1OO9A

Orientation in solution of mmp-3 catalytic domain and n-timp-1 from residual dipolar couplings
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
168
structure length
168
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Stromelysin-1
publication title Global Orientation of Bound MMP-3 and N-TIMP-1 in Solution via Residual Dipolar Couplings
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 168
sequence length 168
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1oo9A00
4AYKA 2OI0A 3ELMA 3E8RA 1ZP5A 1A85A 1C7KA 3LQ0A 2EROA 4AXQA 1ZXVA 1ND1A 3N2VA 1R54A 3HBVP 5D1UA 1KUKA 3U1RA 1SATA 1XFZA 1GXDA 2OVZA 5CZMA 2MZIA 1UTTA 1XFUA 4H49A 4AUOA 4H1QA 4I35A 2W13A 3EHXA 3LUNA 4GF1A 1Y8JA 2AIGP 1SMPA 1K7QA 2OW9A 3TS4A 2OXUA 1HFSA 5I2ZA 2RJQA 1FLSA 1JAQA 3B92A 2E2DA 1D7XA 5D2BA 1GO8P 3HY9A 1CQRA 3LGPA 4H76A 1IABA 4HX3A 4XBHA 1C3IA 3DSLA 3LIRA 4PKTA 4PKVA 1Z3JA 4GWNA 4XM7A 1YOUA 1L6JA 1XFYA 4ILWD 1JIZA 1IAEA 1MMRA 3CKIA 3EDHA 3G5CA 3AYUA 3F16A 4GUYA 2WOAA 2D1NA 3LKAA 1XUDA 3KEKA 1YP1A 3RTSA 1O0QA 4JQGA 3KEJA 2JT5A 1R1HA 3I7GA 1OS2A 2DDFA 4HMAA 4WZVA 3WV1A 5BOTA 1IAAA 3AYKA 5L79A 3SHIA 4JA1A 1RM8A 4GR0A 1BM6A 1HTDA 3NX7A 1MMQA 4H82A 4I03A 1UTZA 1PWPA 3I7IA 1JAOA 1PWUA 1YQYA 1BKCA 2X3AA 1G12A 3F17A 1HOVA 4H84A 1CK7A 2OVXA 1C8TA 2MLRA 1GE5A 1A86A 2KRJA 2OW0A 2D1OA 3F18A 1D8FA 1IACA 1H71P 3LIKA 1DTHA 1XUCA 4WKIA 2OW1A 5CUHA 2K2GA 2JIHA 3HYGA 4DV8A 3OHOA 1SRPA 3LJZA 2X3CA 4WKEA 2RJPA 966CA 2MZEA 1R55A 3LEAA 3L0VA 4DPEA 1FBLA 2HU6A 2YIGA 2DW2A 4XM8A 2XS4A 3VTGA 1KUHA 1Y93A 2OZRA 2X3BA 4WF6A 1XFWA 1CGFA 3HBUP 1S4BP 5I12A 4ON1A 1JK3A 2W0DA 3MA2A 4WK7A 1KUFA 1BUDA 1B8YA 5D3CA 1XFVA 3L0TA 2ERQA 1BQQM 1CXVA 1QIAA 1QJJA 3KECA 3KMCA 3KMEA 4DD8A 2W12A 4PKUA 1QJIA 2SRTA 1G9KA 1I1IP 4H2EA 5D7WA 3VI1A 1I73A 2YB9A 3KRYA 1JH1A 1GO7P 5B5OA 1BKCE 3DWBA 3F19A 2O3EA 1UEAA 2JSDA 1QIBA 1J7NA 4DF9A 2PJTA 1MMBA 1Y0VA 3K7LA 1DMTA 3LJTA 4H3XA 1G49A 3RTTA 3LQBA 2JT6A 1AKLA 2J83A 2CKIA 4JIJA 1O0TA 4G0DA 2K9CA 3DPFA 1HY7A 1JIWP 5H8XA 2XS3A 1CGLA 2OY4A 1PWWA 2AYKA 2WO9A 1G05A 1BZSA 4IN9A 3ZXHA 1PWVA 3B2ZA 1CGEA 3Q2GA 5BOYA 2Y6CA 5I4OA 1EB6A 1JANA 4A7BA 2TCLA 1BKCI 1IAGA 1OM6A 1R1IA 1GKCA 2OXWA 3DPEA 1ROSA 1XURA 5JMYA 2W14A 2POJA 3LUMA 3HB2P 3EDZA 1YCMA 1MMPA 1KUIA 3LE9A 1JKYA 3BA0A 3P1VA 4JPAA 3TVCA 4PKWA 4FXQA 1WNIA 2I47A 1XFXA 1RMZA 5I3MA 3LK8A 2OY2A 3KWVC 1OMJA 2E3XA 2CLTA 3F1AA 4AIGA 3Q2HA 3ZVSA 1FM1A 1Q3AA 4FXYP 3K7NA 4L19A 1OO9A 3B8ZA 1K7GA 1PWQA 3EDIA 1G4KA 4R3VA 3O2XA 1CIZA 3KHIA 3HDBA 1SLNA 3DNGA 1CAQA 4CTHA 2QPJA 3OHLA 1JAPA 1EAKA 1OM7A 4PKQA 1USNA 5LABA 1SU3A 1GKDA 4J4MA 3EDGA 2L0RA 1HFCA 4QKZA 4H30A 3WV3A 5BPAA 1UMTA 1AYKA 1ATLA 4GR8A 1HV5A 3EWJA 3USNA 4FU4A 1D8MA 3TT4A 4L63A 456CA 1EUBA 5L7FA 2ERPA 1ZS0A 1ASTA 5I0LA 2JNPA 