1OO9A

Orientation in solution of mmp-3 catalytic domain and n-timp-1 from residual dipolar couplings
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
168
structure length
168
Chain Sequence
b'FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromelysin-1
publication title Global Orientation of Bound MMP-3 and N-TIMP-1 in Solution via Residual Dipolar Couplings
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 168
sequence length 168
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1oo9A00
2Z2DA 3F19A 1CGLA 3OHOA 2DW1A 1C8TA 4GR0A 1O0QA 2JIHA 2OZRA 1CXVA 1FLSA 2OY2A 5BOTA 1PWQA 1YP1A 5BOYA 1DTHA 1JAOA 4XM6A 4H1QA 4ZR5A 3MA2A 4WKIA 1JJ9A 4I03A 4DV8A 4FXYP 4AUOA 3LKAA 2CLTA 2JNPA 3KMEA 2L0RA 1BKCA 5LABA 4J4MA 2AYKA 3L0TA 1GE7A 2FV9A 3AYUA 4FXQA 1BM6A 5CZMA 5I2ZA 2W13A 4H76A 2DDYA 1BQOA 4L19A 3DPFA 4JPAA 3U1RA 4A3WA 1PWPA 3ZXHA 1PWWA 3LE9A 2FV5A 1JKYA 2OW0A 4XBHA 1S4BP 4QKZA 2OXWA 3EHXA 2PJTA 1AYKA 1SU3A 3LJTA 2Y6DA 1R1HA 3GBOA 1QJIA 3F18A 1JANA 3AYKA 5B5PA 4GWMA 1D7XA 1UEAA 3KEKA 3BA0A 2X7MA 4JA1A 1G4KA 2O3EA 1UTZA 3G5CA 1BKCE 1IAAA 1I76A 1ZXCA 3LEAA 1ROSA 3DL1A 3K7NA 3RTTA 1FM1A 1HFCA 2XS3A 4WKEA 5D1UA 3KEJA 4A7BA 3E8RA 4HMAA 1SLNA 3O2XA 1ATLA 966CA 1OM8A 3WV1A 3TSKA 2A8HA 2QPJA 1BIWA 4WF6A 1KBCA 1SLMA 1BKCI 1BZSA 3KWVC 4GQLA 1AKLA 3DNGA 5I0LA 3VI1A 1UTTA 4ILWD 3DSLA 1K7IA 3B2ZA 2J83A 1EB6A 4IUWA 1SATA 2N8RA 3F15A 1IAGA 2X3BA 1XFXA 1OMJA 3KRYA 3N2UA 2WO9A 2OI0A 2Y6CA 4H49A 1JIWP 1Z3JA 4GUYA 1OM6A 5L7FA 4XM8A 1HTDA 1JH1A 2V4BA 4FVLA 3LMCA 4G0DA 3LQ0A 1XFUA 1AF0A 3EWJA 1QICA 4PKQA 5D1TA 4JP4A 3P24A 1MMRA 2RJPA 2EROA 3ZUKA 1XURA 1BQQM 3P1VA 2MLRA 1H71P 3F16A 2X3CA 456CA 1CAQA 1JAQA 1UMSA 3Q2HA 4PKUA 4EFSA 3TS4A 3DWBA 4GWNA 1D5JA 3LIKA 830CA 1I73A 2AIGP 2W14A 1UMTA 1XFVA 2HU6A 1OS9A 4Q1LA 1QUAA 2KRJA 1R55A 5I3MA 2K9CA 2MZEA 1CGEA 4PKWA 2K2GA 4JIJA 1OO9A 1JIZA 2YIGA 2E2DA 1I1IP 5JMYA 1GO8P 4L63A 1RM8A 2X3AA 5I43A 3I7GA 1D8FA 2JSDA 3HY7A 1WNIA 4FU4A 1R1JA 1XFYA 3LQBA 4H84A 1G05A 4GR8A 2POJA 1JK3A 4WZVA 1QIBA 1OS2A 3LGPA 3ZVSA 2OW1A 3HDBA 3LJGA 3AIGA 3G42A 1SMPA 1ZTQA 1EUBA 4H3XA 3LIRA 4IJOA 1CIZA 4AYKA 2YB9A 2RJQA 1YQYA 3KECA 3RTSA 1C3IA 5D7WA 2W0DA 1RMZA 2E3XA 1ND1A 1FBLA 1K7GA 2MZIA 1GXDA 1C7KA 4R3VA 5CUHA 3VTGA 1R1IA 1USNA 1L6JA 2MLSA 3NX7A 3F17A 3WV3A 2D1NA 1KUKA 1XUDA 4H82A 1HV5A 3KHIA 1GKDA 1B8YA 1O0TA 4DD8A 4G9LA 1PWUA 2MZHA 3LILA 1IAEA 2OW2A 1YOUA 3HY9A 2JT6A 3EHYA 2DDFA 1QIAA 3HDAP 1A85A 1GE6A 1IADA 2DW0A 1KUGA 5B5OA 1KUIA 2OVXA 4ON1A 4HX3A 1G49A 4GF1A 3CKIA 2W15A 2OXUA 1QJJA 1XFZA 3KMCA 1Y8JA 3EDHA 2ERPA 4JQGA 3B92A 1ZP5A 4PKVA 4XM7A 1GKCA 3I7IA 1Q3AA 5D1SA 3V96B 4DF9A 1JAPA 4WK7A 5BPAA 1HOVA 4H2EA 2SRTA 2WOAA 3K7LA 2W12A 2OY4A 3USNA 3ELMA 3LK8A 1MNCA 2OXZA 1YCMA 5I4OA 2WO8A 2DW2A 3EDGA 