1QIAA

Crystal structure of stromelysin catalytic domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
IPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMELYSIN-1
publication title X-ray structure of human stromelysin catalytic domain complexed with nonpeptide inhibitors: implications for inhibitor selectivity
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1999-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1qiaA00
1ZP5A 1Y0VA 1JANA 1YOUA 2OXZA 4L19A 1JKYA 4JPAA 1JIZA 1UTTA 1A85A 1BZSA 1C7KA 1HTDA 1SRPA 4XM6A 4DD8A 4HMAA 3KEJA 3KMCA 1EAKA 1UEAA 3P1VA 1GXDA 1G12A 4J4MA 1ZVXA 2W0DA 3LKAA 4PKQA 3F18A 4XBHA 3AYKA 4FXQA 3AYUA 1UMSA 3EHYA 1QJIA 1CQRA 2DW1A 2YIGA 3N2VA 1MMBA 2QPJA 3OHLA 3KMEA 4GR0A 1IABA 1K7IA 4GUYA 4CTHA 3HY9A 2OVZA 1XUCA 3OHOA 4H82A 1JAPA 1GO8P 2D1NA 2JSDA 4GR3A 4FXYP 3EDIA 1DMTA 4H2EA 4WKIA 4XM7A 1BQOA 2MZIA 3G5CA 5LABA 3B2ZA 1YP1A 1UMTA 2OI0A 5D7WA 2CLTA 2O3EA 2OW0A 1EUBA 4A7BA 1PWWA 4ILWD 1AKLA 2L0RA 2W13A 1G9KA 4AXQA 3EHXA 3EDHA 1S4BP 4HX3A 1SATA 3N2UA 4JQGA 4WF6A 830CA 1CAQA 1B8YA 3DWBA 3TT4A 5I4OA 1KAPP 3GBOA 3ELMA 4GWMA 4ZR5A 4JA1A 2TCLA 2Y6CA 4I03A 2EROA 1JK3A 1XFWA 1D8FA 3L0TA 4A3WA 1JJ9A 2DW0A 4WZVA 3F1AA 3LQ0A 1CK7A 2Z2DA 1IAEA 1QJJA 1UTZA 5I2ZA 1Y93A 4H3XA 2JT6A 1MNCA 1RM8A 1IADA 1I1IP 2SRTA 3Q2GA 3ZVSA 3EWJA 3NX7A 3F16A 2ERQA 4I35A 4PKTA 1D5JA 2W15A 1C3IA 1ZXCA 4G9LA 4L6TA 2OXWA 3LK8A 2WO9A 1GE6A 5I12A 3HBVP 1BKCI 5JMYA 4R3VA 4L63A 2V4BA 1USNA 4PKRA 5CZMA 1ATLA 1ASTA 3RTSA 1R55A 5D1SA 2OY4A 2RJPA 2HU6A 1A86A 1KUIA 1HFCA 2MLRA 4PKWA 2OVXA 5D3CA 2DDYA 3DPEA 1HOVA 1OS9A 2A8HA 1K7QA 4AIGA 2I47A 3TVCA 2MZHA 3F15A 4PKUA 1QUAA 2OW1A 1HY7A 2PJTA 1QICA 3HDAP 3K7NA 3WV3A 1OM7A 1GE5A 1JH1A 3KECA 3TS4A 3LILA 2AIGP 3UVCA 2Y6DA 4XCTA 2YB9A 1B3DA 3CKIA 4GF1A 1MMPA 1XFVA 2K9CA 1JAOA 3VI1A 1OO9A 2CKIA 1QIBA 3HB2P 3HY7A 3USNA 3P24A 1YQYA 4GWNA 2W14A 1KUFA 2X7MA 2POJA 3EDZA 1WNIA 1XFYA 4XM8A 5D2BA 3KEKA 2OW2A 5BOYA 3RTTA 2ERPA 1ZS0A 1CGEA 4IJOA 1CIZA 1RMZA 2RJQA 3HBUP 1CXVA 5I0LA 4IUWA 2JNPA 1FM1A 5CUHA 2D1OA 4H49A 4H84A 2X3CA 4FVLA 2J0TA 1SMPA 1SU3A 3KHIA 1EB6A 1XUDA 4DPEA 2O36A 3B8ZA 5H8XA 2FV5A 4PKVA 3EDGA 4Q1LA 1KUGA 1MMRA 2X3AA 5BOTA 3WV1A 1AF0A 3KWVC 1ZXVA 1H71P 3TSKA 5I43A 3LEAA 1QIAA 4IN9A 4WKEA 1D8MA 3I7IA 1YCMA 1SLNA 1SLMA 3LQBA 1R1HA 1MMQA 2E2DA 5D1TA 1C8TA 1KBCA 4H76A 4GQLA 2XS4A 1XFZA 3MA2A 3V96B 1L6JA 1ND1A 2AYKA 3LJTA 456CA 3LJZA 1Q3AA 1D7XA 3F19A 1R1JA 4GR8A 3BA0A 3WV2A 2JT5A 1GE7A 1BSWA 1CGLA 1GO7P 3HYGA 4AYKA 3AIGA 2OZRA 3LGPA 1DTHA 3VTGA 2JIHA 1XURA 1JIWP 3B92A 2WO8A 3LUMA 4H1QA 3DNGA 2DW2A 3DPFA 3L0VA 3DL1A 3ZUKA 1BKCE 2X3BA 3U1RA 1PWUA 1XFUA 3F17A 3LJGA 5L7FA 4QKZA 2WOAA 1Z3JA 2MZEA 4ON1A 1K7GA 3K7LA 3O2XA 1CGFA 1PWPA 2OW9A 5BPAA 1G4KA 1JAQA 1OM8A 2DDFA 