1QIAA

Crystal structure of stromelysin catalytic domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
IPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STROMELYSIN-1
publication title X-ray structure of human stromelysin catalytic domain complexed with nonpeptide inhibitors: implications for inhibitor selectivity
pubmed rcsb
source organism Homo sapiens
total genus 47
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1999-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1qiaA00
1R1JA 4WKIA 1CQRA 1O0QA 3ELMA 1OM6A 1AYKA 2O3EA 456CA 1OM8A 3KRYA 1G4KA 3LK8A 4GWMA 1R54A 4GUYA 4AXQA 3MA2A 3TSKA 5CXAA 3LGPA 3RTTA 4WKEA 2MZIA 1WNIA 2RJPA 3EDGA 1G05A 4PKQA 5D1UA 1G12A 1ZTQA 3LQ0A 2V4BA 3TS4A 3LUMA 4IJOA 1D8MA 2X3CA 2L0RA 2X3AA 1JIWP 3F1AA 1JAPA 2DW1A 2K2GA 2OW0A 2YIGA 1KBCA 1Y8JA 4Q1LA 4FXYP 1OMJA 1EAKA 1XFZA 1XUCA 2WO9A 5I43A 1KAPP 1CXVA 5L7FA 1MMPA 2WOAA 1PWQA 1Y93A 3EHYA 1JIZA 3WV2A 5I0LA 2W15A 4GQLA 1IAAA 1JAOA 1YOUA 4JA1A 1GXDA 3P1VA 3G42A 3TT4A 4ON1A 1ROSA 5I12A 1AF0A 4L6TA 3SHIA 2W13A 2CKIA 5D2BA 1CAQA 3LQBA 1UMSA 1K7IA 2JT5A 1XURA 2N8RA 1ZP5A 3LIKA 1GE7A 4H30A 3ZVSA 3LEAA 3USNA 1GKCA 2D1OA 2DW2A 2XS4A 2Y6DA 3TVCA 1JANA 5I2ZA 1B8YA 2CLTA 1IAGA 4XM7A 1XUDA 1ASTA 1UTZA 1XFYA 3HDAP 1JJ9A 3GBOA 3B2ZA 1SMPA 2OVZA 4J4MA 2O36A 1KUFA 4DV8A 2AYKA 3HDBA 4G0DA 1SATA 3EWJA 1ZXVA 2EROA 4GF1A 1QIBA 3VTGA 1EUBA 1A86A 1QUAA 1C7KA 2OI0A 1HFCA 3B92A 5I4OA 1FM1A 1FBLA 5BOTA 3DL1A 5BPAA 1PWUA 1R1IA 3Q2GA 1BQQM 1KUGA 1JH1A 1SLNA 4XCTA 4FXQA 4PKVA 1A85A 5L79A 2FV5A 2QPJA 2OW1A 3KMCA 3ZUKA 3UVCA 1JKYA 3AIGA 2FV9A 4JPAA 1CGFA 3B8ZA 1CGLA 5BOYA 2Y6CA 4GR8A 3I7IA 2WO8A 3LJZA 4H1QA 3F16A 1IACA 4WZVA 3L0TA 4JQGA 966CA 5CUHA 3CKIA 3EHXA 4PKUA 1MMBA 4A3WA 1D7XA 3KEKA 2W14A 4WK7A 3LMCA 3N2UA 1XFXA 4GR3A 1BUVM 2RJQA 3OHLA 4CTHA 1HOVA 3LKAA 2JIHA 4I35A 2MLSA 2MZHA 1JK3A 1HV5A 1OS2A 2OY4A 3KMEA 3F15A 1ATLA 4PKTA 1GE6A 3LIRA 4ZR5A 3DSLA 1BQOA 1SRPA 2DDYA 2KRJA 2TCLA 4JP4A 1J7NA 1GKDA 1QJJA 1CIZA 2AIGP 1JAQA 3EDHA 1MMRA 2MLRA 1YP1A 1G49A 3L0VA 1CK7A 2X7MA 1IABA 2OZRA 1RM8A 2ERPA 1GO7P 3E8RA 4JIJA 2OY2A 4FU4A 3HY9A 1BKCA 1I73A 3DNGA 3AYKA 1OM7A 1ZXCA 3AYUA 1G9KA 2DW0A 3N2VA 1QICA 1R55A 4XM6A 3HY7A 2I47A 4H49A 1BUDA 2JT6A 1KUIA 2W12A 1UTTA 1XFUA 5LABA 1MMQA 3EDZA 3Q2HA 2SRTA 2OW2A 4GWNA 2E2DA 1D8FA 1K7GA 3F17A 4H76A 2USNA 1KUKA 1CGEA 1C3IA 1OS9A 3NX7A 3F18A 1MNCA 1KUHA 4EFSA 3O64A 1B3DA 2DDFA 2OVXA 3V96B 5D1TA 1O0TA 4L19A 2J83A 2A8HA 1BKCE 2YB9A 1Q3AA 1S4BP 2JSDA 2OXUA 5H8XA 3KWVC 2OW9A 4PKSA 3DWBA 3HYGA 5B5PA 4H82A 2X3BA 4R3VA 830CA 1XFVA 3EDIA 1Z3JA 1YQYA 4I03A 1DTHA 3VI1A 5I3MA 5B5OA 1BZSA 1UMTA 1OO9A 2J0TA 3LJGA 2D1NA 4XM8A 1Y0VA 4XBHA 1HTDA 4QKZA 1K7QA 2JNPA 2PJTA 3P24A 3DPFA 1I1IP 1BM6A 4AIGA 2OXZA 3KHIA 1PWWA 1D5JA 3BA0A 