1OM8A 3DL1A 2MZHA 4XM6A 1IADA 4PKRA 1I76A 2FV9A 2Z2DA 2O36A 830CA 2DW0A 4JP4A 5D1SA 1QICA 1GE7A 5CXAA 4GQLA 1SLMA 3P24A 1K7IA 2N8RA 4IJOA 4PKSA 2OXZA 1JJ9A 3UVCA 4Q1LA 2J0TA 1ZTQA 4IUWA 4A3WA 2V4BA 2Y6DA 1ZXCA 1MNCA 4G9LA 3LILA 3N2UA 2X7MA 1BUVM 3LJGA 3LMCA 3ZUKA 4L6TA 3WV2A 1BIWA 2FV5A 3TSKA 1QUAA 5I43A 4GR3A 1UMSA 2A8HA 2DDYA 1D5JA 1R1JA 2MLSA 1BSWA 3HY7A 2W15A 4XCTA 1B3DA 1KBCA 5D1TA 1BQOA 1KAPP 4ZR5A 3GBOA 3G42A 5B5PA 1OS9A 4FVLA 4GWMA 2WO8A 3EHYA 2DW1A 3V96B 3F15A 1GE6A 3HDAP 3AIGA 2OW2A 2USNA 1AF0A 3O64A 4EFSA 1KUGA 1ZVXA
chains in the Genus database with same CATH superfamily
4AYKA 2OI0A 3ELMA 3E8RA 1XAXA 1ZP5A 1A85A 1C7KA 3LQ0A 2EROA 4AXQA 1ZXVA 1ND1A 3N2VA 1R54A 3HBVP 5D1UA 1KUKA 3U1RA 1SATA 1XFZA 1GXDA 2OVZA 5CZMA 2MZIA 1UTTA 1XFUA 4H49A 4AUOA 4H1QA 4I35A 2W13A 3EHXA 3LUNA 4GF1A 1Y8JA 2AIGP 1SMPA 1K7QA 2OW9A 3TS4A 2OXUA 1HFSA 5I2ZA 1XM5A 2RJQA 1FLSA 1JAQA 3B92A 2E2DA 1D7XA 5D2BA 3DTEA 1GO8P 3HY9A 1CQRA 3LGPA 4H76A 1IABA 4HX3A 4XBHA 1C3IA 3DSLA 3LIRA 4PKTA 4PKVA 1Z3JA 4GWNA 4XM7A 1YOUA 1L6JA 1XFYA 4ILWD 1JIZA 1IAEA 1MMRA 3CKIA 3EDHA 3G5CA 3AYUA 3F16A 4GUYA 2WOAA 2D1NA 3LKAA 1XUDA 3KEKA 1YP1A 3RTSA 1O0QA 4JQGA 3KEJA 2JT5A 1R1HA 3I7GA 1OS2A 2DDFA 4HMAA 4WZVA 3WV1A 5BOTA 1IAAA 3AYKA 5L79A 3SHIA 4JA1A 1RM8A 4GR0A 1BM6A 1HTDA 3NX7A 1MMQA 4H82A 4I03A 1UTZA 1PWPA 3I7IA 1JAOA 1PWUA 1YQYA 1BKCA 2X3AA 1G12A 3F17A 1HOVA 4H84A 1CK7A 2OVXA 1C8TA 2MLRA 3DTKA 1GE5A 1A86A 2KRJA 2OW0A 2D1OA 3F18A 1D8FA 1IACA 1H71P 3LIKA 1DTHA 1XUCA 4WKIA 2OW1A 5CUHA 2K2GA 2JIHA 3HYGA 4DV8A 3OHOA 1SRPA 3LJZA 2X3CA 4WKEA 2RJPA 966CA 2MZEA 1R55A 3LEAA 3L0VA 4DPEA 1FBLA 2HU6A 2YIGA 2DW2A 4XM8A 2XS4A 3VTGA 1KUHA 1Y93A 2OZRA 2X3BA 4WF6A 1XFWA 1CGFA 3HBUP 1S4BP 5I12A 4ON1A 1JK3A 2W0DA 3MA2A 4WK7A 1KUFA 1BUDA 1B8YA 5D3CA 1XFVA 3L0TA 2ERQA 1BQQM 1CXVA 1QIAA 1QJJA 3KECA 3KMCA 3KMEA 4DD8A 2W12A 4PKUA 1QJIA 2SRTA 1G9KA 1I1IP 4H2EA 5D7WA 3VI1A 1I73A 2YB9A 3KRYA 1JH1A 1GO7P 5B5OA 1BKCE 3DWBA 3F19A 2O3EA 1UEAA 2JSDA 1QIBA 1J7NA 4DF9A 2PJTA 3DTIA 1MMBA 1Y0VA 3K7LA 1DMTA 3LJTA 4H3XA 1G49A 3RTTA 3LQBA 2JT6A 1AKLA 2J83A 2CKIA 2YUFA 4JIJA 1O0TA 4G0DA 2K9CA 3DPFA 1HY7A 1JIWP 5H8XA 2XS3A 1CGLA 2OY4A 1PWWA 2AYKA 2WO9A 1G05A 1BZSA 4IN9A 3ZXHA 1PWVA 3B2ZA 1CGEA 3Q2GA 5BOYA 2Y6CA 5I4OA 1EB6A 1JANA 4A7BA 2TCLA 1BKCI 1IAGA 1OM6A 1R1IA 1GKCA 2OXWA 3DPEA 1ROSA 1XURA 5JMYA 2W14A 2POJA 3LUMA 3HB2P 3EDZA 1YCMA 1MMPA 1KUIA 3LE9A 1JKYA 3BA0A 3P1VA 4JPAA 3TVCA 4PKWA 4FXQA 1WNIA 2I47A 1XFXA 1RMZA 5I3MA 3LK8A 2OY2A 3KWVC 1OMJA 2E3XA 2CLTA 3F1AA 4AIGA 3Q2HA 3ZVSA 1FM1A 1Q3AA 4FXYP 3K7NA 4L19A 1OO9A 3B8ZA 1K7GA 1PWQA 3EDIA 1G4KA 4R3VA 3O2XA 1CIZA 3KHIA 3HDBA 1SLNA 3DNGA 1CAQA 4CTHA 2QPJA 3OHLA 1JAPA 1EAKA 1OM7A 4PKQA 1USNA 5LABA 1SU3A 1GKDA 4J4MA 3EDGA 2L0RA 1HFCA 4QKZA 