3O64A 3KRYA 2K2GA 1BIWA 3SHIA 5B5OA 5I3MA 2FV9A 4G0DA 4DF9A 1XFXA 3HDBA 2J83A 3LIRA 1PWVA 2KRJA 966CA 1GKDA 3DSLA 1KUHA 3I7GA 2MLSA 1ZTQA 3LIKA 1KUKA 1R54A 5L79A 5CXAA 1ROSA 1HFSA 1OM6A 1I73A 5B5PA 1J7NA 1OMJA 1G49A 4EFSA 5D1UA 1HV5A 1FBLA 1IAGA 1AYKA 1GKCA 3LE9A 2OXUA 1BKCA 3LUNA 1BM6A 1R1IA 3E8RA 4DV8A 4JP4A 2OY2A 3G42A 4FU4A 3Q2HA 1IACA 4PKSA 1I76A 1OS2A 1PWQA 2USNA 3ZXHA 2N8RA 2E3XA 1O0QA 3LMCA 1FLSA 1Y8JA 2W12A 1BUDA 4JIJA 1BUVM 4H30A 1BQQM 2XS3A 1O0TA 4AUOA 1IAAA 4WK7A 1G05A
chains in the Genus database with same CATH superfamily
1ZP5A 1Y0VA 1JANA 1YOUA 2OXZA 4L19A 1JKYA 4JPAA 1JIZA 1UTTA 1A85A 1BZSA 1C7KA 1HTDA 1SRPA 4XM6A 4DD8A 4HMAA 3KEJA 3KMCA 1EAKA 1UEAA 3P1VA 1GXDA 1G12A 4J4MA 1ZVXA 2W0DA 3LKAA 4PKQA 3F18A 4XBHA 3AYKA 4FXQA 3AYUA 1UMSA 3EHYA 1QJIA 1CQRA 2DW1A 1OZ9A 2YIGA 3N2VA 1MMBA 2QPJA 3OHLA 3KMEA 4GR0A 1IABA 1K7IA 4GUYA 4CTHA 3HY9A 2OVZA 1XUCA 3OHOA 4H82A 1JAPA 1GO8P 2D1NA 2JSDA 4GR3A 4FXYP 3EDIA 1DMTA 4H2EA 4WKIA 4XM7A 1BQOA 2MZIA 3G5CA 5LABA 3B2ZA 1YP1A 1UMTA 2OI0A 5D7WA 2CLTA 2O3EA 2OW0A 1EUBA 4A7BA 1PWWA 4ILWD 1AKLA 2L0RA 2W13A 1G9KA 4AXQA 3EHXA 1XAXA 3EDHA 1S4BP 4HX3A 1SATA 3N2UA 4JQGA 4WF6A 830CA 1CAQA 1B8YA 3DWBA 3TT4A 5I4OA 1KAPP 3GBOA 3ELMA 4GWMA 4ZR5A 4JA1A 2TCLA 2Y6CA 4I03A 2EROA 1JK3A 1XFWA 1D8FA 3L0TA 4A3WA 1JJ9A 2DW0A 4WZVA 3F1AA 3LQ0A 1CK7A 2Z2DA 1IAEA 1QJJA 1UTZA 5I2ZA 1Y93A 4H3XA 2JT6A 1MNCA 1RM8A 1IADA 1I1IP 2SRTA 3Q2GA 3ZVSA 3EWJA 3NX7A 3F16A 2ERQA 4I35A 4PKTA 1D5JA 2W15A 1C3IA 1ZXCA 4G9LA 4L6TA 2OXWA 3LK8A 2WO9A 1GE6A 5I12A 3HBVP 1BKCI 5JMYA 4R3VA 4L63A 2V4BA 1USNA 4PKRA 5CZMA 1ATLA 1ASTA 3RTSA 1R55A 5D1SA 2OY4A 2RJPA 2HU6A 1A86A 1KUIA 1HFCA 2MLRA 4PKWA 2OVXA 5D3CA 2DDYA 3DPEA 1HOVA 1OS9A 2A8HA 1K7QA 4AIGA 2I47A 3TVCA 2MZHA 3F15A 4PKUA 1QUAA 2OW1A 1HY7A 2PJTA 1QICA 3HDAP 3K7NA 3WV3A 1OM7A 1GE5A 1JH1A 3KECA 3TS4A 3LILA 2AIGP 3UVCA 2Y6DA 4XCTA 2YB9A 3DTKA 1B3DA 3CKIA 4GF1A 1MMPA 1XFVA 2K9CA 1JAOA 3VI1A 1OO9A 2CKIA 1QIBA 3HB2P 3HY7A 3USNA 3P24A 1YQYA 4GWNA 2W14A 1KUFA 2X7MA 2POJA 3EDZA 1WNIA 1XFYA 4XM8A 5D2BA 3KEKA 2OW2A 5BOYA 3RTTA 2ERPA 1ZS0A 1CGEA 4IJOA 1CIZA 1RMZA 2RJQA 3HBUP 1CXVA 5I0LA 4IUWA 2JNPA 1FM1A 5CUHA 2D1OA 4H49A 4H84A 2X3CA 4FVLA 2J0TA 1SMPA 1SU3A 3KHIA 1EB6A 1XUDA 4DPEA 2O36A 3B8ZA 5H8XA 2FV5A 4PKVA 3EDGA 4Q1LA 1KUGA 1MMRA 2X3AA 5BOTA 3WV1A 1AF0A 3KWVC 3DTEA 1ZXVA 3DTIA 1H71P 3TSKA 5I43A 3LEAA 1QIAA 4IN9A 4WKEA 1D8MA 3I7IA 1YCMA 1SLNA 1SLMA 3LQBA 1R1HA 1MMQA 2E2DA 5D1TA 1C8TA 1KBCA 4H76A 4GQLA 2XS4A 1XFZA 3MA2A 3V96B 1L6JA 1ND1A 2AYKA 3LJTA 456CA 3LJZA 1Q3AA 1D7XA 3F19A 1R1JA 4GR8A 3BA0A 3WV2A 2JT5A 1GE7A 1BSWA 1CGLA 1GO7P 3HYGA 4AYKA 3AIGA 2OZRA 3LGPA 1DTHA 3VTGA 2JIHA 1XURA 1JIWP 3B92A 2WO8A 3LUMA 4H1QA 3DNGA 2DW2A 3DPFA 3L0VA 3DL1A 3ZUKA 1BKCE 1XM5A 