1GO8P 2POJA 2ERQA 1PWVA 3RTSA 1C8TA 1GE5A 1ZS0A 4PKWA 1SU3A 5JMYA 4H3XA 1PWPA 4H2EA 5D7WA 1BSWA 5D3CA 4AUOA 1USNA 4IN9A 1HY7A 1QIAA 1ZVXA 4L63A 3LJTA 4WF6A 2OXWA 4DF9A 4HX3A 2E3XA 3F19A 2HU6A 4G9LA 1H71P 3WV1A 4DD8A 1XFWA 2W0DA 1ND1A 3HB2P 1UEAA 1FLSA 1BKCI 1BIWA 1SLMA 1I76A 3K7LA 3LILA 3U1RA 2XS3A 3WV3A 3HBVP 3OHOA 2K9CA 1R1HA 4HMAA 1AKLA 3HBUP 1DMTA 3K7NA 1IADA 5D1SA 4PKRA 4IUWA 5CZMA 3G5CA 3KEJA 1EB6A 1IAEA 3O2XA 4FVLA 4ILWD 4A7BA 1YCMA 4AYKA 2MZEA 4H84A 2Z2DA 3ZXHA 3I7GA 3DPEA 4DPEA 4GR0A 1RMZA 3KECA 1HFSA 1QJIA 3LUNA 1L6JA 3LE9A
chains in the Genus database with same CATH superfamily
1R1JA 4WKIA 1CQRA 1O0QA 3ELMA 1OM6A 1AYKA 2O3EA 456CA 1OM8A 3KRYA 1G4KA 3LK8A 4GWMA 1R54A 4GUYA 4AXQA 3MA2A 3TSKA 5CXAA 3LGPA 3RTTA 4WKEA 2MZIA 1WNIA 2RJPA 3EDGA 1G05A 4PKQA 5D1UA 1G12A 1ZTQA 3LQ0A 2V4BA 3TS4A 3LUMA 4IJOA 1D8MA 2X3CA 2L0RA 2X3AA 1JIWP 3F1AA 1JAPA 2DW1A 2K2GA 2OW0A 2YIGA 1KBCA 1Y8JA 4Q1LA 4FXYP 1OMJA 1EAKA 1XAXA 1XFZA 1XUCA 2WO9A 3DTIA 5I43A 1KAPP 1CXVA 5L7FA 1MMPA 2WOAA 1PWQA 1Y93A 3EHYA 1JIZA 3WV2A 5I0LA 2W15A 4GQLA 1IAAA 1JAOA 1YOUA 4JA1A 1GXDA 3P1VA 3G42A 3TT4A 4ON1A 1ROSA 5I12A 1AF0A 4L6TA 3SHIA 2W13A 2CKIA 5D2BA 1CAQA 3LQBA 1UMSA 1K7IA 2JT5A 1XURA 2N8RA 4L7AA 1ZP5A 3LIKA 1GE7A 3DTKA 4H30A 3ZVSA 3LEAA 3USNA 1GKCA 2D1OA 2DW2A 2XS4A 2Y6DA 3TVCA 1JANA 5I2ZA 1B8YA 2CLTA 1IAGA 4XM7A 1XUDA 1ASTA 1UTZA 1XFYA 3HDAP 1JJ9A 3GBOA 3B2ZA 1SMPA 2OVZA 4J4MA 2O36A 1KUFA 4DV8A 2AYKA 3HDBA 4G0DA 1SATA 3EWJA 1ZXVA 2EROA 4GF1A 1QIBA 3VTGA 1EUBA 1A86A 1QUAA 1C7KA 2OI0A 1HFCA 3B92A 5I4OA 1FM1A 1FBLA 5BOTA 3DL1A 5BPAA 1PWUA 1R1IA 3Q2GA 1BQQM 1KUGA 1JH1A 1SLNA 4XCTA 4FXQA 4PKVA 1A85A 5L79A 2FV5A 2QPJA 2OW1A 3KMCA 3ZUKA 3UVCA 1JKYA 3AIGA 2FV9A 4JPAA 1CGFA 3B8ZA 1CGLA 5BOYA 2Y6CA 4GR8A 3I7IA 2WO8A 3LJZA 4H1QA 3F16A 1IACA 4WZVA 3L0TA 4JQGA 966CA 5CUHA 3CKIA 3EHXA 4PKUA 1MMBA 4A3WA 1D7XA 3KEKA 2W14A 4WK7A 3LMCA 1XM5A 3N2UA 1XFXA 4GR3A 1BUVM 2RJQA 3OHLA 4CTHA 1HOVA 3LKAA 2JIHA 4I35A 2MLSA 2MZHA 1JK3A 1HV5A 1OS2A 1TVIA 2OY4A 3KMEA 3F15A 1ATLA 4PKTA 1GE6A 3LIRA 4ZR5A 3DSLA 1BQOA 1SRPA 2DDYA 2KRJA 2TCLA 4JP4A 1J7NA 1GKDA 1QJJA 1CIZA 2AIGP 1JAQA 3EDHA 1MMRA 2MLRA 1YP1A 1G49A 3L0VA 1CK7A 2X7MA 1IABA 2OZRA 1RM8A 2ERPA 1GO7P 3E8RA 4JIJA 2OY2A 4FU4A 3HY9A 1BKCA 1I73A 3DNGA 3AYKA 1OM7A 1ZXCA 3AYUA 1G9KA 2DW0A 3N2VA 1QICA 1R55A 4XM6A 3HY7A 2I47A 4H49A 1BUDA 2JT6A 1KUIA 2W12A 1UTTA 1XFUA 5LABA 1MMQA 3EDZA 3Q2HA 2SRTA 2OW2A 4GWNA 2E2DA 1D8FA 1K7GA 3F17A 4H76A 2USNA 1KUKA 1CGEA 1C3IA 1OS9A 3NX7A 3F18A 1MNCA 1KUHA 4EFSA 3O64A 1B3DA 2DDFA 2OVXA 3V96B 5D1TA 1O0TA 4L19A 2J83A 1OZ9A 2A8HA 1BKCE 2YB9A 1Q3AA 1S4BP 2JSDA 2OXUA 5H8XA 3KWVC 2OW9A 4PKSA 3DWBA 3HYGA 5B5PA 4H82A 2X3BA 4R3VA 830CA 1XFVA 3EDIA 1Z3JA 1YQYA 4I03A 1DTHA 3VI1A 5I3MA 5B5OA 1BZSA 