 1GKDA 1YCMA 1L6JA 4A3WA 1R1HA 1BKCA 4AXQA 2HU6A 1YOUA 1QICA 1OMJA 1BZSA 3I7GA 4H84A 4DD8A 1UMTA 5D7WA 1O0QA 1BUDA 4GUYA 1C8TA 3EHYA 1GE7A 2Y6DA 1IAAA 3KEKA 1Y93A 3DTIA 3L0TA 3SHIA 1QIBA 3N2VA 4PKTA 4ON1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0T A;  1MMQ A;  3DPF A;  1ATL A;  4GR8 A;  3ZUK A;  1D8M A;  1G49 A;  3LJG A;  4WZV A;  2YB9 A;  3TSK A;  1H71 P;  4GWN A;  1YP1 A;  1D7X A;  1J7N A;  3HDA P;  1DTH A;  1KBC A;  2AYK A;  4PKQ A;  3F17 A;  1R55 A;  4G0D A;  1BKC E;  4JPA A;  1AKL A;  2POJ A;  4XM7 A;  3KEC A;  4JQG A;  2KRJ A;  3DSL A;  3P1V A;  4PKV A;  2X3C A;  1USN A;  1PWQ A;  1R1J A;  3KME A;  1OS9 A;  1PWU A;  1ZTQ A;  5I4O A;  4L19 A;  1FM1 A;  1I73 A;  1R54 A;  5D1T A;  1K7I A;  3AYK A;  2ERQ A;  4R3V A;  3OHL A;  1HFC A;  2OVZ A;  1CK7 A;  2V4B A;  3GBO A;  3LKA A;  1I1I P;  2L0R A;  3B92 A;  4PKU A;  3WV2 A;  2W15 A;  1G05 A;  3O2X A;  4EFS A;  3AIG A;  3F15 A;  3F18 A;  5D1S A;  1QJJ A;  3NX7 A;  1GO8 P;  1MMP A;  1MMR A;  3LQB A;  2DW1 A;  3KEJ A;  3E8R A;  3P24 A;  2MLS A;  2CLT A;  5LAB A;  1CXV A;  1XFX A;  3G42 A;  5I43 A;  2YIG A;  2MZI A;  2OY4 A;  1MNC A;  1PWV A;  1D8F A;  5CZM A;  1G9K A;  2DW0 A;  2WOA A;  3DPE A;  3AYU A;  3B8Z A;  4QKZ A;  1JIZ A;  5I3M A;  1CGE A;  1SAT A;  4ILW D;  1B8Y A;  2A8H A;  1SMP A;  456C A;  1HOV A;  1CQR A;  4FXQ A;  1JAQ A;  3HB2 P;  5BOY A;  3LMC A;  1BUV M;  1IAB A;  1SLM A;  3HY7 A;  4DV8 A;  3USN A;  1OS2 A;  3DNG A;  3LGP A;  2O3E A;  3HBV P;  1CGF A;  2JSD A;  3I7I A;  4JA1 A;  3Q2H A;  1CAQ A;  2QPJ A;  3EDG A;  3VI1 A;  1ZS0 A;  3OHO A;  1HTD A;  1GKC A;  4XCT A;  3LQ0 A;  1EB6 A;  3TT4 A;  2MZE A;  1FLS A;  2D1N A;  1B3D A;  1XUR A;  2JT6 A;  3U1R A;  5I2Z A;  1KUH A;  1Y8J A;  1BM6 A;  1GE5 A;  1OM6 A;  4H49 A;  1RMZ A;  4AIG A;  1OO9 A;  2W12 A;  1G4K A;  3LK8 A;  4H2E A;  4H82 A;  3DL1 A;  1G12 A;  2DW2 A;  1XFW A;  1KAP P;  3N2U A;  5D1U A;  1ZP5 A;  2W13 A;  4GQL A;  1XUD A;  3KMC A;  4WKI A;  2J83 A;  3UVC A;  1IAC A;  5JMY A;  1BKC I;  3B2Z A;  3LJZ A;  3LUM A;  2MLR A;  2WO8 A;  1ND1 A;  2RJP A;  2USN A;  2OW9 A;  1SLN A;  2JIH A;  2OW1 A;  4DF9 A;  1BSW A;  4A7B A;  3ZXH A;  3F19 A;  4XM6 