2X3BA 3U1RA 1PWUA 1XFUA 3F17A 3LJGA 5L7FA 4QKZA 2WOAA 1Z3JA 2MZEA 4ON1A 1K7GA 3K7LA 3O2XA 1CGFA 1PWPA 2OW9A 5BPAA 1G4KA 1JAQA 1OM8A 2DDFA 3O64A 3KRYA 2K2GA 1BIWA 3SHIA 5B5OA 5I3MA 2FV9A 4G0DA 4DF9A 1XFXA 3HDBA 2J83A 3LIRA 1PWVA 2KRJA 966CA 1GKDA 3DSLA 1KUHA 1TVIA 3I7GA 2MLSA 1ZTQA 3LIKA 1KUKA 1R54A 5L79A 5CXAA 1ROSA 2YUFA 1HFSA 1OM6A 1I73A 5B5PA 1J7NA 1OMJA 1G49A 4EFSA 5D1UA 1HV5A 1FBLA 1IAGA 1AYKA 1GKCA 3LE9A 2OXUA 1BKCA 3LUNA 1BM6A 1R1IA 3E8RA 4DV8A 4JP4A 2OY2A 3G42A 4FU4A 3Q2HA 1IACA 4PKSA 1I76A 1OS2A 1PWQA 2USNA 3ZXHA 2N8RA 2E3XA 1O0QA 1FLSA 1Y8JA 2W12A 3LMCA 1BUDA 4JIJA 1BUVM 4H30A 1BQQM 2XS3A 1O0TA 4L7AA 4AUOA 1IAAA 4WK7A 1G05A
chains in the Genus database with same CATH topology
1ZP5A 1Y0VA 1JANA 1YOUA 2OXZA 4L19A 1JKYA 4JPAA 1JIZA 1UTTA 1A85A 1BZSA 1C7KA 1HTDA 1SRPA 4XM6A 4DD8A 4HMAA 3KEJA 3KMCA 1EAKA 1UEAA 3P1VA 1GXDA 1G12A 4J4MA 1ZVXA 2W0DA 3LKAA 4PKQA 3F18A 4XBHA 3AYKA 4FXQA 3AYUA 1UMSA 3EHYA 1QJIA 1CQRA 2DW1A 2YIGA 3N2VA 1MMBA 2QPJA 3OHLA 3KMEA 4GR0A 1IABA 1K7IA 4GUYA 4CTHA 3HY9A 2OVZA 1XUCA 3OHOA 4H82A 1JAPA 1GO8P 2D1NA 2JSDA 4GR3A 4FXYP 3EDIA 1DMTA 4H2EA 4WKIA 4XM7A 1BQOA 2MZIA 3G5CA 5LABA 3B2ZA 1YP1A 1UMTA 2OI0A 5D7WA 2CLTA 2O3EA 2OW0A 1EUBA 4A7BA 1PWWA 4ILWD 1AKLA 2L0RA 2W13A 1G9KA 4AXQA 3EHXA 3EDHA 1S4BP 4HX3A 1SATA 3N2UA 4JQGA 4WF6A 830CA 1CAQA 1B8YA 3DWBA 3TT4A 5I4OA 1KAPP 3GBOA 3ELMA 4GWMA 4ZR5A 4JA1A 2TCLA 2Y6CA 4I03A 2EROA 1JK3A 1XFWA 1D8FA 3L0TA 4A3WA 1JJ9A 2DW0A 4WZVA 3F1AA 3LQ0A 1CK7A 2Z2DA 1IAEA 1QJJA 1UTZA 5I2ZA 1Y93A 4H3XA 2JT6A 1MNCA 1RM8A 1IADA 1I1IP 2SRTA 3Q2GA 3ZVSA 3EWJA 3NX7A 3F16A 2ERQA 4I35A 4PKTA 1D5JA 2W15A 1C3IA 1ZXCA 4G9LA 4L6TA 2OXWA 3LK8A 2WO9A 1GE6A 5I12A 3HBVP 1BKCI 5JMYA 4R3VA 4L63A 2V4BA 1USNA 4PKRA 5CZMA 1ATLA 1ASTA 3RTSA 1R55A 5D1SA 2OY4A 2RJPA 2HU6A 1A86A 1KUIA 1HFCA 2MLRA 4PKWA 2OVXA 5D3CA 2DDYA 3DPEA 1HOVA 1OS9A 2A8HA 1K7QA 4AIGA 2I47A 3TVCA 2MZHA 3F15A 4PKUA 1QUAA 2OW1A 1HY7A 2PJTA 1QICA 3HDAP 3K7NA 3WV3A 1OM7A 1GE5A 1JH1A 3KECA 3TS4A 3LILA 2AIGP 3UVCA 2Y6DA 4XCTA 2YB9A 3DTKA 1B3DA 3CKIA 4GF1A 1MMPA 1XFVA 2K9CA 1JAOA 3VI1A 1OO9A 2CKIA 1QIBA 3HB2P 3HY7A 3USNA 3P24A 1YQYA 4GWNA 2W14A 1KUFA 2X7MA 2POJA 3EDZA 1WNIA 1XFYA 4XM8A 5D2BA 3KEKA 2OW2A 5BOYA 3RTTA 2ERPA 1ZS0A 1CGEA 4IJOA 1CIZA 1RMZA 2RJQA 3HBUP 1CXVA 5I0LA 4IUWA 2JNPA 1FM1A 5CUHA 2D1OA 4H49A 4H84A 2X3CA 4FVLA 2J0TA 1SMPA 1SU3A 3KHIA 1EB6A 1XUDA 4DPEA 2O36A 3B8ZA 5H8XA 2FV5A 4PKVA 3EDGA 4Q1LA 1KUGA 1MMRA 2X3AA 5BOTA 3WV1A 1AF0A 3KWVC 3DTEA 1ZXVA 3DTIA 1H71P 3TSKA 5I43A 3LEAA 1QIAA 4IN9A 4WKEA 1D8MA 3I7IA 1YCMA 1SLNA 1SLMA 3LQBA 1R1HA 1MMQA 2E2DA 5D1TA 1C8TA 1KBCA 4H76A 4GQLA 2XS4A 1XFZA 3MA2A 3V96B 1L6JA 1ND1A 2AYKA 3LJTA 456CA 3LJZA 1Q3AA 1D7XA 3F19A 1R1JA 4GR8A 3BA0A 3WV2A 2JT5A 1GE7A 1BSWA 