1UMTA 1OO9A 2J0TA 3LJGA 2D1NA 4XM8A 2YUFA 1Y0VA 4XBHA 1HTDA 4QKZA 1K7QA 2JNPA 2PJTA 3P24A 3DPFA 1I1IP 1BM6A 4AIGA 2OXZA 3KHIA 1PWWA 1D5JA 3BA0A 1GO8P 2POJA 2ERQA 1PWVA 3RTSA 1C8TA 1GE5A 1ZS0A 4PKWA 1SU3A 5JMYA 4H3XA 1PWPA 4H2EA 5D7WA 1BSWA 5D3CA 4AUOA 1USNA 4IN9A 1HY7A 1QIAA 1ZVXA 4L63A 3LJTA 4WF6A 2OXWA 4DF9A 4HX3A 2E3XA 3F19A 2HU6A 4G9LA 1H71P 3WV1A 4DD8A 1XFWA 2W0DA 1ND1A 3HB2P 1UEAA 1FLSA 1BKCI 1BIWA 1SLMA 1I76A 3K7LA 3LILA 3U1RA 2XS3A 3WV3A 3HBVP 3OHOA 2K9CA 1R1HA 4HMAA 1AKLA 3HBUP 1DMTA 3K7NA 1IADA 5D1SA 4PKRA 4IUWA 5CZMA 3G5CA 3KEJA 1EB6A 1IAEA 3O2XA 4FVLA 4ILWD 4A7BA 1YCMA 4AYKA 2MZEA 4H84A 2Z2DA 3ZXHA 3I7GA 3DPEA 3DTEA 4DPEA 4GR0A 1RMZA 3KECA 1HFSA 1QJIA 3LUNA 1L6JA 3LE9A
chains in the Genus database with same CATH topology
1R1JA 4WKIA 1CQRA 1O0QA 3ELMA 1OM6A 1AYKA 2O3EA 456CA 1OM8A 3KRYA 1G4KA 3LK8A 4GWMA 1R54A 4GUYA 4AXQA 3MA2A 3TSKA 5CXAA 3LGPA 3RTTA 4WKEA 2MZIA 1WNIA 2RJPA 3EDGA 1G05A 4PKQA 5D1UA 1G12A 1ZTQA 3LQ0A 2V4BA 3TS4A 3LUMA 4IJOA 1D8MA 2X3CA 2L0RA 2X3AA 1JIWP 3F1AA 1JAPA 2DW1A 2K2GA 2OW0A 2YIGA 1KBCA 1Y8JA 4Q1LA 4FXYP 1OMJA 1EAKA 1XFZA 1XUCA 2WO9A 3DTIA 5I43A 1KAPP 1CXVA 5L7FA 1MMPA 2WOAA 1PWQA 1Y93A 3EHYA 1JIZA 3WV2A 5I0LA 2W15A 4GQLA 1IAAA 1JAOA 1YOUA 4JA1A 1GXDA 3P1VA 3G42A 3TT4A 4ON1A 1ROSA 5I12A 1AF0A 4L6TA 3SHIA 2W13A 2CKIA 5D2BA 1CAQA 3LQBA 1UMSA 1K7IA 2JT5A 1XURA 2N8RA 4L7AA 1ZP5A 3LIKA 1GE7A 3DTKA 4H30A 3ZVSA 3LEAA 3USNA 1GKCA 2D1OA 2DW2A 2XS4A 2Y6DA 3TVCA 1JANA 5I2ZA 1B8YA 2CLTA 1IAGA 4XM7A 1XUDA 1ASTA 1UTZA 1XFYA 3HDAP 1JJ9A 3GBOA 3B2ZA 1SMPA 2OVZA 4J4MA 2O36A 1KUFA 4DV8A 2AYKA 3HDBA 4G0DA 1SATA 3EWJA 1ZXVA 2EROA 4GF1A 1QIBA 3VTGA 1EUBA 1A86A 1QUAA 1C7KA 2OI0A 1HFCA 3B92A 5I4OA 1FM1A 1FBLA 5BOTA 3DL1A 5BPAA 1PWUA 1R1IA 3Q2GA 1BQQM 1KUGA 1JH1A 1SLNA 4XCTA 4FXQA 4PKVA 1A85A 5L79A 2FV5A 2QPJA 2OW1A 3KMCA 3ZUKA 3UVCA 1JKYA 3AIGA 2FV9A 4JPAA 1CGFA 3B8ZA 1CGLA 5BOYA 2Y6CA 4GR8A 3I7IA 2WO8A 3LJZA 4H1QA 3F16A 1IACA 4WZVA 3L0TA 4JQGA 966CA 5CUHA 3CKIA 3EHXA 4PKUA 1MMBA 4A3WA 1D7XA 3KEKA 2W14A 4WK7A 3LMCA 3N2UA 1XFXA 4GR3A 1BUVM 2RJQA 3OHLA 4CTHA 1HOVA 3LKAA 2JIHA 4I35A 2MLSA 2MZHA 1JK3A 1HV5A 1OS2A 2OY4A 3KMEA 3F15A 1ATLA 4PKTA 1GE6A 3LIRA 4ZR5A 3DSLA 1BQOA 1SRPA 2DDYA 2KRJA 2TCLA 4JP4A 1J7NA 1GKDA 1QJJA 1CIZA 2AIGP 1JAQA 3EDHA 1MMRA 2MLRA 1YP1A 1G49A 3L0VA 1CK7A 2X7MA 1IABA 2OZRA 1RM8A 2ERPA 1GO7P 3E8RA 4JIJA 2OY2A 4FU4A 3HY9A 1BKCA 1I73A 3DNGA 3AYKA 1OM7A 1ZXCA 3AYUA 1G9KA 2DW0A 3N2VA 1QICA 1R55A 4XM6A 3HY7A 2I47A 4H49A 1BUDA 2JT6A 1KUIA 2W12A 1UTTA 1XFUA 5LABA 1MMQA 3EDZA 3Q2HA 2SRTA 2OW2A 4GWNA 2E2DA 1D8FA 1K7GA 3F17A 4H76A 2USNA 1KUKA 1CGEA 1C3IA 1OS9A 3NX7A 3F18A 1MNCA 1KUHA 4EFSA 3O64A 1B3DA 2DDFA 2OVXA 3V96B 5D1TA 1O0TA 4L19A 2J83A 2A8HA 1BKCE 2YB9A 1Q3AA 1S4BP 2JSDA 2OXUA 