2K2GA

Solution structure of the wild-type catalytic domain of human matrix metalloproteinase 12 (mmp-12) in complex with a tight-binding inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
165
structure length
165
Chain Sequence
MFREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Macrophage metalloelastase
publication title Solution structure of wild-type human matrix metalloproteinase 12 (MMP-12) in complex with a tight-binding inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 165
sequence length 165
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2k2gA00
2J0TA 5H8XA 2D1NA 2JNPA 1PWVA 5D1SA 1HV5A 1BKCI 3TSKA 1CIZA 4H1QA 1IAAA 2SRTA 1KUKA 1G49A 2YIGA 1USNA 3TVCA 2E3XA 2K2GA 1JAOA 3VI1A 1JANA 3WV3A 1XFXA 1YP1A 1JAPA 3USNA 2E2DA 5LABA 5I3MA 1D5JA 3N2UA 3LIKA 3EDGA 1G05A 1JAQA 2PJTA 2D1OA 4WZVA 4JP4A 4EFSA 5BOYA 4CTHA 1QJJA 5D7WA 1CGFA 2JSDA 3WV2A 4GUYA 830CA 3F1AA 4IUWA 1HY7A 1ZTQA 4GWMA 1XFWA 3I7IA 5D1TA 1ZXVA 2O36A 2JT6A 1IAEA 3N2VA 1O0QA 3F17A 3Q2HA 4PKQA 3O2XA 3F19A 5I12A 1CK7A 4H82A 1FM1A 1ZP5A 4FXYP 2DW2A 2K9CA 2MZIA 2OW9A 4H49A 1ASTA 5D1UA 1FBLA 5BOTA 1K7IA 1ZS0A 1OM6A 1QIAA 1EAKA 1I76A 1HFSA 3G5CA 1GO8P 3HDAP 3LKAA 1G4KA 2W15A 3RTSA 1GE6A 1XUDA 4XBHA 4AIGA 2RJPA 1GKCA 3KEJA 1G9KA 4GQLA 2O3EA 4PKUA 4WF6A 1AYKA 1D8FA 5CXAA 1QIBA 2AYKA 1G12A 1O0TA 1BUVM 1R1IA 1XFZA 966CA 3UVCA 4GF1A 1GO7P 2FV9A 1R54A 2USNA 4JPAA 2FV5A 3KHIA 4WKIA 1YCMA 1HTDA 2MLRA 4FXQA 3HYGA 2POJA 1H71P 4G0DA 3E8RA 1JK3A 4H76A 4R3VA 3SHIA 3DL1A 4XM6A 3TS4A 4I35A 4L63A 1OMJA 4A3WA 2WO9A 3EHXA 4J4MA 1BUDA 1SU3A 3L0TA 5L79A 1BKCE 3DPFA 2W14A 5B5PA 4H84A 3HY7A 1JKYA 1OS2A 1XFYA 456CA 1B3DA 1YOUA 2CKIA 2W0DA 4PKSA 2Z2DA 2N8RA 2XS3A 3LEAA 1B8YA 1CAQA 1PWQA 1K7GA 3LUNA 1HFCA 2DW1A 1CQRA 4PKRA 1XUCA 1SMPA 3L0VA 3LK8A 4XCTA 3AIGA 2XS4A 1ND1A 1A86A 3F15A 1BQOA 