1CGLA 1GO7P 3HYGA 4AYKA 3AIGA 2OZRA 3LGPA 1DTHA 3VTGA 2JIHA 1XURA 1JIWP 3B92A 2WO8A 3LUMA 4H1QA 3DNGA 2DW2A 3DPFA 3L0VA 3DL1A 3ZUKA 1BKCE 2X3BA 3U1RA 1PWUA 1XFUA 3F17A 3LJGA 5L7FA 4QKZA 2WOAA 1Z3JA 2MZEA 4ON1A 1K7GA 3K7LA 3O2XA 1CGFA 1PWPA 2OW9A 5BPAA 1G4KA 1JAQA 1OM8A 2DDFA 3O64A 3KRYA 2K2GA 1BIWA 3SHIA 5B5OA 5I3MA 2FV9A 4G0DA 4DF9A 1XFXA 3HDBA 2J83A 3LIRA 1PWVA 2KRJA 966CA 1GKDA 3DSLA 1KUHA 3I7GA 2MLSA 1ZTQA 3LIKA 1KUKA 1R54A 5L79A 5CXAA 1ROSA 2YUFA 1HFSA 1OM6A 1I73A 5B5PA 1J7NA 1OMJA 1G49A 4EFSA 5D1UA 1HV5A 1FBLA 1IAGA 1AYKA 1GKCA 3LE9A 2OXUA 1BKCA 3LUNA 1BM6A 1R1IA 3E8RA 4DV8A 4JP4A 2OY2A 3G42A 4FU4A 3Q2HA 1IACA 4PKSA 1I76A 1OS2A 1PWQA 2USNA 3ZXHA 2N8RA 2E3XA 1O0QA 1FLSA 1Y8JA 2W12A 3LMCA 1BUDA 4JIJA 1BUVM 4H30A 1BQQM 2XS3A 1O0TA 4L7AA 4AUOA 1IAAA 4WK7A 1G05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZP5 A;  1Y0V A;  1JAN A;  1YOU A;  2OXZ A;  4L19 A;  1JKY A;  4JPA A;  1JIZ A;  1UTT A;  1A85 A;  1BZS A;  1C7K A;  1HTD A;  1SRP A;  4XM6 A;  4DD8 A;  4HMA A;  3KEJ A;  3KMC A;  1EAK A;  1UEA A;  3P1V A;  1GXD A;  1G12 A;  4J4M A;  1ZVX A;  2W0D A;  3LKA A;  4PKQ A;  3F18 A;  4XBH A;  3AYK A;  4FXQ A;  3AYU A;  1UMS A;  3EHY A;  1QJI A;  1CQR A;  2DW1 A;  2YIG A;  3N2V A;  1MMB A;  2QPJ A;  3OHL A;  3KME A;  4GR0 A;  1IAB A;  1K7I A;  4GUY A;  4CTH A;  3HY9 A;  2OVZ A;  1XUC A;  3OHO A;  4H82 A;  1JAP A;  1GO8 P;  2D1N A;  2JSD A;  4GR3 A;  4FXY P;  3EDI A;  1DMT A;  4H2E A;  4WKI A;  4XM7 A;  1BQO A;  2MZI A;  3G5C A;  5LAB A;  3B2Z A;  1YP1 A;  1UMT A;  2OI0 A;  5D7W A;  2CLT A;  2O3E A;  2OW0 A;  1EUB A;  4A7B A;  1PWW A;  4ILW D;  1AKL A;  2L0R A;  2W13 A;  1G9K A;  4AXQ A;  3EHX A;  3EDH A;  1S4B P;  4HX3 A;  1SAT A;  3N2U A;  4JQG A;  4WF6 A;  830C A;  1CAQ A;  1B8Y A;  3DWB A;  3TT4 A;  5I4O A;  1KAP P;  3GBO A;  3ELM A;  4GWM A;  4ZR5 A;  4JA1 A;  2TCL A;  2Y6C A;  4I03 A;  2ERO A;  1JK3 A;  1XFW A;  1D8F A;  3L0T A;  4A3W A;  1JJ9 A;  2DW0 A;  4WZV A;  3F1A A;  3LQ0 A;  1CK7 A;  2Z2D A;  1IAE A;  1QJJ A;  1UTZ A;  5I2Z A;  1Y93 A;  4H3X A;  2JT6 A;  1MNC A;  1RM8 A;  1IAD A;  1I1I P;  2SRT A;  3Q2G A;  3ZVS A;  3EWJ A;  3NX7 A;  3F16 A;  2ERQ A;  4I35 A;  4PKT A;  1D5J A;  2W15 A;  1C3I A;  1ZXC A;  4G9L A;  4L6T A;  2OXW A;  3LK8 A;  2WO9 A;  1GE6 A;  5I12 A;  3HBV P;  1BKC I;  5JMY A;  4R3V A;  4L63 A;  2V4B A;  1USN A;  4PKR A;  5CZM A;  1ATL A;  1AST A;  3RTS A;  1R55 A;  5D1S A;  2OY4 A;  2RJP A;  2HU6 A;  1A86 A;  1KUI A;  1HFC A;  2MLR A;  4PKW A;  2OVX A;  5D3C A;  2DDY A;  3DPE A;  1HOV A;  1OS9 A;  2A8H A;  1K7Q A;  4AIG A;  2I47 A;  3TVC A;  2MZH A;  3F15 A;  4PKU A;  1QUA A;  2OW1 A;  1HY7 A;  2PJT A;  1QIC A;  3HDA P;  3K7N A;  3WV3 A;  1OM7 A;  1GE5 A;  1JH1 A;  3KEC