4H30A 3WV3A 5BPAA 1UMTA 1AYKA 1ATLA 4GR8A 1HV5A 3EWJA 3USNA 4FU4A 1D8MA 3TT4A 4L63A 456CA 1EUBA 5L7FA 2ERPA 1ZS0A 1ASTA 5I0LA 2JNPA 1OM8A 3DL1A 2MZHA 1TVIA 4XM6A 1IADA 4PKRA 1I76A 2FV9A 2Z2DA 2O36A 830CA 2DW0A 4JP4A 5D1SA 1QICA 1GE7A 1OZ9A 5CXAA 4GQLA 1SLMA 3P24A 1K7IA 4L7AA 2N8RA 4IJOA 4PKSA 2OXZA 1JJ9A 3UVCA 4Q1LA 2J0TA 1ZTQA 4IUWA 4A3WA 2V4BA 2Y6DA 1ZXCA 1MNCA 4G9LA 3LILA 3N2UA 2X7MA 1BUVM 3LJGA 3LMCA 3ZUKA 4L6TA 3WV2A 1BIWA 2FV5A 3TSKA 1QUAA 5I43A 4GR3A 1UMSA 2A8HA 2DDYA 1D5JA 1R1JA 2MLSA 1BSWA 3HY7A 2W15A 4XCTA 1B3DA 1KBCA 5D1TA 1BQOA 1KAPP 4ZR5A 3GBOA 3G42A 5B5PA 1OS9A 4FVLA 4GWMA 2WO8A 3EHYA 2DW1A 3V96B 3F15A 1GE6A 3HDAP 3AIGA 2OW2A 2USNA 1AF0A 3O64A 4EFSA 1KUGA 1ZVXA
chains in the Genus database with same CATH topology
4AYKA 2OI0A 3ELMA 3E8RA 1ZP5A 1A85A 1C7KA 3LQ0A 2EROA 4AXQA 1ZXVA 1ND1A 3N2VA 1R54A 3HBVP 5D1UA 1KUKA 3U1RA 1SATA 1XFZA 1GXDA 2OVZA 5CZMA 2MZIA 1UTTA 1XFUA 4H49A 4AUOA 4H1QA 4I35A 2W13A 3EHXA 3LUNA 4GF1A 1Y8JA 2AIGP 1SMPA 1K7QA 2OW9A 3TS4A 2OXUA 1HFSA 5I2ZA 2RJQA 1FLSA 1JAQA 3B92A 2E2DA 1D7XA 5D2BA 3DTEA 1GO8P 3HY9A 1CQRA 3LGPA 4H76A 1IABA 4HX3A 4XBHA 1C3IA 3DSLA 3LIRA 4PKTA 4PKVA 1Z3JA 4GWNA 4XM7A 1YOUA 1L6JA 1XFYA 4ILWD 1JIZA 1IAEA 1MMRA 3CKIA 3EDHA 3G5CA 3AYUA 3F16A 4GUYA 2WOAA 2D1NA 3LKAA 1XUDA 3KEKA 1YP1A 3RTSA 1O0QA 4JQGA 3KEJA 2JT5A 1R1HA 3I7GA 1OS2A 2DDFA 4HMAA 4WZVA 3WV1A 5BOTA 1IAAA 3AYKA 5L79A 3SHIA 4JA1A 1RM8A 4GR0A 1BM6A 1HTDA 3NX7A 1MMQA 4H82A 4I03A 1UTZA 1PWPA 3I7IA 1JAOA 1PWUA 1YQYA 1BKCA 2X3AA 1G12A 3F17A 1HOVA 4H84A 1CK7A 2OVXA 1C8TA 2MLRA 3DTKA 1GE5A 1A86A 2KRJA 2OW0A 2D1OA 3F18A 1D8FA 1IACA 1H71P 3LIKA 1DTHA 1XUCA 4WKIA 2OW1A 5CUHA 2K2GA 2JIHA 3HYGA 4DV8A 3OHOA 1SRPA 3LJZA 2X3CA 4WKEA 2RJPA 966CA 2MZEA 1R55A 3LEAA 3L0VA 4DPEA 1FBLA 2HU6A 2YIGA 2DW2A 4XM8A 2XS4A 3VTGA 1KUHA 1Y93A 2OZRA 2X3BA 4WF6A 1XFWA 1CGFA 3HBUP 1S4BP 5I12A 4ON1A 1JK3A 2W0DA 3MA2A 4WK7A 1KUFA 1BUDA 1B8YA 5D3CA 1XFVA 3L0TA 2ERQA 1BQQM 1CXVA 1QIAA 1QJJA 3KECA 3KMCA 3KMEA 4DD8A 2W12A 4PKUA 1QJIA 2SRTA 1G9KA 1I1IP 4H2EA 5D7WA 3VI1A 1I73A 2YB9A 3KRYA 1JH1A 1GO7P 5B5OA 1BKCE 3DWBA 3F19A 2O3EA 1UEAA 2JSDA 1QIBA 1J7NA 4DF9A 2PJTA 3DTIA 1MMBA 1Y0VA 3K7LA 1DMTA 3LJTA 4H3XA 1G49A 3RTTA 3LQBA 2JT6A 1AKLA 2J83A 2CKIA 2YUFA 4JIJA 1O0TA 4G0DA 2K9CA 3DPFA 1HY7A 1JIWP 5H8XA 2XS3A 1CGLA 2OY4A 1PWWA 2AYKA 2WO9A 1G05A 1BZSA 4IN9A 3ZXHA 1PWVA 3B2ZA 1CGEA 3Q2GA 5BOYA 2Y6CA 5I4OA 1EB6A 1JANA 4A7BA 2TCLA 1BKCI 1IAGA 1OM6A 1R1IA 1GKCA 2OXWA 3DPEA 1ROSA 1XURA 5JMYA 2W14A 2POJA 3LUMA 3HB2P 3EDZA 1YCMA 1MMPA 1KUIA 3LE9A 1JKYA 3BA0A 3P1VA 4JPAA 3TVCA 4PKWA 4FXQA 1WNIA 2I47A 1XFXA 1RMZA 5I3MA 3LK8A 2OY2A 3KWVC 1OMJA 2E3XA 2CLTA 3F1AA 4AIGA 3Q2HA 3ZVSA 1FM1A 1Q3AA 4FXYP 3K7NA 4L19A 1OO9A 3B8ZA 1K7GA 1PWQA 3EDIA 1G4KA 4R3VA 