A;  1GO7 P;  1JH1 A;  4IN9 A;  4CTH A;  4G9L A;  1A86 A;  3LIK A;  1Z3J A;  4GR3 A;  3RTT A;  3LIR A;  4L63 A;  2ERO A;  2RJQ A;  1I76 A;  3EHX A;  3LEA A;  1ZVX A;  2XS3 A;  1QIA A;  1DMT A;  1BQQ M;  3LJT A;  2XS4 A;  1GXD A;  2Y6C A;  1PWP A;  3F16 A;  1IAG A;  1JK3 A;  2MZH A;  3LE9 A;  2E2D A;  2FV9 A;  2WO9 A;  5CUH A;  1KUF A;  1A85 A;  4L6T A;  1IAD A;  2K2G A;  2OY2 A;  1Y0V A;  1BIW A;  1S4B P;  2OW0 A;  1XFZ A;  2OI0 A;  5D3C A;  2X3B A;  2JT5 A;  3MA2 A;  1KUI A;  4GF1 A;  1EUB A;  2DDF A;  2CKI A;  2Z2D A;  4Q1L A;  1GE6 A;  4H3X A;  1JAO A;  1WNI A;  2JNP A;  1PWW A;  4FXY P;  2W0D A;  4JIJ A;  3K7L A;  4HMA A;  1HV5 A;  1XFY A;  5B5O A;  1EAK A;  1MMB A;  3KWV C;  3HBU P;  2DDY A;  2X7M A;  5BOT A;  4IUW A;  3DWB A;  3KRY A;  1AYK A;  1YQY A;  3O64 A;  2D1O A;  4PKW A;  1UTT A;  4DPE A;  1O0T A;  1SRP A;  1KUG A;  1OM7 A;  3L0V A;  1ZXV A;  1UMS A;  1XFV A;  3KHI A;  2N8R A;  1AST A;  5D2B A;  2OXU A;  1K7G A;  3F1A A;  5B5P A;  5I0L A;  4H76 A;  3TVC A;  4WK7 A;  1D5J A;  2OXW A;  1JAP A;  4IJO A;  1K7Q A;  3V96 B;  1RM8 A;  4GWM A;  3WV1 A;  1HY7 A;  2PJT A;  4FVL A;  1R1I A;  1UEA A;  5CXA A;  4WKE A;  4J4M A;  4PKS A;  3Q2G A;  2AIG P;  2SRT A;  1HFS A;  2OXZ A;  5H8X A;  2TCL A;  4AYK A;  2ERP A;  1AF0 A;  4ZR5 A;  3EDI A;  1QJI A;  3HDB A;  3EWJ A;  4XM8 A;  3LIL A;  2OZR A;  1BQO A;  2E3X A;  3BA0 A;  4I35 A;  3HY9 A;  830C A;  1JKY A;  3TS4 A;  4H1Q A;  1XFU A;  1XUC A;  4I03 A;  1C7K A;  4GR0 A;  3ZVS A;  1CIZ A;  3G5C A;  4FU4 A;  966C A;  3VTG A;  3WV3 A;  2W14 A;  4HX3 A;  3EDZ A;  2O36 A;  1KUK A;  2OW2 A;  5L79 A;  3CKI A;  1FBL A;  2FV5 A;  1OM8 A;  2X3A A;  2OVX A;  4XBH A;  1JAN A;  1CGL A;  3ELM A;  4WF6 A;  1Q3A A;  4JP4 A;  4H30 A;  1C3I A;  4AUO A;  1ZXC A;  1QUA A;  5BPA A;  2I47 A;  1IAE A;  3RTS A;  5L7F A;  1SU3 A;  3EDH A;  3K7N A;  1JIW P;  5I12 A;  4PKR A;  1ROS A;  3HYG A;  2K9C A;  3LUN A;  1JJ9 A;  1UTZ A;  1GKD A;  1YCM A;  1L6J A;  4A3W A;  1R1H A;  1BKC A;  4AXQ A;  2HU6 A;  1YOU A;  1QIC A;  1OMJ A;  1BZS A;  3I7G A;  4H84 A;  4DD8 A;  1UMT A;  5D7W A;  1O0Q A;  1BUD A;  4GUY A;  1C8T A;  3EHY A;  1GE7 A;  2Y6D A;  1IAA A;  3KEK A;  1Y93 A;  3L0T A;  3SHI A;  1QIB A;  3N2V A;  4PKT A;  4ON1 A; 