A;  3TS4 A;  3LIL A;  2AIG P;  3UVC A;  2Y6D A;  4XCT A;  2YB9 A;  1B3D A;  3CKI A;  4GF1 A;  1MMP A;  1XFV A;  2K9C A;  1JAO A;  3VI1 A;  1OO9 A;  2CKI A;  1QIB A;  3HB2 P;  3HY7 A;  3USN A;  3P24 A;  1YQY A;  4GWN A;  2W14 A;  1KUF A;  2X7M A;  2POJ A;  3EDZ A;  1WNI A;  1XFY A;  4XM8 A;  5D2B A;  3KEK A;  2OW2 A;  5BOY A;  3RTT A;  2ERP A;  1ZS0 A;  1CGE A;  4IJO A;  1CIZ A;  1RMZ A;  2RJQ A;  3HBU P;  1CXV A;  5I0L A;  4IUW A;  2JNP A;  1FM1 A;  5CUH A;  2D1O A;  4H49 A;  4H84 A;  2X3C A;  4FVL A;  2J0T A;  1SMP A;  1SU3 A;  3KHI A;  1EB6 A;  1XUD A;  4DPE A;  2O36 A;  3B8Z A;  5H8X A;  2FV5 A;  4PKV A;  3EDG A;  4Q1L A;  1KUG A;  1MMR A;  2X3A A;  5BOT A;  3WV1 A;  1AF0 A;  3KWV C;  1ZXV A;  1H71 P;  3TSK A;  5I43 A;  3LEA A;  1QIA A;  4IN9 A;  4WKE A;  1D8M A;  3I7I A;  1YCM A;  1SLN A;  1SLM A;  3LQB A;  1R1H A;  1MMQ A;  2E2D A;  5D1T A;  1C8T A;  1KBC A;  4H76 A;  4GQL A;  2XS4 A;  1XFZ A;  3MA2 A;  3V96 B;  1L6J A;  1ND1 A;  2AYK A;  3LJT A;  456C A;  3LJZ A;  1Q3A A;  1D7X A;  3F19 A;  1R1J A;  4GR8 A;  3BA0 A;  3WV2 A;  2JT5 A;  1GE7 A;  1BSW A;  1CGL A;  1GO7 P;  3HYG A;  4AYK A;  3AIG A;  2OZR A;  3LGP A;  1DTH A;  3VTG A;  2JIH A;  1XUR A;  1JIW P;  3B92 A;  2WO8 A;  3LUM A;  4H1Q A;  3DNG A;  2DW2 A;  3DPF A;  3L0V A;  3DL1 A;  3ZUK A;  1BKC E;  2X3B A;  3U1R A;  1PWU A;  1XFU A;  3F17 A;  3LJG A;  5L7F A;  4QKZ A;  2WOA A;  1Z3J A;  2MZE A;  4ON1 A;  1K7G A;  3K7L A;  3O2X A;  1CGF A;  1PWP A;  2OW9 A;  5BPA A;  1G4K A;  1JAQ A;  1OM8 A;  2DDF A;  3O64 A;  3KRY A;  2K2G A;  1BIW A;  3SHI A;  5B5O A;  5I3M A;  2FV9 A;  4G0D A;  4DF9 A;  1XFX A;  3HDB A;  2J83 A;  3LIR A;  1PWV A;  2KRJ A;  966C A;  1GKD A;  3DSL A;  1KUH A;  3I7G A;  2MLS A;  1ZTQ A;  3LIK A;  1KUK A;  1R54 A;  5L79 A;  5CXA A;  1ROS A;  1HFS A;  1OM6 A;  1I73 A;  5B5P A;  1J7N A;  1OMJ A;  1G49 A;  4EFS A;  5D1U A;  1HV5 A;  1FBL A;  1IAG A;  1AYK A;  1GKC A;  3LE9 A;  2OXU A;  1BKC A;  3LUN A;  1BM6 A;  1R1I A;  3E8R A;  4DV8 A;  4JP4 A;  2OY2 A;  3G42 A;  4FU4 A;  3Q2H A;  1IAC A;  4PKS A;  1I76 A;  1OS2 A;  1PWQ A;  2USN A;  3ZXH A;  2N8R A;  2E3X A;  1O0Q A;  3LMC A;  1FLS A;  1Y8J A;  2W12 A;  1BUD A;  4JIJ A;  1BUV M;  4H30 A;  1BQQ M;  2XS3 A;  1O0T A;  4AUO A;  1IAA A;  4WK7 A;  1G05 A; 
#chains in the Genus database with same CATH topology