3O2XA 1CIZA 3KHIA 3HDBA 1SLNA 3DNGA 1CAQA 4CTHA 2QPJA 3OHLA 1JAPA 1EAKA 1OM7A 4PKQA 1USNA 5LABA 1SU3A 1GKDA 4J4MA 3EDGA 2L0RA 1HFCA 4QKZA 4H30A 3WV3A 5BPAA 1UMTA 1AYKA 1ATLA 4GR8A 1HV5A 3EWJA 3USNA 4FU4A 1D8MA 3TT4A 4L63A 456CA 1EUBA 5L7FA 2ERPA 1ZS0A 1ASTA 5I0LA 2JNPA 1OM8A 3DL1A 2MZHA 4XM6A 1IADA 4PKRA 1I76A 2FV9A 2Z2DA 2O36A 830CA 2DW0A 4JP4A 5D1SA 1QICA 1GE7A 5CXAA 4GQLA 1SLMA 3P24A 1K7IA 4L7AA 2N8RA 4IJOA 4PKSA 2OXZA 1JJ9A 3UVCA 4Q1LA 2J0TA 1ZTQA 4IUWA 4A3WA 2V4BA 2Y6DA 1ZXCA 1MNCA 4G9LA 3LILA 3N2UA 2X7MA 1BUVM 3LJGA 3LMCA 3ZUKA 4L6TA 3WV2A 1BIWA 2FV5A 3TSKA 1QUAA 5I43A 4GR3A 1UMSA 2A8HA 2DDYA 1D5JA 1R1JA 2MLSA 1BSWA 3HY7A 2W15A 4XCTA 1B3DA 1KBCA 5D1TA 1BQOA 1KAPP 4ZR5A 3GBOA 3G42A 5B5PA 1OS9A 4FVLA 4GWMA 2WO8A 3EHYA 2DW1A 3V96B 3F15A 1GE6A 3HDAP 3AIGA 2OW2A 2USNA 1AF0A 3O64A 4EFSA 1KUGA 1ZVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYK A;  2OI0 A;  3ELM A;  3E8R A;  1ZP5 A;  1A85 A;  1C7K A;  3LQ0 A;  2ERO A;  4AXQ A;  1ZXV A;  1ND1 A;  3N2V A;  1R54 A;  3HBV P;  5D1U A;  1KUK A;  3U1R A;  1SAT A;  1XFZ A;  1GXD A;  2OVZ A;  5CZM A;  2MZI A;  1UTT A;  1XFU A;  4H49 A;  4AUO A;  4H1Q A;  4I35 A;  2W13 A;  3EHX A;  3LUN A;  4GF1 A;  1Y8J A;  2AIG P;  1SMP A;  1K7Q A;  2OW9 A;  3TS4 A;  2OXU A;  1HFS A;  5I2Z A;  2RJQ A;  1FLS A;  1JAQ A;  3B92 A;  2E2D A;  1D7X A;  5D2B A;  1GO8 P;  3HY9 A;  1CQR A;  3LGP A;  4H76 A;  1IAB A;  4HX3 A;  4XBH A;  1C3I A;  3DSL A;  3LIR A;  4PKT A;  4PKV A;  1Z3J A;  4GWN A;  4XM7 A;  1YOU A;  1L6J A;  1XFY A;  4ILW D;  1JIZ A;  1IAE A;  1MMR A;  3CKI A;  3EDH A;  3G5C A;  3AYU A;  3F16 A;  4GUY A;  2WOA A;  2D1N A;  3LKA A;  1XUD A;  3KEK A;  1YP1 A;  3RTS A;  1O0Q A;  4JQG A;  3KEJ A;  2JT5 A;  1R1H A;  3I7G A;  1OS2 A;  2DDF A;  4HMA A;  4WZV A;  3WV1 A;  5BOT A;  1IAA A;  3AYK A;  5L79 A;  3SHI A;  4JA1 A;  1RM8 A;  4GR0 A;  1BM6 A;  1HTD A;  3NX7 A;  1MMQ A;  4H82 A;  4I03 A;  1UTZ A;  1PWP A;  3I7I A;  1JAO A;  1PWU A;  1YQY A;  1BKC A;  2X3A A;  1G12 A;  3F17 A;  1HOV A;  4H84 A;  1CK7 A;  2OVX A;  1C8T A;  2MLR A;  1GE5 A;  1A86 A;  2KRJ A;  2OW0 A;  2D1O A;  3F18 A;  1D8F A;  1IAC A;  1H71 P;  3LIK A;  1DTH A;  1XUC A;  4WKI A;  2OW1 A;  5CUH A;  2K2G A;  2JIH A;  3HYG A;  4DV8 A;  3OHO A;  1SRP A;  3LJZ A;  2X3C A;  4WKE A;  2RJP A;  966C A;  2MZE A;  1R55 A;  3LEA A;  3L0V A;  4DPE A;  1FBL A;  2HU6 A;  2YIG A;  2DW2 A;  4XM8 A;  2XS4 A;  3VTG A;  1KUH A;  1Y93 A;  2OZR A;  2X3B A;  4WF6 A;  1XFW A;  1CGF A;  3HBU P;  1S4B P;  5I12 A;  4ON1 A;  1JK3 A;  2W0D A;  3MA2 A;  4WK7 A;  1KUF A;  1BUD A;  1B8Y A;  5D3C A;  1XFV A;  3L0T A;  2ERQ A;  1BQQ M;  1CXV A;  1QIA A;  1QJJ A;  3KEC A;  3KMC A;  3KME A;  4DD8 A;  2W12 A;  4PKU A;  1QJI A;  2SRT A;  1G9K