4PKSA 3HYGA 3TT4A 1HFSA 3EDIA 4I35A 1KUFA 1MMQA 2XS4A 1IABA 2OVZA 3F1AA 4IN9A 5L79A 4PKRA 4H30A 4AXQA 4L6TA 3SHIA 3OHLA 1BSWA 1GO7P 4XCTA 5I12A 1DMTA 4DPEA 1A86A 1CGFA 5D3CA 4AIGA 4PKTA 1Y93A 3HBVP 1B3DA 3DPEA 3EDZA 2I47A 4GR3A 5H8XA 2J0TA 5D2BA 3LJZA 3WV2A 1KAPP 2O36A 3LUNA 1K7QA 2CKIA 1R54A 1BUVM 1ASTA 1MMPA 1HY7A 1ZXVA 2D1OA 1OM7A 3O64A 1CQRA 1G12A 3B8ZA 1SRPA 1KUHA 1CK7A 5CXAA 2TCLA 3HBUP 3UVCA 1XFWA 1XUCA 1ZVXA 1D8MA 1J7NA 1MMBA 1Y0VA 3L0VA 1ZS0A 3TVCA 1GE5A 4CTHA 1BUDA 3Q2GA 2USNA 1G9KA 1EAKA 1IACA 2ERQA 1PWVA 2OW9A 2JT5A 3LUMA 3N2VA 3HB2P
chains in the Genus database with same CATH superfamily
2Z2DA 3F19A 1CGLA 3OHOA 2DW1A 1C8TA 4GR0A 1O0QA 2JIHA 2OZRA 1CXVA 1XAXA 1FLSA 2OY2A 5BOTA 1PWQA 1YP1A 5BOYA 1DTHA 1JAOA 4XM6A 4H1QA 4ZR5A 3MA2A 4WKIA 1JJ9A 4I03A 4DV8A 4FXYP 4AUOA 3LKAA 2CLTA 2JNPA 3KMEA 2L0RA 1BKCA 5LABA 4J4MA 2AYKA 3L0TA 1GE7A 2FV9A 3AYUA 4FXQA 1BM6A 5CZMA 5I2ZA 2W13A 4H76A 2DDYA 1BQOA 4L19A 3DPFA 4JPAA 3U1RA 4A3WA 1PWPA 3ZXHA 1PWWA 3LE9A 2FV5A 1JKYA 2OW0A 4XBHA 1S4BP 4QKZA 2OXWA 3EHXA 2PJTA 1AYKA 1SU3A 3LJTA 2Y6DA 1R1HA 3GBOA 1QJIA 3F18A 1JANA 3AYKA 5B5PA 4GWMA 1D7XA 1UEAA 3KEKA 3BA0A 2X7MA 4JA1A 1G4KA 2O3EA 1UTZA 3G5CA 1BKCE 1IAAA 1I76A 1ZXCA 3LEAA 1ROSA 3DL1A 3K7NA 3RTTA 1FM1A 1HFCA 2XS3A 4WKEA 5D1UA 3KEJA 4A7BA 3E8RA 4HMAA 1SLNA 3O2XA 1ATLA 966CA 1OM8A 3WV1A 3DTIA 3TSKA 2A8HA 2QPJA 1BIWA 4WF6A 1KBCA 1SLMA 1BKCI 1BZSA 3KWVC 4GQLA 1AKLA 3DNGA 5I0LA 3VI1A 1UTTA 4ILWD 3DSLA 1K7IA 3B2ZA 2J83A 1EB6A 4IUWA 1SATA 2N8RA 3F15A 1IAGA 2X3BA 1XFXA 1OMJA 3KRYA 3N2UA 2WO9A 2OI0A 2Y6CA 4H49A 1JIWP 1Z3JA 4GUYA 1OM6A 5L7FA 4XM8A 1HTDA 1JH1A 2V4BA 4FVLA 3LMCA 4G0DA 3LQ0A 4L7AA 1XFUA 1AF0A 3EWJA 1QICA 4PKQA 5D1TA 4JP4A 3P24A 1MMRA 2RJPA 2EROA 3ZUKA 1XURA 1BQQM 3P1VA 2MLRA 1H71P 3F16A 2X3CA 456CA 1CAQA 1JAQA 1UMSA 3Q2HA 4PKUA 4EFSA 3TS4A 3DWBA 4GWNA 1D5JA 3LIKA 830CA 1I73A 2AIGP 2W14A 1UMTA 1XFVA 2HU6A 1OS9A 4Q1LA 1QUAA 2KRJA 1R55A 5I3MA 2K9CA 2MZEA 1CGEA 4PKWA 2K2GA 4JIJA 1OO9A 1JIZA 2YIGA 2E2DA 1I1IP 5JMYA 1GO8P 4L63A 1RM8A 2X3AA 5I43A 3I7GA 1D8FA 2JSDA 3HY7A 1WNIA 4FU4A 1R1JA 1XFYA 3LQBA 4H84A 1G05A 4GR8A 2POJA 1JK3A 4WZVA 1QIBA 1OS2A 3LGPA 3ZVSA 2OW1A 3HDBA 3LJGA 3AIGA 3G42A 1SMPA 1ZTQA 1EUBA 1TVIA 4H3XA 3LIRA 4IJOA 1CIZA 4AYKA 2YB9A 2RJQA 1YQYA 3KECA 3RTSA 1C3IA 5D7WA 2W0DA 1XM5A 1RMZA 2E3XA 1ND1A 1FBLA 1K7GA 2MZIA 1GXDA 2YUFA 1C7KA 4R3VA 5CUHA 3VTGA 1R1IA 1USNA 1L6JA 2MLSA 3NX7A 3F17A 3WV3A 2D1NA 1KUKA 1XUDA 4H82A 1HV5A 3KHIA 1GKDA 1B8YA 1O0TA 4DD8A 4G9LA 1PWUA 2MZHA 3LILA 1IAEA 2OW2A 1YOUA 3HY9A 2JT6A 3EHYA 2DDFA 1QIAA 3HDAP 1A85A 1GE6A 1IADA 2DW0A 1KUGA 5B5OA 1KUIA 2OVXA 4ON1A 4HX3A 1G49A 4GF1A 3CKIA 2W15A 2OXUA 1QJJA 1XFZA 3KMCA 1Y8JA 3EDHA 2ERPA 4JQGA 3B92A 1ZP5A 4PKVA 4XM7A 1OZ9A 1GKCA 3I7IA 1Q3AA 5D1SA 