1BZSA 2EROA 1UMSA 1KAPP 3ELMA 1Y8JA 4H3XA 1EUBA 3EDZA 4A7BA 2HU6A 4WKEA 4GR3A 3DSLA 1DMTA 4JIJA 1HOVA 2OXZA 3HY9A 2Y6CA 3DNGA 2OVXA 1GE5A 2CLTA 1A85A 3B8ZA 4Q1LA 1Y93A 1KUFA 5BPAA 2X3BA 1AF0A 1KUGA 2WOAA 2DDYA 3KRYA 1KUHA 1R1JA 3LQ0A 5I0LA 3KWVC 3K7LA 1C8TA 1AKLA 3HDBA 1MMBA 1CGEA 2X3AA 2WO8A 3BA0A 1ZXCA 3GBOA 2X7MA 3LJGA 1MNCA 1DTHA 4DD8A 2OY4A 1Z3JA 4QKZA 2TCLA 2OI0A 2AIGP 1UTZA 4PKVA 1BSWA 3TT4A 1R55A 1CGLA 1D8MA 2MLSA 3MA2A 2OVZA 1JH1A 4G9LA 1SATA 1RM8A 1BKCA 4PKWA 4H30A 4AUOA 1KUIA 4HMAA 2I47A 2MZEA 3VTGA 2A8HA 3LUMA 1BQQM 3EWJA 1I73A 1GXDA 4XM8A 1J7NA 2OXUA 1EB6A 2ERPA 4DV8A 2MZHA 1IACA 1XFUA 1JIWP 1PWWA 3ZVSA 1QUAA 1SRPA 2L0RA 1IABA 2OXWA 4HX3A 4IN9A 4WK7A 4GR8A 2JIHA 1L6JA 1UMTA 3V96B 1SLMA 4JQGA 3EHYA 1OM8A 4DF9A 1MMRA 3F16A 2OW0A 2Y6DA 3B92A 3P24A 4JA1A 2OY2A 1ZVXA 2OZRA 1IADA 3KMEA 3LGPA 3OHLA 2QPJA 2W13A 1K7QA 2X3CA 3AYKA 5D3CA 1QICA 3NX7A 3G42A 3DPEA 5D2BA 3Q2GA 2ERQA 4H2EA 1PWUA 3OHOA 3KECA 3P1VA 1KBCA 5B5OA 3HBVP 3LJTA 1ATLA 1JIZA 1RMZA 4XM7A 2OW1A 3WV1A 4AYKA 1C7KA 2YB9A 5CUHA 4ON1A 3LMCA 4GWNA 2KRJA 1XURA 1MMPA 4I03A 3F18A 3ZUKA 1CXVA 1OS9A 1UTTA 1SLNA 2W12A 1PWPA 1BM6A 1XFVA 4PKTA 5I2ZA 1D7XA 1Y0VA 1FLSA 2RJQA 2OW2A 5JMYA 5I4OA 1MMQA 3HBUP 5CZMA 3HB2P 1GKDA 1UEAA 4FVLA 1JJ9A 1BIWA 4L6TA 3ZXHA 2DDFA 4ZR5A 3LJZA 4DPEA 2J83A 4ILWD 4FU4A 3LILA 4AXQA 1OO9A 1YQYA 3LE9A 4GR0A 3DWBA 1R1HA 4IJOA 1I1IP 1OM7A 1WNIA 1Q3AA 3I7GA 3O64A 4L19A 3K7NA 1ROSA 5L7FA 3CKIA 3EDIA 1QJIA 3U1RA 2JT5A 3LIRA 2DW0A 2V4BA 3RTTA 3B2ZA 1C3IA 3KMCA 3LQBA 3AYUA 1GE7A 5I43A 3EDHA 1S4BP 1IAGA 3KEKA
chains in the Genus database with same CATH superfamily