A;  1I1I P;  4H2E A;  5D7W A;  3VI1 A;  1I73 A;  2YB9 A;  3KRY A;  1JH1 A;  1GO7 P;  5B5O A;  1BKC E;  3DWB A;  3F19 A;  2O3E A;  1UEA A;  2JSD A;  1QIB A;  1J7N A;  4DF9 A;  2PJT A;  1MMB A;  1Y0V A;  3K7L A;  1DMT A;  3LJT A;  4H3X A;  1G49 A;  3RTT A;  3LQB A;  2JT6 A;  1AKL A;  2J83 A;  2CKI A;  4JIJ A;  1O0T A;  4G0D A;  2K9C A;  3DPF A;  1HY7 A;  1JIW P;  5H8X A;  2XS3 A;  1CGL A;  2OY4 A;  1PWW A;  2AYK A;  2WO9 A;  1G05 A;  1BZS A;  4IN9 A;  3ZXH A;  1PWV A;  3B2Z A;  1CGE A;  3Q2G A;  5BOY A;  2Y6C A;  5I4O A;  1EB6 A;  1JAN A;  4A7B A;  2TCL A;  1BKC I;  1IAG A;  1OM6 A;  1R1I A;  1GKC A;  2OXW A;  3DPE A;  1ROS A;  1XUR A;  5JMY A;  2W14 A;  2POJ A;  3LUM A;  3HB2 P;  3EDZ A;  1YCM A;  1MMP A;  1KUI A;  3LE9 A;  1JKY A;  3BA0 A;  3P1V A;  4JPA A;  3TVC A;  4PKW A;  4FXQ A;  1WNI A;  2I47 A;  1XFX A;  1RMZ A;  5I3M A;  3LK8 A;  2OY2 A;  3KWV C;  1OMJ A;  2E3X A;  2CLT A;  3F1A A;  4AIG A;  3Q2H A;  3ZVS A;  1FM1 A;  1Q3A A;  4FXY P;  3K7N A;  4L19 A;  1OO9 A;  3B8Z A;  1K7G A;  1PWQ A;  3EDI A;  1G4K A;  4R3V A;  3O2X A;  1CIZ A;  3KHI A;  3HDB A;  1SLN A;  3DNG A;  1CAQ A;  4CTH A;  2QPJ A;  3OHL A;  1JAP A;  1EAK A;  1OM7 A;  4PKQ A;  1USN A;  5LAB A;  1SU3 A;  1GKD A;  4J4M A;  3EDG A;  2L0R A;  1HFC A;  4QKZ A;  4H30 A;  3WV3 A;  5BPA A;  1UMT A;  1AYK A;  1ATL A;  4GR8 A;  1HV5 A;  3EWJ A;  3USN A;  4FU4 A;  1D8M A;  3TT4 A;  4L63 A;  456C A;  1EUB A;  5L7F A;  2ERP A;  1ZS0 A;  1AST A;  5I0L A;  2JNP A;  1OM8 A;  3DL1 A;  2MZH A;  4XM6 A;  1IAD A;  4PKR A;  1I76 A;  2FV9 A;  2Z2D A;  2O36 A;  830C A;  2DW0 A;  4JP4 A;  5D1S A;  1QIC A;  1GE7 A;  5CXA A;  4GQL A;  1SLM A;  3P24 A;  1K7I A;  2N8R A;  4IJO A;  4PKS A;  2OXZ A;  1JJ9 A;  3UVC A;  4Q1L A;  2J0T A;  1ZTQ A;  4IUW A;  4A3W A;  2V4B A;  2Y6D A;  1ZXC A;  1MNC A;  4G9L A;  3LIL A;  3N2U A;  2X7M A;  1BUV M;  3LJG A;  3LMC A;  3ZUK A;  4L6T A;  3WV2 A;  1BIW A;  2FV5 A;  3TSK A;  1QUA A;  5I43 A;  4GR3 A;  1UMS A;  2A8H A;  2DDY A;  1D5J A;  1R1J A;  2MLS A;  1BSW A;  3HY7 A;  2W15 A;  4XCT A;  1B3D A;  1KBC A;  5D1T A;  1BQO A;  1KAP P;  4ZR5 A;  3GBO A;  3G42 A;  5B5P A;  1OS9 A;  4FVL A;  4GWM A;  2WO8 A;  3EHY A;  2DW1 A;  3V96 B;  3F15 A;  1GE6 A;  3HDA P;  3AIG A;  2OW2 A;  2USN A;  1AF0 A;  3O64 A;  4EFS A;  1KUG A;  1ZVX A; 
#chains in the Genus database with same CATH topology