3V96B 4DF9A 1JAPA 4WK7A 5BPAA 1HOVA 4H2EA 2SRTA 2WOAA 3K7LA 2W12A 2OY4A 3USNA 3ELMA 3LK8A 1MNCA 2OXZA 1YCMA 5I4OA 2WO8A 2DW2A 3EDGA 4PKSA 3HYGA 3TT4A 1HFSA 3EDIA 4I35A 1KUFA 1MMQA 2XS4A 1IABA 2OVZA 3DTKA 3F1AA 4IN9A 5L79A 4PKRA 4H30A 4AXQA 4L6TA 3SHIA 3OHLA 1BSWA 1GO7P 4XCTA 5I12A 1DMTA 4DPEA 1A86A 1CGFA 5D3CA 4AIGA 4PKTA 1Y93A 3HBVP 1B3DA 3DPEA 3EDZA 2I47A 4GR3A 5H8XA 2J0TA 5D2BA 3LJZA 3DTEA 3WV2A 1KAPP 2O36A 3LUNA 1K7QA 2CKIA 1R54A 1BUVM 1ASTA 1MMPA 1HY7A 1ZXVA 2D1OA 1OM7A 3O64A 1CQRA 1G12A 3B8ZA 1SRPA 1KUHA 1CK7A 5CXAA 2TCLA 3HBUP 3UVCA 1XFWA 1XUCA 1ZVXA 1D8MA 1J7NA 1MMBA 1Y0VA 3L0VA 1ZS0A 3TVCA 1GE5A 4CTHA 1BUDA 3Q2GA 2USNA 1G9KA 1EAKA 1IACA 2ERQA 1PWVA 2OW9A 2JT5A 3LUMA 3N2VA 3HB2P
chains in the Genus database with same CATH topology
2Z2DA 3F19A 1CGLA 3OHOA 2DW1A 1C8TA 4GR0A 1O0QA 2JIHA 2OZRA 1CXVA 1FLSA 2OY2A 5BOTA 1PWQA 1YP1A 5BOYA 1DTHA 1JAOA 4XM6A 4H1QA 4ZR5A 3MA2A 4WKIA 1JJ9A 4I03A 4DV8A 4FXYP 4AUOA 3LKAA 2CLTA 2JNPA 3KMEA 2L0RA 1BKCA 5LABA 4J4MA 2AYKA 3L0TA 1GE7A 2FV9A 3AYUA 4FXQA 1BM6A 5CZMA 5I2ZA 2W13A 4H76A 2DDYA 1BQOA 4L19A 3DPFA 4JPAA 3U1RA 4A3WA 1PWPA 3ZXHA 1PWWA 3LE9A 2FV5A 1JKYA 2OW0A 4XBHA 1S4BP 4QKZA 2OXWA 3EHXA 2PJTA 1AYKA 1SU3A 3LJTA 2Y6DA 1R1HA 3GBOA 1QJIA 3F18A 1JANA 3AYKA 5B5PA 4GWMA 1D7XA 1UEAA 3KEKA 3BA0A 2X7MA 4JA1A 1G4KA 2O3EA 1UTZA 3G5CA 1BKCE 1IAAA 1I76A 1ZXCA 3LEAA 1ROSA 3DL1A 3K7NA 3RTTA 1FM1A 1HFCA 2XS3A 4WKEA 5D1UA 3KEJA 4A7BA 3E8RA 4HMAA 1SLNA 3O2XA 1ATLA 966CA 1OM8A 3WV1A 3DTIA 3TSKA 2A8HA 2QPJA 1BIWA 4WF6A 1KBCA 1SLMA 1BKCI 1BZSA 3KWVC 4GQLA 1AKLA 3DNGA 5I0LA 3VI1A 1UTTA 4ILWD 3DSLA 1K7IA 3B2ZA 2J83A 1EB6A 4IUWA 1SATA 2N8RA 3F15A 1IAGA 2X3BA 1XFXA 1OMJA 3KRYA 3N2UA 2WO9A 2OI0A 2Y6CA 4H49A 1JIWP 1Z3JA 4GUYA 1OM6A 5L7FA 4XM8A 1HTDA 1JH1A 2V4BA 4FVLA 3LMCA 4G0DA 3LQ0A 4L7AA 1XFUA 1AF0A 3EWJA 1QICA 4PKQA 5D1TA 4JP4A 3P24A 1MMRA 2RJPA 2EROA 3ZUKA 1XURA 1BQQM 3P1VA 2MLRA 1H71P 3F16A 2X3CA 456CA 1CAQA 1JAQA 1UMSA 3Q2HA 4PKUA 4EFSA 3TS4A 3DWBA 4GWNA 1D5JA 3LIKA 830CA 1I73A 2AIGP 2W14A 1UMTA 1XFVA 2HU6A 1OS9A 4Q1LA 1QUAA 2KRJA 1R55A 5I3MA 2K9CA 2MZEA 1CGEA 4PKWA 2K2GA 4JIJA 1OO9A 1JIZA 2YIGA 2E2DA 1I1IP 5JMYA 1GO8P 4L63A 1RM8A 2X3AA 5I43A 3I7GA 1D8FA 2JSDA 3HY7A 1WNIA 4FU4A 1R1JA 1XFYA 3LQBA 4H84A 1G05A 4GR8A 2POJA 1JK3A 4WZVA 1QIBA 1OS2A 3LGPA 3ZVSA 2OW1A 3HDBA 3LJGA 3AIGA 3G42A 1SMPA 1ZTQA 1EUBA 4H3XA 3LIRA 4IJOA 1CIZA 4AYKA 2YB9A 2RJQA 1YQYA 3KECA 3RTSA 1C3IA 5D7WA 2W0DA 1RMZA 2E3XA 1ND1A 1FBLA 1K7GA 2MZIA 1GXDA 2YUFA 1C7KA 4R3VA 5CUHA 3VTGA 1R1IA 1USNA 1L6JA 2MLSA 3NX7A 3F17A 3WV3A 2D1NA 1KUKA 1XUDA 4H82A 1HV5A 3KHIA 1GKDA 1B8YA 1O0TA 4DD8A 4G9LA 1PWUA 2MZHA 3LILA 1IAEA 2OW2A 1YOUA 3HY9A 2JT6A 3EHYA 2DDFA 1QIAA 3HDAP 1A85A 1GE6A 1IADA 2DW0A 1KUGA 5B5OA 1KUIA 2OVXA 4ON1A 4HX3A 