2J0TA 5H8XA 2D1NA 2JNPA 1PWVA 5D1SA 1HV5A 1BKCI 3TSKA 1CIZA 4H1QA 1IAAA 2SRTA 1KUKA 1G49A 2YIGA 1USNA 3TVCA 2E3XA 2K2GA 1JAOA 3VI1A 1JANA 3WV3A 1XFXA 1YP1A 1JAPA 3USNA 2E2DA 5LABA 5I3MA 1D5JA 3N2UA 3LIKA 3EDGA 1G05A 1JAQA 2PJTA 2D1OA 4WZVA 4JP4A 4EFSA 5BOYA 4CTHA 1QJJA 5D7WA 1CGFA 2JSDA 3WV2A 4GUYA 830CA 3F1AA 4IUWA 1HY7A 1ZTQA 4GWMA 1XFWA 3I7IA 5D1TA 1ZXVA 2O36A 2JT6A 1IAEA 3N2VA 1O0QA 3F17A 3Q2HA 4PKQA 1OZ9A 3O2XA 3F19A 5I12A 1CK7A 4H82A 1FM1A 1ZP5A 4FXYP 2DW2A 2K9CA 2MZIA 2OW9A 4H49A 1ASTA 5D1UA 3DTIA 1FBLA 5BOTA 1K7IA 1ZS0A 1OM6A 1QIAA 1EAKA 1I76A 1HFSA 3G5CA 1GO8P 3HDAP 3LKAA 1G4KA 2W15A 3RTSA 1GE6A 1XUDA 4XBHA 4AIGA 2RJPA 1GKCA 3KEJA 1G9KA 4GQLA 2O3EA 4PKUA 4WF6A 1AYKA 1D8FA 5CXAA 1QIBA 2AYKA 1G12A 1O0TA 1BUVM 1R1IA 1XFZA 966CA 3UVCA 4GF1A 1GO7P 2FV9A 1R54A 2USNA 4JPAA 2FV5A 3KHIA 4WKIA 1YCMA 3DTKA 1HTDA 2MLRA 4FXQA 3HYGA 2POJA 1H71P 4G0DA 3E8RA 1JK3A 4H76A 4R3VA 3SHIA 3DL1A 4XM6A 3TS4A 4I35A 4L63A 1OMJA 4A3WA 2WO9A 1XM5A 3EHXA 4J4MA 1BUDA 1SU3A 3L0TA 5L79A 1BKCE 3DPFA 2W14A 5B5PA 4H84A 3HY7A 1JKYA 1OS2A 1XFYA 456CA 1B3DA 1YOUA 2CKIA 2W0DA 4PKSA 2Z2DA 2N8RA 2XS3A 3LEAA 1B8YA 1CAQA 1TVIA 1PWQA 1K7GA 3LUNA 1HFCA 2DW1A 1CQRA 4PKRA 1XUCA 1SMPA 3L0VA 3LK8A 4XCTA 3AIGA 2XS4A 1ND1A 1A86A 3F15A 1BQOA 1BZSA 2EROA 1UMSA 1KAPP 3ELMA 1Y8JA 4H3XA 1EUBA 3EDZA 4A7BA 2HU6A 4WKEA 4GR3A 3DSLA 1DMTA 4JIJA 1HOVA 2OXZA 3HY9A 2YUFA 2Y6CA 3DNGA 2OVXA 1GE5A 2CLTA 1A85A 3B8ZA 4Q1LA 1Y93A 1KUFA 5BPAA 2X3BA 1AF0A 1KUGA 2WOAA 2DDYA 3KRYA 1KUHA 1R1JA 3LQ0A 5I0LA 3KWVC 3K7LA 1C8TA 1AKLA 3HDBA 1MMBA 1CGEA 2X3AA 2WO8A 3BA0A 1ZXCA 3GBOA 2X7MA 3LJGA 1MNCA 1DTHA 4DD8A 2OY4A 1Z3JA 4QKZA 2TCLA 2OI0A 2AIGP 1UTZA 4PKVA 1BSWA 3TT4A 1R55A 1CGLA 1D8MA 2MLSA 1XAXA 3MA2A 2OVZA 1JH1A 4G9LA 1SATA 1RM8A 1BKCA 4PKWA 4H30A 4AUOA 1KUIA 4HMAA 2I47A 2MZEA 3VTGA 2A8HA 3LUMA 1BQQM 3EWJA 1I73A 1GXDA 4XM8A 1J7NA 2OXUA 1EB6A 2ERPA 4DV8A 2MZHA 1IACA 1XFUA 1JIWP 1PWWA 3ZVSA 1QUAA 1SRPA 2L0RA 1IABA 2OXWA 4HX3A 4IN9A 4WK7A 4GR8A 2JIHA 1L6JA 1UMTA 3V96B 1SLMA 4JQGA 3EHYA 1OM8A 4DF9A 1MMRA 3F16A 2OW0A 2Y6DA 