 4AYK A;  2OI0 A;  3ELM A;  3E8R A;  1XAX A;  1ZP5 A;  1A85 A;  1C7K A;  3LQ0 A;  2ERO A;  4AXQ A;  1ZXV A;  1ND1 A;  3N2V A;  1R54 A;  3HBV P;  5D1U A;  1KUK A;  3U1R A;  1SAT A;  1XFZ A;  1GXD A;  2OVZ A;  5CZM A;  2MZI A;  1UTT A;  1XFU A;  4H49 A;  4AUO A;  4H1Q A;  4I35 A;  2W13 A;  3EHX A;  3LUN A;  4GF1 A;  1Y8J A;  2AIG P;  1SMP A;  1K7Q A;  2OW9 A;  3TS4 A;  2OXU A;  1HFS A;  5I2Z A;  1XM5 A;  2RJQ A;  1FLS A;  1JAQ A;  3B92 A;  2E2D A;  1D7X A;  5D2B A;  3DTE A;  1GO8 P;  3HY9 A;  1CQR A;  3LGP A;  4H76 A;  1IAB A;  4HX3 A;  4XBH A;  1C3I A;  3DSL A;  3LIR A;  4PKT A;  4PKV A;  1Z3J A;  4GWN A;  4XM7 A;  1YOU A;  1L6J A;  1XFY A;  4ILW D;  1JIZ A;  1IAE A;  1MMR A;  3CKI A;  3EDH A;  3G5C A;  3AYU A;  3F16 A;  4GUY A;  2WOA A;  2D1N A;  3LKA A;  1XUD A;  3KEK A;  1YP1 A;  3RTS A;  1O0Q A;  4JQG A;  3KEJ A;  2JT5 A;  1R1H A;  3I7G A;  1OS2 A;  2DDF A;  4HMA A;  4WZV A;  3WV1 A;  5BOT A;  1IAA A;  3AYK A;  5L79 A;  3SHI A;  4JA1 A;  1RM8 A;  4GR0 A;  1BM6 A;  1HTD A;  3NX7 A;  1MMQ A;  4H82 A;  4I03 A;  1UTZ A;  1PWP A;  3I7I A;  1JAO A;  1PWU A;  1YQY A;  1BKC A;  2X3A A;  1G12 A;  3F17 A;  1HOV A;  4H84 A;  1CK7 A;  2OVX A;  1C8T A;  2MLR A;  3DTK A;  1GE5 A;  1A86 A;  2KRJ A;  2OW0 A;  2D1O A;  3F18 A;  1D8F A;  1IAC A;  1H71 P;  3LIK A;  1DTH A;  1XUC A;  4WKI A;  2OW1 A;  5CUH A;  2K2G A;  2JIH A;  3HYG A;  4DV8 A;  3OHO A;  1SRP A;  3LJZ A;  2X3C A;  4WKE A;  2RJP A;  966C A;  2MZE A;  1R55 A;  3LEA A;  3L0V A;  4DPE A;  1FBL A;  2HU6 A;  2YIG A;  2DW2 A;  4XM8 A;  2XS4 A;  3VTG A;  1KUH A;  1Y93 A;  2OZR A;  2X3B A;  4WF6 A;  1XFW A;  1CGF A;  3HBU P;  1S4B P;  5I12 A;  4ON1 A;  1JK3 A;  2W0D A;  3MA2 A;  4WK7 A;  1KUF A;  1BUD A;  1B8Y A;  5D3C A;  1XFV A;  3L0T A;  2ERQ A;  1BQQ M;  1CXV A;  1QIA A;  1QJJ A;  3KEC A;  3KMC A;  3KME A;  4DD8 A;  2W12 A;  4PKU A;  1QJI A;  2SRT A;  1G9K A;  1I1I P;  4H2E A;  5D7W A;  3VI1 A;  1I73 A;  2YB9 A;  3KRY A;  1JH1 A;  1GO7 P;  5B5O A;  1BKC E;  3DWB A;  3F19 A;  2O3E A;  1UEA A;  2JSD A;  1QIB A;  1J7N A;  4DF9 A;  2PJT A;  3DTI A;  1MMB A;  1Y0V A;  3K7L A;  1DMT A;  3LJT A;  4H3X A;  1G49 A;  3RTT A;  3LQB A;  2JT6 A;  1AKL A;  2J83 A;  2CKI A;  2YUF A;  4JIJ A;  1O0T A;  4G0D A;  2K9C A;  3DPF A;  1HY7 A;  1JIW P;  5H8X A;  2XS3 A;  1CGL A;  2OY4 A;  1PWW A;  2AYK A;  2WO9 A;  1G05 A;  1BZS A;  4IN9 A;  3ZXH A;  1PWV A;  3B2Z A;  1CGE A;  3Q2G A;  5BOY A;  2Y6C A;  5I4O A;  1EB6 A;  1JAN A;  4A7B A;  2TCL A;  1BKC I;  1IAG A;  1OM6 A;  1R1I A;  1GKC A;  2OXW A;  3DPE A;  1ROS A;  1XUR A;  5JMY A;  2W14 A;  2POJ A;  3LUM A;  3HB2 P;  3EDZ A;  1YCM A;  1MMP A;  1KUI A;  3LE9 A;  1JKY A;  3BA0 A;  3P1V A;  4JPA A;  3TVC A;  4PKW A;  4FXQ A;  1WNI A;  2I47 A;  1XFX A;  1RMZ A;  5I3M A;  3LK8 A;  2OY2 A;  3KWV C;  1OMJ A;  2E3X A;  2CLT A;  3F1A A;  4AIG A;  3Q2H A;  3ZVS A;  1FM1 A;  1Q3A A;  4FXY P;  3K7N A;  4L19 A;  1OO9 A;  3B8Z A;  1K7G A;  1PWQ A;  3EDI A;  1G4K A;  4R3V A;  3O2X A;  1CIZ A;  3KHI A;  3HDB A;  1SLN A;  3DNG A;  1CAQ A;  4CTH A;  2QPJ A;  3OHL A;  1JAP A;  1EAK A;  1OM7 A;  