1G49A 4GF1A 3CKIA 2W15A 2OXUA 1QJJA 1XFZA 3KMCA 1Y8JA 3EDHA 2ERPA 4JQGA 3B92A 1ZP5A 4PKVA 4XM7A 1GKCA 3I7IA 1Q3AA 5D1SA 3V96B 4DF9A 1JAPA 4WK7A 5BPAA 1HOVA 4H2EA 2SRTA 2WOAA 3K7LA 2W12A 2OY4A 3USNA 3ELMA 3LK8A 1MNCA 2OXZA 1YCMA 5I4OA 2WO8A 2DW2A 3EDGA 4PKSA 3HYGA 3TT4A 1HFSA 3EDIA 4I35A 1KUFA 1MMQA 2XS4A 1IABA 2OVZA 3DTKA 3F1AA 4IN9A 5L79A 4PKRA 4H30A 4AXQA 4L6TA 3SHIA 3OHLA 1BSWA 1GO7P 4XCTA 5I12A 1DMTA 4DPEA 1A86A 1CGFA 5D3CA 4AIGA 4PKTA 1Y93A 3HBVP 1B3DA 3DPEA 3EDZA 2I47A 4GR3A 5H8XA 2J0TA 5D2BA 3LJZA 3DTEA 3WV2A 1KAPP 2O36A 3LUNA 1K7QA 2CKIA 1R54A 1BUVM 1ASTA 1MMPA 1HY7A 1ZXVA 2D1OA 1OM7A 3O64A 1CQRA 1G12A 3B8ZA 1SRPA 1KUHA 1CK7A 5CXAA 2TCLA 3HBUP 3UVCA 1XFWA 1XUCA 1ZVXA 1D8MA 1J7NA 1MMBA 1Y0VA 3L0VA 1ZS0A 3TVCA 1GE5A 4CTHA 1BUDA 3Q2GA 2USNA 1G9KA 1EAKA 1IACA 2ERQA 1PWVA 2OW9A 2JT5A 3LUMA 3N2VA 3HB2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z2D A;  3F19 A;  1CGL A;  3OHO A;  2DW1 A;  1C8T A;  4GR0 A;  1O0Q A;  2JIH A;  2OZR A;  1CXV A;  1FLS A;  2OY2 A;  5BOT A;  1PWQ A;  1YP1 A;  5BOY A;  1DTH A;  1JAO A;  4XM6 A;  4H1Q A;  4ZR5 A;  3MA2 A;  4WKI A;  1JJ9 A;  4I03 A;  4DV8 A;  4FXY P;  4AUO A;  3LKA A;  2CLT A;  2JNP A;  3KME A;  2L0R A;  1BKC A;  5LAB A;  4J4M A;  2AYK A;  3L0T A;  1GE7 A;  2FV9 A;  3AYU A;  4FXQ A;  1BM6 A;  5CZM A;  5I2Z A;  2W13 A;  4H76 A;  2DDY A;  1BQO A;  4L19 A;  3DPF A;  4JPA A;  3U1R A;  4A3W A;  1PWP A;  3ZXH A;  1PWW A;  3LE9 A;  2FV5 A;  1JKY A;  2OW0 A;  4XBH A;  1S4B P;  4QKZ A;  2OXW A;  3EHX A;  2PJT A;  1AYK A;  1SU3 A;  3LJT A;  2Y6D A;  1R1H A;  3GBO A;  1QJI A;  3F18 A;  1JAN A;  3AYK A;  5B5P A;  4GWM A;  1D7X A;  1UEA A;  3KEK A;  3BA0 A;  2X7M A;  4JA1 A;  1G4K A;  2O3E A;  1UTZ A;  3G5C A;  1BKC E;  1IAA A;  1I76 A;  1ZXC A;  3LEA A;  1ROS A;  3DL1 A;  3K7N A;  3RTT A;  1FM1 A;  1HFC A;  2XS3 A;  4WKE A;  5D1U A;  3KEJ A;  4A7B A;  3E8R A;  4HMA A;  1SLN A;  3O2X A;  1ATL A;  966C A;  1OM8 A;  3WV1 A;  3TSK A;  2A8H A;  2QPJ A;  1BIW A;  4WF6 A;  1KBC A;  1SLM A;  1BKC I;  1BZS A;  3KWV C;  4GQL A;  1AKL A;  3DNG A;  5I0L A;  3VI1 A;  1UTT A;  4ILW D;  3DSL A;  1K7I A;  3B2Z A;  2J83 A;  1EB6 A;  4IUW A;  1SAT A;  2N8R A;  3F15 A;  1IAG A;  2X3B A;  1XFX A;  1OMJ A;  3KRY A;  3N2U A;  2WO9 A;  2OI0 A;  2Y6C A;  4H49 A;  1JIW P;  1Z3J A;  4GUY A;  1OM6 A;  5L7F A;  4XM8 A;  1HTD A;  1JH1 A;  2V4B A;  4FVL A;  3LMC A;  4G0D A;  3LQ0 A;  1XFU A;  1AF0 A;  3EWJ A;  1QIC A;  4PKQ A;  5D1T A;  4JP4 A;  3P24 A;  1MMR A;  2RJP A;  2ERO A;  3ZUK A;  1XUR A;  1BQQ M;  3P1V A;  2MLR A;  1H71 P;  3F16 A;  2X3C A;  456C A;  1CAQ A;  1JAQ A;  1UMS A;  3Q2H A;  4PKU A;  4EFS A;  3TS4 A;  3DWB A;  4GWN A;  1D5J A;  3LIK A;  830C A;  1I73 A;  2AIG P;  2W14 A;  1UMT