5H8XA 3KWVC 2OW9A 4PKSA 3DWBA 3HYGA 5B5PA 4H82A 2X3BA 4R3VA 830CA 1XFVA 3EDIA 1Z3JA 1YQYA 4I03A 1DTHA 3VI1A 5I3MA 5B5OA 1BZSA 1UMTA 1OO9A 2J0TA 3LJGA 2D1NA 4XM8A 2YUFA 1Y0VA 4XBHA 1HTDA 4QKZA 1K7QA 2JNPA 2PJTA 3P24A 3DPFA 1I1IP 1BM6A 4AIGA 2OXZA 3KHIA 1PWWA 1D5JA 3BA0A 1GO8P 2POJA 2ERQA 1PWVA 3RTSA 1C8TA 1GE5A 1ZS0A 4PKWA 1SU3A 5JMYA 4H3XA 1PWPA 4H2EA 5D7WA 1BSWA 5D3CA 4AUOA 1USNA 4IN9A 1HY7A 1QIAA 1ZVXA 4L63A 3LJTA 4WF6A 2OXWA 4DF9A 4HX3A 2E3XA 3F19A 2HU6A 4G9LA 1H71P 3WV1A 4DD8A 1XFWA 2W0DA 1ND1A 3HB2P 1UEAA 1FLSA 1BKCI 1BIWA 1SLMA 1I76A 3K7LA 3LILA 3U1RA 2XS3A 3WV3A 3HBVP 3OHOA 2K9CA 1R1HA 4HMAA 1AKLA 3HBUP 1DMTA 3K7NA 1IADA 5D1SA 4PKRA 4IUWA 5CZMA 3G5CA 3KEJA 1EB6A 1IAEA 3O2XA 4FVLA 4ILWD 4A7BA 1YCMA 4AYKA 2MZEA 4H84A 2Z2DA 3ZXHA 3I7GA 3DPEA 3DTEA 4DPEA 4GR0A 1RMZA 3KECA 1HFSA 1QJIA 3LUNA 1L6JA 3LE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1J A;  4WKI A;  1CQR A;  1O0Q A;  3ELM A;  1OM6 A;  1AYK A;  2O3E A;  456C A;  1OM8 A;  3KRY A;  1G4K A;  3LK8 A;  4GWM A;  1R54 A;  4GUY A;  4AXQ A;  3MA2 A;  3TSK A;  5CXA A;  3LGP A;  3RTT A;  4WKE A;  2MZI A;  1WNI A;  2RJP A;  3EDG A;  1G05 A;  4PKQ A;  5D1U A;  1G12 A;  1ZTQ A;  3LQ0 A;  2V4B A;  3TS4 A;  3LUM A;  4IJO A;  1D8M A;  2X3C A;  2L0R A;  2X3A A;  1JIW P;  3F1A A;  1JAP A;  2DW1 A;  2K2G A;  2OW0 A;  2YIG A;  1KBC A;  1Y8J A;  4Q1L A;  4FXY P;  1OMJ A;  1EAK A;  1XFZ A;  1XUC A;  2WO9 A;  5I43 A;  1KAP P;  1CXV A;  5L7F A;  1MMP A;  2WOA A;  1PWQ A;  1Y93 A;  3EHY A;  1JIZ A;  3WV2 A;  5I0L A;  2W15 A;  4GQL A;  1IAA A;  1JAO A;  1YOU A;  4JA1 A;  1GXD A;  3P1V A;  3G42 A;  3TT4 A;  4ON1 A;  1ROS A;  5I12 A;  1AF0 A;  4L6T A;  3SHI A;  2W13 A;  2CKI A;  5D2B A;  1CAQ A;  3LQB A;  1UMS A;  1K7I A;  2JT5 A;  1XUR A;  2N8R A;  1ZP5 A;  3LIK A;  1GE7 A;  4H30 A;  3ZVS A;  3LEA A;  3USN A;  1GKC A;  2D1O A;  2DW2 A;  2XS4 A;  2Y6D A;  3TVC A;  1JAN A;  5I2Z A;  1B8Y A;  2CLT A;  1IAG A;  4XM7 A;  1XUD A;  1AST A;  1UTZ A;  1XFY A;  3HDA P;  1JJ9 A;  3GBO A;  3B2Z A;  1SMP A;  2OVZ A;  4J4M A;  2O36 A;  1KUF A;  4DV8 A;  2AYK A;  3HDB A;  4G0D A;  1SAT A;  3EWJ A;  1ZXV A;  2ERO A;  4GF1 A;  1QIB A;  3VTG A;  1EUB A;  1A86 A;  1QUA A;  1C7K A;  2OI0 A;  1HFC A;  3B92 A;  5I4O A;  1FM1 A;  1FBL A;  5BOT A;  3DL1 A;  5BPA A;  1PWU A;  1R1I A;  3Q2G A;  1BQQ M;  1KUG A;  1JH1 A;  1SLN A;  4XCT A;  4FXQ A;  4PKV A;  1A85 A;  5L79 A;  2FV5 A;  2QPJ A;  2OW1 A;  3KMC A;  3ZUK A;  3UVC A;  1JKY A;  3AIG A;  2FV9 A;  4JPA A;  1CGF A;  3B8Z A;  1CGL A;  5BOY A;  2Y6C A;  4GR8 A;  3I7I A;  2WO8 A;  3LJZ A;  4H1Q A;  3F16 A;  1IAC A;  4WZV A;  3L0T A;  4JQG A;  966C A;  5CUH A;  3CKI A;  3EHX A;  4PKU A;  1MMB A;  4A3W A;  1D7X A;  3KEK A;  2W14 A;  4WK7 A;  