#chains in the Genus database with same CATH topology
 2J0T A;  1MMQ A;  3DPF A;  1ATL A;  4GR8 A;  3ZUK A;  1D8M A;  1G49 A;  3LJG A;  4WZV A;  2YB9 A;  3TSK A;  1H71 P;  4GWN A;  1YP1 A;  1D7X A;  1J7N A;  3HDA P;  1DTH A;  1KBC A;  2AYK A;  4PKQ A;  3F17 A;  1R55 A;  4G0D A;  1BKC E;  4JPA A;  1AKL A;  2POJ A;  4XM7 A;  3KEC A;  4JQG A;  2KRJ A;  3DSL A;  3P1V A;  4PKV A;  2X3C A;  1USN A;  1PWQ A;  1R1J A;  3KME A;  1OS9 A;  1PWU A;  1ZTQ A;  5I4O A;  4L19 A;  1FM1 A;  1I73 A;  1R54 A;  5D1T A;  1K7I A;  3AYK A;  1XM5 A;  2ERQ A;  4R3V A;  3OHL A;  1HFC A;  2OVZ A;  1CK7 A;  2V4B A;  3GBO A;  3LKA A;  1I1I P;  2L0R A;  3B92 A;  4PKU A;  4L7A A;  3WV2 A;  2W15 A;  1G05 A;  3O2X A;  4EFS A;  3AIG A;  3F15 A;  3F18 A;  5D1S A;  3DTK A;  1QJJ A;  3NX7 A;  1GO8 P;  1MMP A;  1MMR A;  3LQB A;  2DW1 A;  3KEJ A;  3E8R A;  3P24 A;  2MLS A;  2CLT A;  5LAB A;  1CXV A;  1XFX A;  3G42 A;  5I43 A;  2YIG A;  1OZ9 A;  2MZI A;  2OY4 A;  1MNC A;  1PWV A;  1D8F A;  5CZM A;  1G9K A;  2DW0 A;  2WOA A;  3DPE A;  3AYU A;  3B8Z A;  4QKZ A;  1JIZ A;  5I3M A;  1CGE A;  1SAT A;  4ILW D;  1B8Y A;  2A8H A;  1SMP A;  456C A;  1HOV A;  1CQR A;  4FXQ A;  1JAQ A;  3HB2 P;  5BOY A;  3LMC A;  1BUV M;  1IAB A;  1SLM A;  3HY7 A;  4DV8 A;  3USN A;  1OS2 A;  3DNG A;  3LGP A;  2O3E A;  3HBV P;  1CGF A;  2JSD A;  3I7I A;  4JA1 A;  3Q2H A;  1CAQ A;  2QPJ A;  3EDG A;  3VI1 A;  1ZS0 A;  3OHO A;  1HTD A;  1GKC A;  4XCT A;  3LQ0 A;  1EB6 A;  3TT4 A;  2MZE A;  1FLS A;  2D1N A;  1B3D A;  1XUR A;  2JT6 A;  3U1R A;  5I2Z A;  1KUH A;  1Y8J A;  1BM6 A;  1GE5 A;  1OM6 A;  4H49 A;  1RMZ A;  4AIG A;  1OO9 A;  2W12 A;  1G4K A;  3LK8 A;  4H2E A;  4H82 A;  3DL1 A;  1G12 A;  2DW2 A;  1XFW A;  1KAP P;  3N2U A;  5D1U A;  1ZP5 A;  2W13 A;  4GQL A;  1XUD A;  3KMC A;  4WKI A;  2J83 A;  3UVC A;  1IAC A;  5JMY A;  1BKC I;  3B2Z A;  3LJZ A;  3LUM A;  2MLR A;  2WO8 A;  1ND1 A;  2RJP A;  2USN A;  2OW9 A;  1SLN A;  2JIH A;  2OW1 A;  4DF9 A;  1BSW A;  4A7B A;  3ZXH A;  3F19 A;  4XM6 A;  1GO7 P;  1JH1 A;  4IN9 A;  4CTH A;  4G9L A;  1A86 A;  3LIK A;  1Z3J A;  4GR3 A;  