 1ZP5 A;  1Y0V A;  1JAN A;  1YOU A;  2OXZ A;  4L19 A;  1JKY A;  4JPA A;  1JIZ A;  1UTT A;  1A85 A;  1BZS A;  1C7K A;  1HTD A;  1SRP A;  4XM6 A;  4DD8 A;  4HMA A;  3KEJ A;  3KMC A;  1EAK A;  1UEA A;  3P1V A;  1GXD A;  1G12 A;  4J4M A;  1ZVX A;  2W0D A;  3LKA A;  4PKQ A;  3F18 A;  4XBH A;  3AYK A;  4FXQ A;  3AYU A;  1UMS A;  3EHY A;  1QJI A;  1CQR A;  2DW1 A;  1OZ9 A;  2YIG A;  3N2V A;  1MMB A;  2QPJ A;  3OHL A;  3KME A;  4GR0 A;  1IAB A;  1K7I A;  4GUY A;  4CTH A;  3HY9 A;  2OVZ A;  1XUC A;  3OHO A;  4H82 A;  1JAP A;  1GO8 P;  2D1N A;  2JSD A;  4GR3 A;  4FXY P;  3EDI A;  1DMT A;  4H2E A;  4WKI A;  4XM7 A;  1BQO A;  2MZI A;  3G5C A;  5LAB A;  3B2Z A;  1YP1 A;  1UMT A;  2OI0 A;  5D7W A;  2CLT A;  2O3E A;  2OW0 A;  1EUB A;  4A7B A;  1PWW A;  4ILW D;  1AKL A;  2L0R A;  2W13 A;  1G9K A;  4AXQ A;  3EHX A;  1XAX A;  3EDH A;  1S4B P;  4HX3 A;  1SAT A;  3N2U A;  4JQG A;  4WF6 A;  830C A;  1CAQ A;  1B8Y A;  3DWB A;  3TT4 A;  5I4O A;  1KAP P;  3GBO A;  3ELM A;  4GWM A;  4ZR5 A;  4JA1 A;  2TCL A;  2Y6C A;  4I03 A;  2ERO A;  1JK3 A;  1XFW A;  1D8F A;  3L0T A;  4A3W A;  1JJ9 A;  2DW0 A;  4WZV A;  3F1A A;  3LQ0 A;  1CK7 A;  2Z2D A;  1IAE A;  1QJJ A;  1UTZ A;  5I2Z A;  1Y93 A;  4H3X A;  2JT6 A;  1MNC A;  1RM8 A;  1IAD A;  1I1I P;  2SRT A;  3Q2G A;  3ZVS A;  3EWJ A;  3NX7 A;  3F16 A;  2ERQ A;  4I35 A;  4PKT A;  1D5J A;  2W15 A;  1C3I A;  1ZXC A;  4G9L A;  4L6T A;  2OXW A;  3LK8 A;  2WO9 A;  1GE6 A;  5I12 A;  3HBV P;  1BKC I;  5JMY A;  4R3V A;  4L63 A;  2V4B A;  1USN A;  4PKR A;  5CZM A;  1ATL A;  1AST A;  3RTS A;  1R55 A;  5D1S A;  2OY4 A;  2RJP A;  2HU6 A;  1A86 A;  1KUI A;  1HFC A;  2MLR A;  4PKW A;  2OVX A;  5D3C A;  2DDY A;  3DPE A;  1HOV A;  1OS9 A;  2A8H A;  1K7Q A;  4AIG A;  2I47 A;  3TVC A;  2MZH A;  3F15 A;  4PKU A;  1QUA A;  2OW1 A;  1HY7 A;  2PJT A;  1QIC A;  3HDA P;  3K7N A;  3WV3 A;  1OM7 A;  1GE5 A;  1JH1 A;  3KEC A;  3TS4 A;  3LIL A;  2AIG P;  3UVC A;  2Y6D A;  4XCT A;  2YB9 A;  3DTK A;  1B3D A;  3CKI A;  4GF1 A;  1MMP A;  1XFV A;  2K9C A;  1JAO A;  3VI1 A;  1OO9 A;  2CKI A;  1QIB A;  3HB2 P;  3HY7 A;  3USN A;  3P24 A;  1YQY A;  4GWN A;  2W14 A;  1KUF A;  2X7M A;  2POJ A;  3EDZ A;  1WNI A;  1XFY A;  4XM8 A;  5D2B A;  3KEK A;  2OW2 A;  5BOY A;  3RTT A;  2ERP A;  1ZS0 A;  1CGE A;  4IJO A;  1CIZ A;  1RMZ A;  2RJQ A;  3HBU P;  1CXV A;  5I0L A;  4IUW A;  2JNP A;  1FM1 A;  5CUH A;  2D1O A;  4H49 A;  4H84 A;  2X3C A;  4FVL A;  2J0T A;  1SMP A;  1SU3 A;  3KHI A;  1EB6 A;  1XUD A;  4DPE A;  2O36 A;  3B8Z A;  5H8X A;  2FV5 A;  4PKV A;  3EDG A;  4Q1L A;  1KUG A;  1MMR A;  2X3A A;  5BOT A;  3WV1 A;  1AF0 A;  3KWV C;  3DTE A;  1ZXV A;  3DTI A;  1H71 P;  3TSK A;  5I43 A;  3LEA A;  1QIA A;  4IN9 A;  4WKE A;  1D8M A;  3I7I A;  1YCM A;  1SLN A;  1SLM A;  3LQB A;  1R1H A;  1MMQ A;  2E2D A;  5D1T A;  1C8T A;  1KBC A;  4H76 A;  4GQL A;  2XS4 A;  1XFZ A;  3MA2 A;  3V96 B;  1L6J A;  1ND1 A;  2AYK A;  3LJT A;  456C A;  3LJZ A;  1Q3A A;  1D7X A;  3F19 A;  1R1J A;  4GR8 A;  3BA0 A;  3WV2 A;  2JT5 A;  1GE7 A;  1BSW A;  1CGL A;  1GO7 P;  3HYG A;  4AYK A;  3AIG A;  2OZR A;  3LGP A;  1DTH A;  3VTG