3LMC A;  3N2U A;  1XFX A;  4GR3 A;  1BUV M;  2RJQ A;  3OHL A;  4CTH A;  1HOV A;  3LKA A;  2JIH A;  4I35 A;  2MLS A;  2MZH A;  1JK3 A;  1HV5 A;  1OS2 A;  2OY4 A;  3KME A;  3F15 A;  1ATL A;  4PKT A;  1GE6 A;  3LIR A;  4ZR5 A;  3DSL A;  1BQO A;  1SRP A;  2DDY A;  2KRJ A;  2TCL A;  4JP4 A;  1J7N A;  1GKD A;  1QJJ A;  1CIZ A;  2AIG P;  1JAQ A;  3EDH A;  1MMR A;  2MLR A;  1YP1 A;  1G49 A;  3L0V A;  1CK7 A;  2X7M A;  1IAB A;  2OZR A;  1RM8 A;  2ERP A;  1GO7 P;  3E8R A;  4JIJ A;  2OY2 A;  4FU4 A;  3HY9 A;  1BKC A;  1I73 A;  3DNG A;  3AYK A;  1OM7 A;  1ZXC A;  3AYU A;  1G9K A;  2DW0 A;  3N2V A;  1QIC A;  1R55 A;  4XM6 A;  3HY7 A;  2I47 A;  4H49 A;  1BUD A;  2JT6 A;  1KUI A;  2W12 A;  1UTT A;  1XFU A;  5LAB A;  1MMQ A;  3EDZ A;  3Q2H A;  2SRT A;  2OW2 A;  4GWN A;  2E2D A;  1D8F A;  1K7G A;  3F17 A;  4H76 A;  2USN A;  1KUK A;  1CGE A;  1C3I A;  1OS9 A;  3NX7 A;  3F18 A;  1MNC A;  1KUH A;  4EFS A;  3O64 A;  1B3D A;  2DDF A;  2OVX A;  3V96 B;  5D1T A;  1O0T A;  4L19 A;  2J83 A;  2A8H A;  1BKC E;  2YB9 A;  1Q3A A;  1S4B P;  2JSD A;  2OXU A;  5H8X A;  3KWV C;  2OW9 A;  4PKS A;  3DWB A;  3HYG A;  5B5P A;  4H82 A;  2X3B A;  4R3V A;  830C A;  1XFV A;  3EDI A;  1Z3J A;  1YQY A;  4I03 A;  1DTH A;  3VI1 A;  5I3M A;  5B5O A;  1BZS A;  1UMT A;  1OO9 A;  2J0T A;  3LJG A;  2D1N A;  4XM8 A;  1Y0V A;  4XBH A;  1HTD A;  4QKZ A;  1K7Q A;  2JNP A;  2PJT A;  3P24 A;  3DPF A;  1I1I P;  1BM6 A;  4AIG A;  2OXZ A;  3KHI A;  1PWW A;  1D5J A;  3BA0 A;  1GO8 P;  2POJ A;  2ERQ A;  1PWV A;  3RTS A;  1C8T A;  1GE5 A;  1ZS0 A;  4PKW A;  1SU3 A;  5JMY A;  4H3X A;  1PWP A;  4H2E A;  5D7W A;  1BSW A;  5D3C A;  4AUO A;  1USN A;  4IN9 A;  1HY7 A;  1QIA A;  1ZVX A;  4L63 A;  3LJT A;  4WF6 A;  2OXW A;  4DF9 A;  4HX3 A;  2E3X A;  3F19 A;  2HU6 A;  4G9L A;  1H71 P;  3WV1 A;  4DD8 A;  1XFW A;  2W0D A;  1ND1 A;  3HB2 P;  1UEA A;  1FLS A;  1BKC I;  1BIW A;  1SLM A;  1I76 A;  3K7L A;  3LIL A;  3U1R A;  2XS3 A;  3WV3 A;  3HBV P;  3OHO A;  2K9C A;  1R1H A;  4HMA A;  1AKL A;  3HBU P;  1DMT A;  3K7N A;  1IAD A;  5D1S A;  4PKR A;  4IUW A;  5CZM A;  3G5C A;  3KEJ A;  1EB6 A;  1IAE A;  3O2X A;  4FVL A;  4ILW D;  4A7B A;  1YCM A;  4AYK A;  2MZE A;  4H84 A;  2Z2D A;  3ZXH A;  3I7G A;  3DPE A;  4DPE A;  4GR0 A;  1RMZ A;  3KEC A;  1HFS A;  1QJI A;  3LUN A;  1L6J A;  3LE9 A; 
#chains in the Genus database with same CATH topology