3RTT A;  3LIR A;  4L63 A;  2ERO A;  2RJQ A;  1I76 A;  3EHX A;  3LEA A;  1XAX A;  1ZVX A;  2XS3 A;  1QIA A;  1DMT A;  1BQQ M;  3LJT A;  2XS4 A;  1GXD A;  2Y6C A;  1PWP A;  3F16 A;  1IAG A;  1JK3 A;  2MZH A;  3LE9 A;  2E2D A;  2FV9 A;  2WO9 A;  5CUH A;  1KUF A;  1A85 A;  4L6T A;  1IAD A;  2K2G A;  2OY2 A;  1Y0V A;  1BIW A;  1S4B P;  2OW0 A;  1XFZ A;  2OI0 A;  5D3C A;  2X3B A;  2JT5 A;  3MA2 A;  1KUI A;  4GF1 A;  1EUB A;  2DDF A;  2CKI A;  2Z2D A;  4Q1L A;  1GE6 A;  4H3X A;  1JAO A;  1WNI A;  2JNP A;  1PWW A;  4FXY P;  2W0D A;  4JIJ A;  3K7L A;  4HMA A;  1HV5 A;  1XFY A;  5B5O A;  1EAK A;  1MMB A;  3KWV C;  3HBU P;  2DDY A;  2X7M A;  5BOT A;  4IUW A;  3DWB A;  3KRY A;  1AYK A;  1YQY A;  3O64 A;  2D1O A;  4PKW A;  1UTT A;  4DPE A;  1O0T A;  1SRP A;  1KUG A;  1OM7 A;  3L0V A;  1TVI A;  1ZXV A;  1UMS A;  1XFV A;  3KHI A;  2N8R A;  1AST A;  5D2B A;  2OXU A;  1K7G A;  3F1A A;  5B5P A;  5I0L A;  4H76 A;  3TVC A;  4WK7 A;  1D5J A;  2OXW A;  1JAP A;  4IJO A;  1K7Q A;  3V96 B;  1RM8 A;  4GWM A;  3WV1 A;  1HY7 A;  2PJT A;  4FVL A;  1R1I A;  1UEA A;  5CXA A;  4WKE A;  4J4M A;  4PKS A;  3Q2G A;  2AIG P;  2SRT A;  1HFS A;  2OXZ A;  5H8X A;  2TCL A;  4AYK A;  2ERP A;  2YUF A;  1AF0 A;  4ZR5 A;  3EDI A;  1QJI A;  3HDB A;  3EWJ A;  4XM8 A;  3LIL A;  2OZR A;  1BQO A;  2E3X A;  3BA0 A;  4I35 A;  3HY9 A;  830C A;  1JKY A;  3TS4 A;  4H1Q A;  1XFU A;  1XUC A;  4I03 A;  1C7K A;  4GR0 A;  3ZVS A;  1CIZ A;  3DTE A;  3G5C A;  4FU4 A;  966C A;  3VTG A;  3WV3 A;  2W14 A;  4HX3 A;  3EDZ A;  2O36 A;  1KUK A;  2OW2 A;  5L79 A;  3CKI A;  1FBL A;  2FV5 A;  1OM8 A;  2X3A A;  2OVX A;  4XBH A;  1JAN A;  1CGL A;  3ELM A;  4WF6 A;  1Q3A A;  4JP4 A;  4H30 A;  1C3I A;  4AUO A;  1ZXC A;  1QUA A;  5BPA A;  2I47 A;  1IAE A;  3RTS A;  5L7F A;  1SU3 A;  3EDH A;  3K7N A;  1JIW P;  5I12 A;  4PKR A;  1ROS A;  3HYG A;  2K9C A;  3LUN A;  1JJ9 A;  1UTZ A;  1GKD A;  1YCM A;  1L6J A;  4A3W A;  1R1H A;  1BKC A;  4AXQ A;  2HU6 A;  1YOU A;  1QIC A;  1OMJ A;  1BZS A;  3I7G A;  4H84 A;  4DD8 A;  1UMT A;  5D7W A;  1O0Q A;  1BUD A;  4GUY A;  1C8T A;  3EHY A;  1GE7 A;  2Y6D A;  1IAA A;  3KEK A;  1Y93 A;  3DTI A;  3L0T A;  3SHI A;  1QIB A;  3N2V A;  4PKT A;  4ON1 A; 