4PKQ A;  1USN A;  5LAB A;  1SU3 A;  1GKD A;  4J4M A;  3EDG A;  2L0R A;  1HFC A;  4QKZ A;  4H30 A;  3WV3 A;  5BPA A;  1UMT A;  1AYK A;  1ATL A;  4GR8 A;  1HV5 A;  3EWJ A;  3USN A;  4FU4 A;  1D8M A;  3TT4 A;  4L63 A;  456C A;  1EUB A;  5L7F A;  2ERP A;  1ZS0 A;  1AST A;  5I0L A;  2JNP A;  1OM8 A;  3DL1 A;  2MZH A;  1TVI A;  4XM6 A;  1IAD A;  4PKR A;  1I76 A;  2FV9 A;  2Z2D A;  2O36 A;  830C A;  2DW0 A;  4JP4 A;  5D1S A;  1QIC A;  1GE7 A;  1OZ9 A;  5CXA A;  4GQL A;  1SLM A;  3P24 A;  1K7I A;  4L7A A;  2N8R A;  4IJO A;  4PKS A;  2OXZ A;  1JJ9 A;  3UVC A;  4Q1L A;  2J0T A;  1ZTQ A;  4IUW A;  4A3W A;  2V4B A;  2Y6D A;  1ZXC A;  1MNC A;  4G9L A;  3LIL A;  3N2U A;  2X7M A;  1BUV M;  3LJG A;  3LMC A;  3ZUK A;  4L6T A;  3WV2 A;  1BIW A;  2FV5 A;  3TSK A;  1QUA A;  5I43 A;  4GR3 A;  1UMS A;  2A8H A;  2DDY A;  1D5J A;  1R1J A;  2MLS A;  1BSW A;  3HY7 A;  2W15 A;  4XCT A;  1B3D A;  1KBC A;  5D1T A;  1BQO A;  1KAP P;  4ZR5 A;  3GBO A;  3G42 A;  5B5P A;  1OS9 A;  4FVL A;  4GWM A;  2WO8 A;  3EHY A;  2DW1 A;  3V96 B;  3F15 A;  1GE6 A;  3HDA P;  3AIG A;  2OW2 A;  2USN A;  1AF0 A;  3O64 A;  4EFS A;  1KUG A;  1ZVX A; 
#chains in the Genus database with same CATH homology
 4AYK A;  2OI0 A;  3ELM A;  3E8R A;  1ZP5 A;  1A85 A;  1C7K A;  3LQ0 A;  2ERO A;  4AXQ A;  1ZXV A;  1ND1 A;  3N2V A;  1R54 A;  3HBV P;  5D1U A;  1KUK A;  3U1R A;  1SAT A;  1XFZ A;  1GXD A;  2OVZ A;  5CZM A;  2MZI A;  1UTT A;  1XFU A;  4H49 A;  4AUO A;  4H1Q A;  4I35 A;  2W13 A;  3EHX A;  3LUN A;  4GF1 A;  1Y8J A;  2AIG P;  1SMP A;  1K7Q A;  2OW9 A;  3TS4 A;  2OXU A;  1HFS A;  5I2Z A;  2RJQ A;  1FLS A;  1JAQ A;  3B92 A;  2E2D A;  1D7X A;  5D2B A;  3DTE A;  1GO8 P;  3HY9 A;  1CQR A;  3LGP A;  4H76 A;  1IAB A;  4HX3 A;  4XBH A;  1C3I A;  3DSL A;  3LIR A;  4PKT A;  4PKV A;  1Z3J A;  4GWN A;  4XM7 A;  1YOU A;  1L6J A;  1XFY A;  4ILW D;  1JIZ A;  1IAE A;  1MMR A;  3CKI A;  3EDH A;  3G5C A;  3AYU A;  3F16 A;  4GUY A;  2WOA A;  2D1N A;  3LKA A;  1XUD A;  3KEK A;  1YP1 A;  3RTS A;  1O0Q A;  4JQG A;  3KEJ A;  2JT5 A;  1R1H A;  3I7G A;  1OS2 A;  2DDF A;  4HMA A;  4WZV A;  3WV1 A;  5BOT A;  1IAA A;  3AYK A;  5L79 A;  3SHI A;  4JA1 A;  1RM8 A;  4GR0 A;  1BM6 A;  1HTD A;  3NX7 A;  1MMQ A;  4H82 A;  4I03 A;  1UTZ A;  1PWP A;  3I7I A;  1JAO A;  1PWU A;  1YQY A;  1BKC A;  2X3A A;  1G12 A;  3F17 A;  1HOV A;  4H84 A;  1CK7 A;  2OVX A;  1C8T A;  2MLR A;  3DTK A;  1GE5 A;  1A86 A;  2KRJ A;  2OW0 A;  2D1O A;  3F18 A;  1D8F A;  1IAC A;  1H71 P;  3LIK A;  1DTH A;  1XUC A;  4WKI A;  2OW1 A;  5CUH A;  2K2G A;  2JIH A;  3HYG A;  4DV8 A;  3OHO A;  1SRP A;  3LJZ A;  2X3C A;  4WKE A;  2RJP A;  966C A;  2MZE A;  1R55 A;  3LEA A;  3L0V A;  4DPE A;  1FBL A;  2HU6 A;  2YIG A;  2DW2 A;  4XM8 