 1R1J A;  4WKI A;  1CQR A;  1O0Q A;  3ELM A;  1OM6 A;  1AYK A;  2O3E A;  456C A;  1OM8 A;  3KRY A;  1G4K A;  3LK8 A;  4GWM A;  1R54 A;  4GUY A;  4AXQ A;  3MA2 A;  3TSK A;  5CXA A;  3LGP A;  3RTT A;  4WKE A;  2MZI A;  1WNI A;  2RJP A;  3EDG A;  1G05 A;  4PKQ A;  5D1U A;  1G12 A;  1ZTQ A;  3LQ0 A;  2V4B A;  3TS4 A;  3LUM A;  4IJO A;  1D8M A;  2X3C A;  2L0R A;  2X3A A;  1JIW P;  3F1A A;  1JAP A;  2DW1 A;  2K2G A;  2OW0 A;  2YIG A;  1KBC A;  1Y8J A;  4Q1L A;  4FXY P;  1OMJ A;  1EAK A;  1XAX A;  1XFZ A;  1XUC A;  2WO9 A;  3DTI A;  5I43 A;  1KAP P;  1CXV A;  5L7F A;  1MMP A;  2WOA A;  1PWQ A;  1Y93 A;  3EHY A;  1JIZ A;  3WV2 A;  5I0L A;  2W15 A;  4GQL A;  1IAA A;  1JAO A;  1YOU A;  4JA1 A;  1GXD A;  3P1V A;  3G42 A;  3TT4 A;  4ON1 A;  1ROS A;  5I12 A;  1AF0 A;  4L6T A;  3SHI A;  2W13 A;  2CKI A;  5D2B A;  1CAQ A;  3LQB A;  1UMS A;  1K7I A;  2JT5 A;  1XUR A;  2N8R A;  4L7A A;  1ZP5 A;  3LIK A;  1GE7 A;  3DTK A;  4H30 A;  3ZVS A;  3LEA A;  3USN A;  1GKC A;  2D1O A;  2DW2 A;  2XS4 A;  2Y6D A;  3TVC A;  1JAN A;  5I2Z A;  1B8Y A;  2CLT A;  1IAG A;  4XM7 A;  1XUD A;  1AST A;  1UTZ A;  1XFY A;  3HDA P;  1JJ9 A;  3GBO A;  3B2Z A;  1SMP A;  2OVZ A;  4J4M A;  2O36 A;  1KUF A;  4DV8 A;  2AYK A;  3HDB A;  4G0D A;  1SAT A;  3EWJ A;  1ZXV A;  2ERO A;  4GF1 A;  1QIB A;  3VTG A;  1EUB A;  1A86 A;  1QUA A;  1C7K A;  2OI0 A;  1HFC A;  3B92 A;  5I4O A;  1FM1 A;  1FBL A;  5BOT A;  3DL1 A;  5BPA A;  1PWU A;  1R1I A;  3Q2G A;  1BQQ M;  1KUG A;  1JH1 A;  1SLN A;  4XCT A;  4FXQ A;  4PKV A;  1A85 A;  5L79 A;  2FV5 A;  2QPJ A;  2OW1 A;  3KMC A;  3ZUK A;  3UVC A;  1JKY A;  3AIG A;  2FV9 A;  4JPA A;  1CGF A;  3B8Z A;  1CGL A;  5BOY A;  2Y6C A;  4GR8 A;  3I7I A;  2WO8 A;  3LJZ A;  4H1Q A;  3F16 A;  1IAC A;  4WZV A;  3L0T A;  4JQG A;  966C A;  5CUH A;  3CKI A;  3EHX A;  4PKU A;  1MMB A;  4A3W A;  1D7X A;  3KEK A;  2W14 A;  4WK7 A;  3LMC A;  1XM5 A;  3N2U A;  1XFX A;  4GR3 A;  1BUV M;  2RJQ A;  3OHL A;  4CTH A;  1HOV A;  3LKA A;  2JIH A;  4I35 A;  2MLS A;  2MZH A;  1JK3 A;  1HV5 A;  1OS2 A;  1TVI A;  2OY4 A;  3KME A;  3F15 A;  1ATL A;  4PKT A;  1GE6 A;  3LIR A;  4ZR5 A;  3DSL A;  1BQO A;  1SRP A;  2DDY A;  2KRJ A;  2TCL A;  4JP4 A;  1J7N A;  1GKD A;  1QJJ A;  1CIZ A;  2AIG P;  1JAQ A;  3EDH A;  1MMR A;  2MLR A;  1YP1 A;  1G49 A;  3L0V A;  1CK7 A;  2X7M A;  1IAB A;  2OZR A;  1RM8 A;  2ERP A;  1GO7 P;  3E8R A;  4JIJ A;  2OY2 A;  4FU4 A;  3HY9 A;  1BKC A;  1I73 A;  3DNG A;  3AYK A;  1OM7 A;  1ZXC A;  3AYU A;  1G9K A;  2DW0 A;  3N2V A;  1QIC A;  1R55 A;  4XM6 A;  3HY7 A;  2I47 A;  4H49 A;  1BUD A;  2JT6 A;  1KUI A;  2W12 A;  1UTT A;  1XFU A;  5LAB A;  1MMQ A;  3EDZ A;  3Q2H A;  2SRT A;  2OW2 A;  4GWN A;  2E2D A;  1D8F A;  1K7G A;  3F17 A;  4H76 A;  2USN A;  1KUK A;  1CGE A;  1C3I A;  1OS9 A;  3NX7 A;  3F18 A;  1MNC A;  1KUH A;  4EFS A;  3O64 A;  1B3D A;  2DDF A;  2OVX A;  3V96 B;  5D1T A;  1O0T A;  4L19 A;  2J83 A;  1OZ9 A;  2A8H A;  1BKC E;  2YB9 A;  1Q3A A;  1S4B P;  2JSD A;  2OXU A;  5H8X A;  3KWV C;  2OW9 A;  4PKS A;  3DWB A;  3HYG A;  5B5P A;  4H82 A;  2X3B A;  4R3V A;  830C A;  1XFV A;  