A;  1XFV A;  2HU6 A;  1OS9 A;  4Q1L A;  1QUA A;  2KRJ A;  1R55 A;  5I3M A;  2K9C A;  2MZE A;  1CGE A;  4PKW A;  2K2G A;  4JIJ A;  1OO9 A;  1JIZ A;  2YIG A;  2E2D A;  1I1I P;  5JMY A;  1GO8 P;  4L63 A;  1RM8 A;  2X3A A;  5I43 A;  3I7G A;  1D8F A;  2JSD A;  3HY7 A;  1WNI A;  4FU4 A;  1R1J A;  1XFY A;  3LQB A;  4H84 A;  1G05 A;  4GR8 A;  2POJ A;  1JK3 A;  4WZV A;  1QIB A;  1OS2 A;  3LGP A;  3ZVS A;  2OW1 A;  3HDB A;  3LJG A;  3AIG A;  3G42 A;  1SMP A;  1ZTQ A;  1EUB A;  4H3X A;  3LIR A;  4IJO A;  1CIZ A;  4AYK A;  2YB9 A;  2RJQ A;  1YQY A;  3KEC A;  3RTS A;  1C3I A;  5D7W A;  2W0D A;  1RMZ A;  2E3X A;  1ND1 A;  1FBL A;  1K7G A;  2MZI A;  1GXD A;  1C7K A;  4R3V A;  5CUH A;  3VTG A;  1R1I A;  1USN A;  1L6J A;  2MLS A;  3NX7 A;  3F17 A;  3WV3 A;  2D1N A;  1KUK A;  1XUD A;  4H82 A;  1HV5 A;  3KHI A;  1GKD A;  1B8Y A;  1O0T A;  4DD8 A;  4G9L A;  1PWU A;  2MZH A;  3LIL A;  1IAE A;  2OW2 A;  1YOU A;  3HY9 A;  2JT6 A;  3EHY A;  2DDF A;  1QIA A;  3HDA P;  1A85 A;  1GE6 A;  1IAD A;  2DW0 A;  1KUG A;  5B5O A;  1KUI A;  2OVX A;  4ON1 A;  4HX3 A;  1G49 A;  4GF1 A;  3CKI A;  2W15 A;  2OXU A;  1QJJ A;  1XFZ A;  3KMC A;  1Y8J A;  3EDH A;  2ERP A;  4JQG A;  3B92 A;  1ZP5 A;  4PKV A;  4XM7 A;  1GKC A;  3I7I A;  1Q3A A;  5D1S A;  3V96 B;  4DF9 A;  1JAP A;  4WK7 A;  5BPA A;  1HOV A;  4H2E A;  2SRT A;  2WOA A;  3K7L A;  2W12 A;  2OY4 A;  3USN A;  3ELM A;  3LK8 A;  1MNC A;  2OXZ A;  1YCM A;  5I4O A;  2WO8 A;  2DW2 A;  3EDG A;  4PKS A;  3HYG A;  3TT4 A;  1HFS A;  3EDI A;  4I35 A;  1KUF A;  1MMQ A;  2XS4 A;  1IAB A;  2OVZ A;  3F1A A;  4IN9 A;  5L79 A;  4PKR A;  4H30 A;  4AXQ A;  4L6T A;  3SHI A;  3OHL A;  1BSW A;  1GO7 P;  4XCT A;  5I12 A;  1DMT A;  4DPE A;  1A86 A;  1CGF A;  5D3C A;  4AIG A;  4PKT A;  1Y93 A;  3HBV P;  1B3D A;  3DPE A;  3EDZ A;  2I47 A;  4GR3 A;  5H8X A;  2J0T A;  5D2B A;  3LJZ A;  3WV2 A;  1KAP P;  2O36 A;  3LUN A;  1K7Q A;  2CKI A;  1R54 A;  1BUV M;  1AST A;  1MMP A;  1HY7 A;  1ZXV A;  2D1O A;  1OM7 A;  3O64 A;  1CQR A;  1G12 A;  3B8Z A;  1SRP A;  1KUH A;  1CK7 A;  5CXA A;  2TCL A;  3HBU P;  3UVC A;  1XFW A;  1XUC A;  1ZVX A;  1D8M A;  1J7N A;  1MMB A;  1Y0V A;  3L0V A;  1ZS0 A;  3TVC A;  1GE5 A;  4CTH A;  1BUD A;  3Q2G A;  2USN A;  1G9K A;  1EAK A;  1IAC A;  2ERQ A;  1PWV A;  2OW9 A;  2JT5 A;  3LUM A;  3N2V A;  3HB2 P; 
#chains in the Genus database with same CATH topology