#chains in the Genus database with same CATH homology
 2J0T A;  1MMQ A;  3DPF A;  1ATL A;  4GR8 A;  3ZUK A;  1D8M A;  1G49 A;  3LJG A;  4WZV A;  2YB9 A;  3TSK A;  1H71 P;  4GWN A;  1YP1 A;  1D7X A;  1J7N A;  3HDA P;  1DTH A;  1KBC A;  2AYK A;  4PKQ A;  3F17 A;  1R55 A;  4G0D A;  1BKC E;  4JPA A;  1AKL A;  2POJ A;  4XM7 A;  3KEC A;  4JQG A;  2KRJ A;  3DSL A;  3P1V A;  4PKV A;  2X3C A;  1USN A;  1PWQ A;  1R1J A;  3KME A;  1OS9 A;  1PWU A;  1ZTQ A;  5I4O A;  4L19 A;  1FM1 A;  1I73 A;  1R54 A;  5D1T A;  1K7I A;  3AYK A;  2ERQ A;  4R3V A;  3OHL A;  1HFC A;  2OVZ A;  1CK7 A;  2V4B A;  3GBO A;  3LKA A;  1I1I P;  2L0R A;  3B92 A;  4PKU A;  4L7A A;  3WV2 A;  2W15 A;  1G05 A;  3O2X A;  4EFS A;  3AIG A;  3F15 A;  3F18 A;  5D1S A;  3DTK A;  1QJJ A;  3NX7 A;  1GO8 P;  1MMP A;  1MMR A;  3LQB A;  2DW1 A;  3KEJ A;  3E8R A;  3P24 A;  2MLS A;  2CLT A;  5LAB A;  1CXV A;  1XFX A;  3G42 A;  5I43 A;  2YIG A;  2MZI A;  2OY4 A;  1MNC A;  1PWV A;  1D8F A;  5CZM A;  1G9K A;  2DW0 A;  2WOA A;  3DPE A;  3AYU A;  3B8Z A;  4QKZ A;  1JIZ A;  5I3M A;  1CGE A;  1SAT A;  4ILW D;  1B8Y A;  2A8H A;  1SMP A;  456C A;  1HOV A;  1CQR A;  4FXQ A;  1JAQ A;  3HB2 P;  5BOY A;  3LMC A;  1BUV M;  1IAB A;  1SLM A;  3HY7 A;  4DV8 A;  3USN A;  1OS2 A;  3DNG A;  3LGP A;  2O3E A;  3HBV P;  1CGF A;  2JSD A;  3I7I A;  4JA1 A;  3Q2H A;  1CAQ A;  2QPJ A;  3EDG A;  3VI1 A;  1ZS0 A;  3OHO A;  1HTD A;  1GKC A;  4XCT A;  3LQ0 A;  1EB6 A;  3TT4 A;  2MZE A;  1FLS A;  2D1N A;  1B3D A;  1XUR A;  2JT6 A;  3U1R A;  5I2Z A;  1KUH A;  1Y8J A;  1BM6 A;  1GE5 A;  1OM6 A;  4H49 A;  1RMZ A;  4AIG A;  1OO9 A;  2W12 A;  1G4K A;  3LK8 A;  4H2E A;  4H82 A;  3DL1 A;  1G12 A;  2DW2 A;  1XFW A;  1KAP P;  3N2U A;  5D1U A;  1ZP5 A;  2W13 A;  4GQL A;  1XUD A;  3KMC A;  4WKI A;  2J83 A;  3UVC A;  1IAC A;  5JMY A;  1BKC I;  3B2Z A;  3LJZ A;  3LUM A;  2MLR A;  2WO8 A;  1ND1 A;  2RJP A;  2USN A;  2OW9 A;  1SLN A;  2JIH A;  2OW1 A;  4DF9 A;  1BSW A;  4A7B A;  3ZXH A;  3F19 A;  4XM6 A;  1GO7 P;  1JH1 A;  4IN9 A;  4CTH A;  4G9L A;  1A86 A;  3LIK A;  1Z3J A;  4GR3 A;  3RTT A;  3LIR A;  4L63 A;  2ERO A;  2RJQ A;  1I76 A;  3EHX A;  