A;  2XS4 A;  3VTG A;  1KUH A;  1Y93 A;  2OZR A;  2X3B A;  4WF6 A;  1XFW A;  1CGF A;  3HBU P;  1S4B P;  5I12 A;  4ON1 A;  1JK3 A;  2W0D A;  3MA2 A;  4WK7 A;  1KUF A;  1BUD A;  1B8Y A;  5D3C A;  1XFV A;  3L0T A;  2ERQ A;  1BQQ M;  1CXV A;  1QIA A;  1QJJ A;  3KEC A;  3KMC A;  3KME A;  4DD8 A;  2W12 A;  4PKU A;  1QJI A;  2SRT A;  1G9K A;  1I1I P;  4H2E A;  5D7W A;  3VI1 A;  1I73 A;  2YB9 A;  3KRY A;  1JH1 A;  1GO7 P;  5B5O A;  1BKC E;  3DWB A;  3F19 A;  2O3E A;  1UEA A;  2JSD A;  1QIB A;  1J7N A;  4DF9 A;  2PJT A;  3DTI A;  1MMB A;  1Y0V A;  3K7L A;  1DMT A;  3LJT A;  4H3X A;  1G49 A;  3RTT A;  3LQB A;  2JT6 A;  1AKL A;  2J83 A;  2CKI A;  2YUF A;  4JIJ A;  1O0T A;  4G0D A;  2K9C A;  3DPF A;  1HY7 A;  1JIW P;  5H8X A;  2XS3 A;  1CGL A;  2OY4 A;  1PWW A;  2AYK A;  2WO9 A;  1G05 A;  1BZS A;  4IN9 A;  3ZXH A;  1PWV A;  3B2Z A;  1CGE A;  3Q2G A;  5BOY A;  2Y6C A;  5I4O A;  1EB6 A;  1JAN A;  4A7B A;  2TCL A;  1BKC I;  1IAG A;  1OM6 A;  1R1I A;  1GKC A;  2OXW A;  3DPE A;  1ROS A;  1XUR A;  5JMY A;  2W14 A;  2POJ A;  3LUM A;  3HB2 P;  3EDZ A;  1YCM A;  1MMP A;  1KUI A;  3LE9 A;  1JKY A;  3BA0 A;  3P1V A;  4JPA A;  3TVC A;  4PKW A;  4FXQ A;  1WNI A;  2I47 A;  1XFX A;  1RMZ A;  5I3M A;  3LK8 A;  2OY2 A;  3KWV C;  1OMJ A;  2E3X A;  2CLT A;  3F1A A;  4AIG A;  3Q2H A;  3ZVS A;  1FM1 A;  1Q3A A;  4FXY P;  3K7N A;  4L19 A;  1OO9 A;  3B8Z A;  1K7G A;  1PWQ A;  3EDI A;  1G4K A;  4R3V A;  3O2X A;  1CIZ A;  3KHI A;  3HDB A;  1SLN A;  3DNG A;  1CAQ A;  4CTH A;  2QPJ A;  3OHL A;  1JAP A;  1EAK A;  1OM7 A;  4PKQ A;  1USN A;  5LAB A;  1SU3 A;  1GKD A;  4J4M A;  3EDG A;  2L0R A;  1HFC A;  4QKZ A;  4H30 A;  3WV3 A;  5BPA A;  1UMT A;  1AYK A;  1ATL A;  4GR8 A;  1HV5 A;  3EWJ A;  3USN A;  4FU4 A;  1D8M A;  3TT4 A;  4L63 A;  456C A;  1EUB A;  5L7F A;  2ERP A;  1ZS0 A;  1AST A;  5I0L A;  2JNP A;  1OM8 A;  3DL1 A;  2MZH A;  4XM6 A;  1IAD A;  4PKR A;  1I76 A;  2FV9 A;  2Z2D A;  2O36 A;  830C A;  2DW0 A;  4JP4 A;  5D1S A;  1QIC A;  1GE7 A;  5CXA A;  4GQL A;  1SLM A;  3P24 A;  1K7I A;  4L7A A;  2N8R A;  4IJO A;  4PKS A;  2OXZ A;  1JJ9 A;  3UVC A;  4Q1L A;  2J0T A;  1ZTQ A;  4IUW A;  4A3W A;  2V4B A;  2Y6D A;  1ZXC A;  1MNC A;  4G9L A;  3LIL A;  3N2U A;  2X7M A;  1BUV M;  3LJG A;  3LMC A;  3ZUK A;  4L6T A;  3WV2 A;  1BIW A;  2FV5 A;  3TSK A;  1QUA A;  5I43 A;  4GR3 A;  1UMS A;  2A8H A;  2DDY A;  1D5J A;  1R1J A;  2MLS A;  1BSW A;  3HY7 A;  2W15 A;  4XCT A;  1B3D A;  1KBC A;  5D1T A;  1BQO A;  1KAP P;  4ZR5 A;  3GBO A;  3G42 A;  5B5P A;  1OS9 A;  4FVL A;  4GWM A;  2WO8 A;  3EHY A;  2DW1 A;  3V96 B;  3F15 A;  1GE6 A;  3HDA P;  3AIG A;  2OW2 A;  2USN A;  1AF0 A;  3O64 A;  4EFS A;  1KUG A;  1ZVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...