A;  2JIH A;  1XUR A;  1JIW P;  3B92 A;  2WO8 A;  3LUM A;  4H1Q A;  3DNG A;  2DW2 A;  3DPF A;  3L0V A;  3DL1 A;  3ZUK A;  1BKC E;  1XM5 A;  2X3B A;  3U1R A;  1PWU A;  1XFU A;  3F17 A;  3LJG A;  5L7F A;  4QKZ A;  2WOA A;  1Z3J A;  2MZE A;  4ON1 A;  1K7G A;  3K7L A;  3O2X A;  1CGF A;  1PWP A;  2OW9 A;  5BPA A;  1G4K A;  1JAQ A;  1OM8 A;  2DDF A;  3O64 A;  3KRY A;  2K2G A;  1BIW A;  3SHI A;  5B5O A;  5I3M A;  2FV9 A;  4G0D A;  4DF9 A;  1XFX A;  3HDB A;  2J83 A;  3LIR A;  1PWV A;  2KRJ A;  966C A;  1GKD A;  3DSL A;  1KUH A;  1TVI A;  3I7G A;  2MLS A;  1ZTQ A;  3LIK A;  1KUK A;  1R54 A;  5L79 A;  5CXA A;  1ROS A;  2YUF A;  1HFS A;  1OM6 A;  1I73 A;  5B5P A;  1J7N A;  1OMJ A;  1G49 A;  4EFS A;  5D1U A;  1HV5 A;  1FBL A;  1IAG A;  1AYK A;  1GKC A;  3LE9 A;  2OXU A;  1BKC A;  3LUN A;  1BM6 A;  1R1I A;  3E8R A;  4DV8 A;  4JP4 A;  2OY2 A;  3G42 A;  4FU4 A;  3Q2H A;  1IAC A;  4PKS A;  1I76 A;  1OS2 A;  1PWQ A;  2USN A;  3ZXH A;  2N8R A;  2E3X A;  1O0Q A;  1FLS A;  1Y8J A;  2W12 A;  3LMC A;  1BUD A;  4JIJ A;  1BUV M;  4H30 A;  1BQQ M;  2XS3 A;  1O0T A;  4L7A A;  4AUO A;  1IAA A;  4WK7 A;  1G05 A; 
#chains in the Genus database with same CATH homology
 1ZP5 A;  1Y0V A;  1JAN A;  1YOU A;  2OXZ A;  4L19 A;  1JKY A;  4JPA A;  1JIZ A;  1UTT A;  1A85 A;  1BZS A;  1C7K A;  1HTD A;  1SRP A;  4XM6 A;  4DD8 A;  4HMA A;  3KEJ A;  3KMC A;  1EAK A;  1UEA A;  3P1V A;  1GXD A;  1G12 A;  4J4M A;  1ZVX A;  2W0D A;  3LKA A;  4PKQ A;  3F18 A;  4XBH A;  3AYK A;  4FXQ A;  3AYU A;  1UMS A;  3EHY A;  1QJI A;  1CQR A;  2DW1 A;  2YIG A;  3N2V A;  1MMB A;  2QPJ A;  3OHL A;  3KME A;  4GR0 A;  1IAB A;  1K7I A;  4GUY A;  4CTH A;  3HY9 A;  2OVZ A;  1XUC A;  3OHO A;  4H82 A;  1JAP A;  1GO8 P;  2D1N A;  2JSD A;  4GR3 A;  4FXY P;  3EDI A;  1DMT A;  4H2E A;  4WKI A;  4XM7 A;  1BQO A;  2MZI A;  3G5C A;  5LAB A;  3B2Z A;  1YP1 A;  1UMT A;  2OI0 A;  5D7W A;  2CLT A;  2O3E A;  2OW0 A;  1EUB A;  4A7B A;  1PWW A;  4ILW D;  1AKL A;  2L0R A;  2W13 A;  1G9K A;  4AXQ A;  3EHX A;  3EDH A;  1S4B P;  4HX3 A;  1SAT A;  3N2U A;  4JQG A;  4WF6 A;  830C A;  1CAQ A;  1B8Y A;  3DWB A;  3TT4 A;  5I4O A;  1KAP P;  3GBO A;  3ELM A;  4GWM A;  4ZR5 A;  4JA1 A;  2TCL A;  2Y6C A;  4I03 A;  2ERO A;  1JK3 A;  1XFW A;  1D8F A;  3L0T A;  4A3W A;  1JJ9 A;  2DW0 A;  4WZV A;  3F1A A;  3LQ0 A;  1CK7 A;  2Z2D A;  1IAE A;  1QJJ A;  1UTZ A;  5I2Z A;  1Y93 A;  4H3X A;  2JT6 A;  1MNC A;  1RM8 A;  1IAD A;  1I1I P;  2SRT A;  3Q2G A;  3ZVS A;  3EWJ A;  3NX7 A;  3F16 A;  2ERQ A;  4I35 A;  4PKT A;  1D5J A;  2W15 A;  1C3I A;  1ZXC A;  4G9L A;  4L6T A;  2OXW A;  3LK8 A;  2WO9 A;  1GE6 A;  5I12 A;  3HBV P;  1BKC I;  5JMY A;  4R3V A;  4L63 A;  2V4B A;  1USN A;  4PKR A;  5CZM A;  1ATL A;  1AST