 2Z2D A;  3F19 A;  1CGL A;  3OHO A;  2DW1 A;  1C8T A;  4GR0 A;  1O0Q A;  2JIH A;  2OZR A;  1CXV A;  1XAX A;  1FLS A;  2OY2 A;  5BOT A;  1PWQ A;  1YP1 A;  5BOY A;  1DTH A;  1JAO A;  4XM6 A;  4H1Q A;  4ZR5 A;  3MA2 A;  4WKI A;  1JJ9 A;  4I03 A;  4DV8 A;  4FXY P;  4AUO A;  3LKA A;  2CLT A;  2JNP A;  3KME A;  2L0R A;  1BKC A;  5LAB A;  4J4M A;  2AYK A;  3L0T A;  1GE7 A;  2FV9 A;  3AYU A;  4FXQ A;  1BM6 A;  5CZM A;  5I2Z A;  2W13 A;  4H76 A;  2DDY A;  1BQO A;  4L19 A;  3DPF A;  4JPA A;  3U1R A;  4A3W A;  1PWP A;  3ZXH A;  1PWW A;  3LE9 A;  2FV5 A;  1JKY A;  2OW0 A;  4XBH A;  1S4B P;  4QKZ A;  2OXW A;  3EHX A;  2PJT A;  1AYK A;  1SU3 A;  3LJT A;  2Y6D A;  1R1H A;  3GBO A;  1QJI A;  3F18 A;  1JAN A;  3AYK A;  5B5P A;  4GWM A;  1D7X A;  1UEA A;  3KEK A;  3BA0 A;  2X7M A;  4JA1 A;  1G4K A;  2O3E A;  1UTZ A;  3G5C A;  1BKC E;  1IAA A;  1I76 A;  1ZXC A;  3LEA A;  1ROS A;  3DL1 A;  3K7N A;  3RTT A;  1FM1 A;  1HFC A;  2XS3 A;  4WKE A;  5D1U A;  3KEJ A;  4A7B A;  3E8R A;  4HMA A;  1SLN A;  3O2X A;  1ATL A;  966C A;  1OM8 A;  3WV1 A;  3DTI A;  3TSK A;  2A8H A;  2QPJ A;  1BIW A;  4WF6 A;  1KBC A;  1SLM A;  1BKC I;  1BZS A;  3KWV C;  4GQL A;  1AKL A;  3DNG A;  5I0L A;  3VI1 A;  1UTT A;  4ILW D;  3DSL A;  1K7I A;  3B2Z A;  2J83 A;  1EB6 A;  4IUW A;  1SAT A;  2N8R A;  3F15 A;  1IAG A;  2X3B A;  1XFX A;  1OMJ A;  3KRY A;  3N2U A;  2WO9 A;  2OI0 A;  2Y6C A;  4H49 A;  1JIW P;  1Z3J A;  4GUY A;  1OM6 A;  5L7F A;  4XM8 A;  1HTD A;  1JH1 A;  2V4B A;  4FVL A;  3LMC A;  4G0D A;  3LQ0 A;  4L7A A;  1XFU A;  1AF0 A;  3EWJ A;  1QIC A;  4PKQ A;  5D1T A;  4JP4 A;  3P24 A;  1MMR A;  2RJP A;  2ERO A;  3ZUK A;  1XUR A;  1BQQ M;  3P1V A;  2MLR A;  1H71 P;  3F16 A;  2X3C A;  456C A;  1CAQ A;  1JAQ A;  1UMS A;  3Q2H A;  4PKU A;  4EFS A;  3TS4 A;  3DWB A;  4GWN A;  1D5J A;  3LIK A;  830C A;  1I73 A;  2AIG P;  2W14 A;  1UMT A;  1XFV A;  2HU6 A;  1OS9 A;  4Q1L A;  1QUA A;  2KRJ A;  1R55 A;  5I3M A;  2K9C A;  2MZE A;  1CGE A;  4PKW A;  2K2G A;  4JIJ A;  1OO9 A;  1JIZ A;  2YIG A;  2E2D A;  1I1I P;  5JMY A;  1GO8 P;  4L63 A;  1RM8 A;  2X3A A;  5I43 A;  3I7G A;  1D8F A;  2JSD A;  3HY7 A;  1WNI A;  4FU4 A;  1R1J A;  1XFY A;  3LQB A;  4H84 A;  1G05 A;  4GR8 A;  2POJ A;  1JK3 A;  4WZV A;  1QIB A;  1OS2 A;  3LGP A;  3ZVS A;  2OW1 A;  3HDB A;  3LJG A;  3AIG A;  3G42 A;  1SMP A;  1ZTQ A;  1EUB A;  1TVI A;  4H3X A;  3LIR A;  4IJO A;  1CIZ A;  4AYK A;  2YB9 A;  2RJQ A;  1YQY A;  3KEC A;  3RTS A;  1C3I A;  5D7W A;  2W0D A;  1XM5 A;  1RMZ A;  2E3X A;  1ND1 A;  1FBL A;  1K7G A;  2MZI A;  1GXD A;  2YUF A;  1C7K A;  4R3V A;  5CUH A;  3VTG A;  1R1I A;  1USN A;  1L6J A;  2MLS A;  3NX7 A;  3F17 A;  3WV3 A;  2D1N A;  1KUK A;  1XUD A;  4H82 A;  1HV5 A;  3KHI A;  1GKD A;  1B8Y A;  1O0T A;  4DD8 A;  4G9L A;  1PWU A;  2MZH A;  3LIL A;  1IAE A;  2OW2 A;  1YOU A;  3HY9 A;  2JT6 A;  3EHY A;  2DDF A;  1QIA A;  3HDA P;  1A85 A;  1GE6 A;  1IAD A;  2DW0 A;  1KUG A;  5B5O A;  1KUI A;  2OVX A;  4ON1 A;  4HX3 A;  1G49 A;  4GF1 A;  3CKI A;  2W15 A;  2OXU A;  1QJJ A;  1XFZ A;  3KMC A;  1Y8J A;  3EDH A;  2ERP A;  4JQG A;  3B92 