3LEA A;  1ZVX A;  2XS3 A;  1QIA A;  1DMT A;  1BQQ M;  3LJT A;  2XS4 A;  1GXD A;  2Y6C A;  1PWP A;  3F16 A;  1IAG A;  1JK3 A;  2MZH A;  3LE9 A;  2E2D A;  2FV9 A;  2WO9 A;  5CUH A;  1KUF A;  1A85 A;  4L6T A;  1IAD A;  2K2G A;  2OY2 A;  1Y0V A;  1BIW A;  1S4B P;  2OW0 A;  1XFZ A;  2OI0 A;  5D3C A;  2X3B A;  2JT5 A;  3MA2 A;  1KUI A;  4GF1 A;  1EUB A;  2DDF A;  2CKI A;  2Z2D A;  4Q1L A;  1GE6 A;  4H3X A;  1JAO A;  1WNI A;  2JNP A;  1PWW A;  4FXY P;  2W0D A;  4JIJ A;  3K7L A;  4HMA A;  1HV5 A;  1XFY A;  5B5O A;  1EAK A;  1MMB A;  3KWV C;  3HBU P;  2DDY A;  2X7M A;  5BOT A;  4IUW A;  3DWB A;  3KRY A;  1AYK A;  1YQY A;  3O64 A;  2D1O A;  4PKW A;  1UTT A;  4DPE A;  1O0T A;  1SRP A;  1KUG A;  1OM7 A;  3L0V A;  1ZXV A;  1UMS A;  1XFV A;  3KHI A;  2N8R A;  1AST A;  5D2B A;  2OXU A;  1K7G A;  3F1A A;  5B5P A;  5I0L A;  4H76 A;  3TVC A;  4WK7 A;  1D5J A;  2OXW A;  1JAP A;  4IJO A;  1K7Q A;  3V96 B;  1RM8 A;  4GWM A;  3WV1 A;  1HY7 A;  2PJT A;  4FVL A;  1R1I A;  1UEA A;  5CXA A;  4WKE A;  4J4M A;  4PKS A;  3Q2G A;  2AIG P;  2SRT A;  1HFS A;  2OXZ A;  5H8X A;  2TCL A;  4AYK A;  2ERP A;  2YUF A;  1AF0 A;  4ZR5 A;  3EDI A;  1QJI A;  3HDB A;  3EWJ A;  4XM8 A;  3LIL A;  2OZR A;  1BQO A;  2E3X A;  3BA0 A;  4I35 A;  3HY9 A;  830C A;  1JKY A;  3TS4 A;  4H1Q A;  1XFU A;  1XUC A;  4I03 A;  1C7K A;  4GR0 A;  3ZVS A;  1CIZ A;  3DTE A;  3G5C A;  4FU4 A;  966C A;  3VTG A;  3WV3 A;  2W14 A;  4HX3 A;  3EDZ A;  2O36 A;  1KUK A;  2OW2 A;  5L79 A;  3CKI A;  1FBL A;  2FV5 A;  1OM8 A;  2X3A A;  2OVX A;  4XBH A;  1JAN A;  1CGL A;  3ELM A;  4WF6 A;  1Q3A A;  4JP4 A;  4H30 A;  1C3I A;  4AUO A;  1ZXC A;  1QUA A;  5BPA A;  2I47 A;  1IAE A;  3RTS A;  5L7F A;  1SU3 A;  3EDH A;  3K7N A;  1JIW P;  5I12 A;  4PKR A;  1ROS A;  3HYG A;  2K9C A;  3LUN A;  1JJ9 A;  1UTZ A;  1GKD A;  1YCM A;  1L6J A;  4A3W A;  1R1H A;  1BKC A;  4AXQ A;  2HU6 A;  1YOU A;  1QIC A;  1OMJ A;  1BZS A;  3I7G A;  4H84 A;  4DD8 A;  1UMT A;  5D7W A;  1O0Q A;  1BUD A;  4GUY A;  1C8T A;  3EHY A;  1GE7 A;  2Y6D A;  1IAA A;  3KEK A;  1Y93 A;  3DTI A;  3L0T A;  3SHI A;  1QIB A;  3N2V A;  4PKT A;  4ON1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...