3EDI A;  1Z3J A;  1YQY A;  4I03 A;  1DTH A;  3VI1 A;  5I3M A;  5B5O A;  1BZS A;  1UMT A;  1OO9 A;  2J0T A;  3LJG A;  2D1N A;  4XM8 A;  2YUF A;  1Y0V A;  4XBH A;  1HTD A;  4QKZ A;  1K7Q A;  2JNP A;  2PJT A;  3P24 A;  3DPF A;  1I1I P;  1BM6 A;  4AIG A;  2OXZ A;  3KHI A;  1PWW A;  1D5J A;  3BA0 A;  1GO8 P;  2POJ A;  2ERQ A;  1PWV A;  3RTS A;  1C8T A;  1GE5 A;  1ZS0 A;  4PKW A;  1SU3 A;  5JMY A;  4H3X A;  1PWP A;  4H2E A;  5D7W A;  1BSW A;  5D3C A;  4AUO A;  1USN A;  4IN9 A;  1HY7 A;  1QIA A;  1ZVX A;  4L63 A;  3LJT A;  4WF6 A;  2OXW A;  4DF9 A;  4HX3 A;  2E3X A;  3F19 A;  2HU6 A;  4G9L A;  1H71 P;  3WV1 A;  4DD8 A;  1XFW A;  2W0D A;  1ND1 A;  3HB2 P;  1UEA A;  1FLS A;  1BKC I;  1BIW A;  1SLM A;  1I76 A;  3K7L A;  3LIL A;  3U1R A;  2XS3 A;  3WV3 A;  3HBV P;  3OHO A;  2K9C A;  1R1H A;  4HMA A;  1AKL A;  3HBU P;  1DMT A;  3K7N A;  1IAD A;  5D1S A;  4PKR A;  4IUW A;  5CZM A;  3G5C A;  3KEJ A;  1EB6 A;  1IAE A;  3O2X A;  4FVL A;  4ILW D;  4A7B A;  1YCM A;  4AYK A;  2MZE A;  4H84 A;  2Z2D A;  3ZXH A;  3I7G A;  3DPE A;  3DTE A;  4DPE A;  4GR0 A;  1RMZ A;  3KEC A;  1HFS A;  1QJI A;  3LUN A;  1L6J A;  3LE9 A; 
#chains in the Genus database with same CATH homology
 1R1J A;  4WKI A;  1CQR A;  1O0Q A;  3ELM A;  1OM6 A;  1AYK A;  2O3E A;  456C A;  1OM8 A;  3KRY A;  1G4K A;  3LK8 A;  4GWM A;  1R54 A;  4GUY A;  4AXQ A;  3MA2 A;  3TSK A;  5CXA A;  3LGP A;  3RTT A;  4WKE A;  2MZI A;  1WNI A;  2RJP A;  3EDG A;  1G05 A;  4PKQ A;  5D1U A;  1G12 A;  1ZTQ A;  3LQ0 A;  2V4B A;  3TS4 A;  3LUM A;  4IJO A;  1D8M A;  2X3C A;  2L0R A;  2X3A A;  1JIW P;  3F1A A;  1JAP A;  2DW1 A;  2K2G A;  2OW0 A;  2YIG A;  1KBC A;  1Y8J A;  4Q1L A;  4FXY P;  1OMJ A;  1EAK A;  1XFZ A;  1XUC A;  2WO9 A;  3DTI A;  5I43 A;  1KAP P;  1CXV A;  5L7F A;  1MMP A;  2WOA A;  1PWQ A;  1Y93 A;  3EHY A;  1JIZ A;  3WV2 A;  5I0L A;  2W15 A;  4GQL A;  1IAA A;  1JAO A;  1YOU A;  4JA1 A;  1GXD A;  3P1V A;  3G42 A;  3TT4 A;  4ON1 A;  1ROS A;  5I12 A;  1AF0 A;  4L6T A;  3SHI A;  2W13 A;  2CKI A;  5D2B A;  1CAQ A;  3LQB A;  1UMS A;  1K7I A;  2JT5 A;  1XUR A;  2N8R A;  4L7A A;  1ZP5 A;  3LIK A;  1GE7 A;  3DTK A;  4H30 A;  3ZVS A;  3LEA A;  3USN A;  1GKC A;  2D1O A;  2DW2 A;  2XS4 A;  2Y6D A;  3TVC A;  1JAN A;  5I2Z A;  1B8Y A;  2CLT A;  1IAG A;  4XM7 A;  1XUD A;  1AST A;  1UTZ A;  1XFY A;  3HDA P;  1JJ9 A;  3GBO A;  3B2Z A;  1SMP A;  2OVZ A;  4J4M A;  2O36 A;  1KUF A;  4DV8 A;  2AYK A;  3HDB A;  4G0D A;  1SAT A;  3EWJ A;  1ZXV A;  2ERO A;  4GF1 A;  1QIB A;  3VTG A;  1EUB A;  1A86 A;  1QUA A;  1C7K A;  2OI0 A;  1HFC A;  3B92 A;  5I4O A;  1FM1 A;  1FBL A;  5BOT A;  3DL1 A;  5BPA A;  1PWU A;  1R1I A;  3Q2G A;  1BQQ M;  1KUG A;  1JH1 A;  1SLN A;  4XCT A;  4FXQ A;  4PKV A;  1A85 