A;  1ZP5 A;  4PKV A;  4XM7 A;  1OZ9 A;  1GKC A;  3I7I A;  1Q3A A;  5D1S A;  3V96 B;  4DF9 A;  1JAP A;  4WK7 A;  5BPA A;  1HOV A;  4H2E A;  2SRT A;  2WOA A;  3K7L A;  2W12 A;  2OY4 A;  3USN A;  3ELM A;  3LK8 A;  1MNC A;  2OXZ A;  1YCM A;  5I4O A;  2WO8 A;  2DW2 A;  3EDG A;  4PKS A;  3HYG A;  3TT4 A;  1HFS A;  3EDI A;  4I35 A;  1KUF A;  1MMQ A;  2XS4 A;  1IAB A;  2OVZ A;  3DTK A;  3F1A A;  4IN9 A;  5L79 A;  4PKR A;  4H30 A;  4AXQ A;  4L6T A;  3SHI A;  3OHL A;  1BSW A;  1GO7 P;  4XCT A;  5I12 A;  1DMT A;  4DPE A;  1A86 A;  1CGF A;  5D3C A;  4AIG A;  4PKT A;  1Y93 A;  3HBV P;  1B3D A;  3DPE A;  3EDZ A;  2I47 A;  4GR3 A;  5H8X A;  2J0T A;  5D2B A;  3LJZ A;  3DTE A;  3WV2 A;  1KAP P;  2O36 A;  3LUN A;  1K7Q A;  2CKI A;  1R54 A;  1BUV M;  1AST A;  1MMP A;  1HY7 A;  1ZXV A;  2D1O A;  1OM7 A;  3O64 A;  1CQR A;  1G12 A;  3B8Z A;  1SRP A;  1KUH A;  1CK7 A;  5CXA A;  2TCL A;  3HBU P;  3UVC A;  1XFW A;  1XUC A;  1ZVX A;  1D8M A;  1J7N A;  1MMB A;  1Y0V A;  3L0V A;  1ZS0 A;  3TVC A;  1GE5 A;  4CTH A;  1BUD A;  3Q2G A;  2USN A;  1G9K A;  1EAK A;  1IAC A;  2ERQ A;  1PWV A;  2OW9 A;  2JT5 A;  3LUM A;  3N2V A;  3HB2 P; 
#chains in the Genus database with same CATH homology
 2Z2D A;  3F19 A;  1CGL A;  3OHO A;  2DW1 A;  1C8T A;  4GR0 A;  1O0Q A;  2JIH A;  2OZR A;  1CXV A;  1FLS A;  2OY2 A;  5BOT A;  1PWQ A;  1YP1 A;  5BOY A;  1DTH A;  1JAO A;  4XM6 A;  4H1Q A;  4ZR5 A;  3MA2 A;  4WKI A;  1JJ9 A;  4I03 A;  4DV8 A;  4FXY P;  4AUO A;  3LKA A;  2CLT A;  2JNP A;  3KME A;  2L0R A;  1BKC A;  5LAB A;  4J4M A;  2AYK A;  3L0T A;  1GE7 A;  2FV9 A;  3AYU A;  4FXQ A;  1BM6 A;  5CZM A;  5I2Z A;  2W13 A;  4H76 A;  2DDY A;  1BQO A;  4L19 A;  3DPF A;  4JPA A;  3U1R A;  4A3W A;  1PWP A;  3ZXH A;  1PWW A;  3LE9 A;  2FV5 A;  1JKY A;  2OW0 A;  4XBH A;  1S4B P;  4QKZ A;  2OXW A;  3EHX A;  2PJT A;  1AYK A;  1SU3 A;  3LJT A;  2Y6D A;  1R1H A;  3GBO A;  1QJI A;  3F18 A;  1JAN A;  3AYK A;  5B5P A;  4GWM A;  1D7X A;  1UEA A;  3KEK A;  3BA0 A;  2X7M A;  4JA1 A;  1G4K A;  2O3E A;  1UTZ A;  3G5C A;  1BKC E;  1IAA A;  1I76 A;  1ZXC A;  3LEA A;  1ROS A;  3DL1 A;  3K7N A;  3RTT A;  1FM1 A;  1HFC A;  2XS3 A;  4WKE A;  5D1U A;  3KEJ A;  4A7B A;  3E8R A;  4HMA A;  1SLN A;  3O2X A;  1ATL A;  966C A;  1OM8 A;  3WV1 A;  3DTI A;  3TSK A;  2A8H A;  2QPJ A;  1BIW A;  4WF6 A;  1KBC A;  1SLM A;  1BKC I;  1BZS A;  3KWV C;  4GQL A;  1AKL A;  3DNG A;  5I0L A;  3VI1 A;  1UTT A;  4ILW D;  3DSL A;  1K7I A;  3B2Z A;  2J83 A;  1EB6 A;  4IUW A;  1SAT A;  2N8R A;  3F15 A;  1IAG A;  2X3B A;  1XFX A;  1OMJ A;  3KRY A;  3N2U A;  2WO9 A;  2OI0 A;  2Y6C A;  4H49 A;  1JIW P;  1Z3J A;  4GUY A;  1OM6 A;  5L7F A;  4XM8 A;  1HTD A;  1JH1 A;  2V4B A;  4FVL A;  3LMC A;  4G0D A;  3LQ0 A;  4L7A