A;  3RTS A;  1R55 A;  5D1S A;  2OY4 A;  2RJP A;  2HU6 A;  1A86 A;  1KUI A;  1HFC A;  2MLR A;  4PKW A;  2OVX A;  5D3C A;  2DDY A;  3DPE A;  1HOV A;  1OS9 A;  2A8H A;  1K7Q A;  4AIG A;  2I47 A;  3TVC A;  2MZH A;  3F15 A;  4PKU A;  1QUA A;  2OW1 A;  1HY7 A;  2PJT A;  1QIC A;  3HDA P;  3K7N A;  3WV3 A;  1OM7 A;  1GE5 A;  1JH1 A;  3KEC A;  3TS4 A;  3LIL A;  2AIG P;  3UVC A;  2Y6D A;  4XCT A;  2YB9 A;  3DTK A;  1B3D A;  3CKI A;  4GF1 A;  1MMP A;  1XFV A;  2K9C A;  1JAO A;  3VI1 A;  1OO9 A;  2CKI A;  1QIB A;  3HB2 P;  3HY7 A;  3USN A;  3P24 A;  1YQY A;  4GWN A;  2W14 A;  1KUF A;  2X7M A;  2POJ A;  3EDZ A;  1WNI A;  1XFY A;  4XM8 A;  5D2B A;  3KEK A;  2OW2 A;  5BOY A;  3RTT A;  2ERP A;  1ZS0 A;  1CGE A;  4IJO A;  1CIZ A;  1RMZ A;  2RJQ A;  3HBU P;  1CXV A;  5I0L A;  4IUW A;  2JNP A;  1FM1 A;  5CUH A;  2D1O A;  4H49 A;  4H84 A;  2X3C A;  4FVL A;  2J0T A;  1SMP A;  1SU3 A;  3KHI A;  1EB6 A;  1XUD A;  4DPE A;  2O36 A;  3B8Z A;  5H8X A;  2FV5 A;  4PKV A;  3EDG A;  4Q1L A;  1KUG A;  1MMR A;  2X3A A;  5BOT A;  3WV1 A;  1AF0 A;  3KWV C;  3DTE A;  1ZXV A;  3DTI A;  1H71 P;  3TSK A;  5I43 A;  3LEA A;  1QIA A;  4IN9 A;  4WKE A;  1D8M A;  3I7I A;  1YCM A;  1SLN A;  1SLM A;  3LQB A;  1R1H A;  1MMQ A;  2E2D A;  5D1T A;  1C8T A;  1KBC A;  4H76 A;  4GQL A;  2XS4 A;  1XFZ A;  3MA2 A;  3V96 B;  1L6J A;  1ND1 A;  2AYK A;  3LJT A;  456C A;  3LJZ A;  1Q3A A;  1D7X A;  3F19 A;  1R1J A;  4GR8 A;  3BA0 A;  3WV2 A;  2JT5 A;  1GE7 A;  1BSW A;  1CGL A;  1GO7 P;  3HYG A;  4AYK A;  3AIG A;  2OZR A;  3LGP A;  1DTH A;  3VTG A;  2JIH A;  1XUR A;  1JIW P;  3B92 A;  2WO8 A;  3LUM A;  4H1Q A;  3DNG A;  2DW2 A;  3DPF A;  3L0V A;  3DL1 A;  3ZUK A;  1BKC E;  2X3B A;  3U1R A;  1PWU A;  1XFU A;  3F17 A;  3LJG A;  5L7F A;  4QKZ A;  2WOA A;  1Z3J A;  2MZE A;  4ON1 A;  1K7G A;  3K7L A;  3O2X A;  1CGF A;  1PWP A;  2OW9 A;  5BPA A;  1G4K A;  1JAQ A;  1OM8 A;  2DDF A;  3O64 A;  3KRY A;  2K2G A;  1BIW A;  3SHI A;  5B5O A;  5I3M A;  2FV9 A;  4G0D A;  4DF9 A;  1XFX A;  3HDB A;  2J83 A;  3LIR A;  1PWV A;  2KRJ A;  966C A;  1GKD A;  3DSL A;  1KUH A;  3I7G A;  2MLS A;  1ZTQ A;  3LIK A;  1KUK A;  1R54 A;  5L79 A;  5CXA A;  1ROS A;  2YUF A;  1HFS A;  1OM6 A;  1I73 A;  5B5P A;  1J7N A;  1OMJ A;  1G49 A;  4EFS A;  5D1U A;  1HV5 A;  1FBL A;  1IAG A;  1AYK A;  1GKC A;  3LE9 A;  2OXU A;  1BKC A;  3LUN A;  1BM6 A;  1R1I A;  3E8R A;  4DV8 A;  4JP4 A;  2OY2 A;  3G42 A;  4FU4 A;  3Q2H A;  1IAC A;  4PKS A;  1I76 A;  1OS2 A;  1PWQ A;  2USN A;  3ZXH A;  2N8R A;  2E3X A;  1O0Q A;  1FLS A;  1Y8J A;  2W12 A;  3LMC A;  1BUD A;  4JIJ A;  1BUV M;  4H30 A;  1BQQ M;  2XS3 A;  1O0T A;  4L7A A;  4AUO A;  1IAA A;  4WK7 A;  1G05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...