A;  5L79 A;  2FV5 A;  2QPJ A;  2OW1 A;  3KMC A;  3ZUK A;  3UVC A;  1JKY A;  3AIG A;  2FV9 A;  4JPA A;  1CGF A;  3B8Z A;  1CGL A;  5BOY A;  2Y6C A;  4GR8 A;  3I7I A;  2WO8 A;  3LJZ A;  4H1Q A;  3F16 A;  1IAC A;  4WZV A;  3L0T A;  4JQG A;  966C A;  5CUH A;  3CKI A;  3EHX A;  4PKU A;  1MMB A;  4A3W A;  1D7X A;  3KEK A;  2W14 A;  4WK7 A;  3LMC A;  3N2U A;  1XFX A;  4GR3 A;  1BUV M;  2RJQ A;  3OHL A;  4CTH A;  1HOV A;  3LKA A;  2JIH A;  4I35 A;  2MLS A;  2MZH A;  1JK3 A;  1HV5 A;  1OS2 A;  2OY4 A;  3KME A;  3F15 A;  1ATL A;  4PKT A;  1GE6 A;  3LIR A;  4ZR5 A;  3DSL A;  1BQO A;  1SRP A;  2DDY A;  2KRJ A;  2TCL A;  4JP4 A;  1J7N A;  1GKD A;  1QJJ A;  1CIZ A;  2AIG P;  1JAQ A;  3EDH A;  1MMR A;  2MLR A;  1YP1 A;  1G49 A;  3L0V A;  1CK7 A;  2X7M A;  1IAB A;  2OZR A;  1RM8 A;  2ERP A;  1GO7 P;  3E8R A;  4JIJ A;  2OY2 A;  4FU4 A;  3HY9 A;  1BKC A;  1I73 A;  3DNG A;  3AYK A;  1OM7 A;  1ZXC A;  3AYU A;  1G9K A;  2DW0 A;  3N2V A;  1QIC A;  1R55 A;  4XM6 A;  3HY7 A;  2I47 A;  4H49 A;  1BUD A;  2JT6 A;  1KUI A;  2W12 A;  1UTT A;  1XFU A;  5LAB A;  1MMQ A;  3EDZ A;  3Q2H A;  2SRT A;  2OW2 A;  4GWN A;  2E2D A;  1D8F A;  1K7G A;  3F17 A;  4H76 A;  2USN A;  1KUK A;  1CGE A;  1C3I A;  1OS9 A;  3NX7 A;  3F18 A;  1MNC A;  1KUH A;  4EFS A;  3O64 A;  1B3D A;  2DDF A;  2OVX A;  3V96 B;  5D1T A;  1O0T A;  4L19 A;  2J83 A;  2A8H A;  1BKC E;  2YB9 A;  1Q3A A;  1S4B P;  2JSD A;  2OXU A;  5H8X A;  3KWV C;  2OW9 A;  4PKS A;  3DWB A;  3HYG A;  5B5P A;  4H82 A;  2X3B A;  4R3V A;  830C A;  1XFV A;  3EDI A;  1Z3J A;  1YQY A;  4I03 A;  1DTH A;  3VI1 A;  5I3M A;  5B5O A;  1BZS A;  1UMT A;  1OO9 A;  2J0T A;  3LJG A;  2D1N A;  4XM8 A;  2YUF A;  1Y0V A;  4XBH A;  1HTD A;  4QKZ A;  1K7Q A;  2JNP A;  2PJT A;  3P24 A;  3DPF A;  1I1I P;  1BM6 A;  4AIG A;  2OXZ A;  3KHI A;  1PWW A;  1D5J A;  3BA0 A;  1GO8 P;  2POJ A;  2ERQ A;  1PWV A;  3RTS A;  1C8T A;  1GE5 A;  1ZS0 A;  4PKW A;  1SU3 A;  5JMY A;  4H3X A;  1PWP A;  4H2E A;  5D7W A;  1BSW A;  5D3C A;  4AUO A;  1USN A;  4IN9 A;  1HY7 A;  1QIA A;  1ZVX A;  4L63 A;  3LJT A;  4WF6 A;  2OXW A;  4DF9 A;  4HX3 A;  2E3X A;  3F19 A;  2HU6 A;  4G9L A;  1H71 P;  3WV1 A;  4DD8 A;  1XFW A;  2W0D A;  1ND1 A;  3HB2 P;  1UEA A;  1FLS A;  1BKC I;  1BIW A;  1SLM A;  1I76 A;  3K7L A;  3LIL A;  3U1R A;  2XS3 A;  3WV3 A;  3HBV P;  3OHO A;  2K9C A;  1R1H A;  4HMA A;  1AKL A;  3HBU P;  1DMT A;  3K7N A;  1IAD A;  5D1S A;  4PKR A;  4IUW A;  5CZM A;  3G5C A;  3KEJ A;  1EB6 A;  1IAE A;  3O2X A;  4FVL A;  4ILW D;  4A7B A;  1YCM A;  4AYK A;  2MZE A;  4H84 A;  2Z2D A;  3ZXH A;  3I7G A;  3DPE A;  3DTE A;  4DPE A;  4GR0 A;  1RMZ A;  3KEC A;  1HFS A;  1QJI A;  3LUN A;  1L6J A;  3LE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...