A;  1XFU A;  1AF0 A;  3EWJ A;  1QIC A;  4PKQ A;  5D1T A;  4JP4 A;  3P24 A;  1MMR A;  2RJP A;  2ERO A;  3ZUK A;  1XUR A;  1BQQ M;  3P1V A;  2MLR A;  1H71 P;  3F16 A;  2X3C A;  456C A;  1CAQ A;  1JAQ A;  1UMS A;  3Q2H A;  4PKU A;  4EFS A;  3TS4 A;  3DWB A;  4GWN A;  1D5J A;  3LIK A;  830C A;  1I73 A;  2AIG P;  2W14 A;  1UMT A;  1XFV A;  2HU6 A;  1OS9 A;  4Q1L A;  1QUA A;  2KRJ A;  1R55 A;  5I3M A;  2K9C A;  2MZE A;  1CGE A;  4PKW A;  2K2G A;  4JIJ A;  1OO9 A;  1JIZ A;  2YIG A;  2E2D A;  1I1I P;  5JMY A;  1GO8 P;  4L63 A;  1RM8 A;  2X3A A;  5I43 A;  3I7G A;  1D8F A;  2JSD A;  3HY7 A;  1WNI A;  4FU4 A;  1R1J A;  1XFY A;  3LQB A;  4H84 A;  1G05 A;  4GR8 A;  2POJ A;  1JK3 A;  4WZV A;  1QIB A;  1OS2 A;  3LGP A;  3ZVS A;  2OW1 A;  3HDB A;  3LJG A;  3AIG A;  3G42 A;  1SMP A;  1ZTQ A;  1EUB A;  4H3X A;  3LIR A;  4IJO A;  1CIZ A;  4AYK A;  2YB9 A;  2RJQ A;  1YQY A;  3KEC A;  3RTS A;  1C3I A;  5D7W A;  2W0D A;  1RMZ A;  2E3X A;  1ND1 A;  1FBL A;  1K7G A;  2MZI A;  1GXD A;  2YUF A;  1C7K A;  4R3V A;  5CUH A;  3VTG A;  1R1I A;  1USN A;  1L6J A;  2MLS A;  3NX7 A;  3F17 A;  3WV3 A;  2D1N A;  1KUK A;  1XUD A;  4H82 A;  1HV5 A;  3KHI A;  1GKD A;  1B8Y A;  1O0T A;  4DD8 A;  4G9L A;  1PWU A;  2MZH A;  3LIL A;  1IAE A;  2OW2 A;  1YOU A;  3HY9 A;  2JT6 A;  3EHY A;  2DDF A;  1QIA A;  3HDA P;  1A85 A;  1GE6 A;  1IAD A;  2DW0 A;  1KUG A;  5B5O A;  1KUI A;  2OVX A;  4ON1 A;  4HX3 A;  1G49 A;  4GF1 A;  3CKI A;  2W15 A;  2OXU A;  1QJJ A;  1XFZ A;  3KMC A;  1Y8J A;  3EDH A;  2ERP A;  4JQG A;  3B92 A;  1ZP5 A;  4PKV A;  4XM7 A;  1GKC A;  3I7I A;  1Q3A A;  5D1S A;  3V96 B;  4DF9 A;  1JAP A;  4WK7 A;  5BPA A;  1HOV A;  4H2E A;  2SRT A;  2WOA A;  3K7L A;  2W12 A;  2OY4 A;  3USN A;  3ELM A;  3LK8 A;  1MNC A;  2OXZ A;  1YCM A;  5I4O A;  2WO8 A;  2DW2 A;  3EDG A;  4PKS A;  3HYG A;  3TT4 A;  1HFS A;  3EDI A;  4I35 A;  1KUF A;  1MMQ A;  2XS4 A;  1IAB A;  2OVZ A;  3DTK A;  3F1A A;  4IN9 A;  5L79 A;  4PKR A;  4H30 A;  4AXQ A;  4L6T A;  3SHI A;  3OHL A;  1BSW A;  1GO7 P;  4XCT A;  5I12 A;  1DMT A;  4DPE A;  1A86 A;  1CGF A;  5D3C A;  4AIG A;  4PKT A;  1Y93 A;  3HBV P;  1B3D A;  3DPE A;  3EDZ A;  2I47 A;  4GR3 A;  5H8X A;  2J0T A;  5D2B A;  3LJZ A;  3DTE A;  3WV2 A;  1KAP P;  2O36 A;  3LUN A;  1K7Q A;  2CKI A;  1R54 A;  1BUV M;  1AST A;  1MMP A;  1HY7 A;  1ZXV A;  2D1O A;  1OM7 A;  3O64 A;  1CQR A;  1G12 A;  3B8Z A;  1SRP A;  1KUH A;  1CK7 A;  5CXA A;  2TCL A;  3HBU P;  3UVC A;  1XFW A;  1XUC A;  1ZVX A;  1D8M A;  1J7N A;  1MMB A;  1Y0V A;  3L0V A;  1ZS0 A;  3TVC A;  1GE5 A;  4CTH A;  1BUD A;  3Q2G A;  2USN A;  1G9K A;  1EAK A;  1IAC A;  2ERQ A;  1PWV A;  2OW9 A;  2JT5 A;  3LUM A;  3N2V A;  3HB2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...