3DTEA 3B92A 3P24A 4JA1A 2OY2A 1ZVXA 2OZRA 1IADA 3KMEA 3LGPA 3OHLA 2QPJA 2W13A 1K7QA 2X3CA 3AYKA 5D3CA 1QICA 3NX7A 3G42A 3DPEA 5D2BA 3Q2GA 2ERQA 4H2EA 1PWUA 3OHOA 3KECA 3P1VA 1KBCA 5B5OA 3HBVP 3LJTA 1ATLA 1JIZA 1RMZA 4XM7A 2OW1A 3WV1A 4L7AA 4AYKA 1C7KA 2YB9A 5CUHA 4ON1A 3LMCA 4GWNA 2KRJA 1XURA 1MMPA 4I03A 3F18A 3ZUKA 1CXVA 1OS9A 1UTTA 1SLNA 2W12A 1PWPA 1BM6A 1XFVA 4PKTA 5I2ZA 1D7XA 1Y0VA 1FLSA 2RJQA 2OW2A 5JMYA 5I4OA 1MMQA 3HBUP 5CZMA 3HB2P 1GKDA 1UEAA 4FVLA 1JJ9A 1BIWA 4L6TA 3ZXHA 2DDFA 4ZR5A 3LJZA 4DPEA 2J83A 4ILWD 4FU4A 3LILA 4AXQA 1OO9A 1YQYA 3LE9A 4GR0A 3DWBA 1R1HA 4IJOA 1I1IP 1OM7A 1WNIA 1Q3AA 3I7GA 3O64A 4L19A 3K7NA 1ROSA 5L7FA 3CKIA 3EDIA 1QJIA 3U1RA 2JT5A 3LIRA 2DW0A 2V4BA 3RTTA 3B2ZA 1C3IA 3KMCA 3LQBA 3AYUA 1GE7A 5I43A 3EDHA 1S4BP 1IAGA 3KEKA
chains in the Genus database with same CATH topology
2J0TA 5H8XA 2D1NA 2JNPA 1PWVA 5D1SA 1HV5A 1BKCI 3TSKA 1CIZA 4H1QA 1IAAA 2SRTA 1KUKA 1G49A 2YIGA 1USNA 3TVCA 2E3XA 2K2GA 1JAOA 3VI1A 1JANA 3WV3A 1XFXA 1YP1A 1JAPA 3USNA 2E2DA 5LABA 5I3MA 1D5JA 3N2UA 3LIKA 3EDGA 1G05A 1JAQA 2PJTA 2D1OA 4WZVA 4JP4A 4EFSA 5BOYA 4CTHA 1QJJA 5D7WA 1CGFA 2JSDA 3WV2A 4GUYA 830CA 3F1AA 4IUWA 1HY7A 1ZTQA 4GWMA 1XFWA 3I7IA 5D1TA 1ZXVA 2O36A 2JT6A 1IAEA 3N2VA 1O0QA 3F17A 3Q2HA 4PKQA 3O2XA 3F19A 5I12A 1CK7A 4H82A 1FM1A 1ZP5A 4FXYP 2DW2A 2K9CA 2MZIA 2OW9A 4H49A 1ASTA 5D1UA 3DTIA 1FBLA 5BOTA 1K7IA 1ZS0A 1OM6A 1QIAA 1EAKA 1I76A 1HFSA 3G5CA 1GO8P 3HDAP 3LKAA 1G4KA 2W15A 3RTSA 1GE6A 1XUDA 4XBHA 4AIGA 2RJPA 1GKCA 3KEJA 1G9KA 4GQLA 2O3EA 4PKUA 4WF6A 1AYKA 1D8FA 5CXAA 1QIBA 2AYKA 1G12A 1O0TA 1BUVM 1R1IA 1XFZA 966CA 3UVCA 4GF1A 1GO7P 2FV9A 1R54A 2USNA 4JPAA 2FV5A 3KHIA 4WKIA 1YCMA 3DTKA 1HTDA 2MLRA 4FXQA 3HYGA 2POJA 1H71P 4G0DA 3E8RA 1JK3A 4H76A 4R3VA 3SHIA 3DL1A 4XM6A 3TS4A 4I35A 4L63A 1OMJA 4A3WA 2WO9A 3EHXA 4J4MA 1BUDA 1SU3A 3L0TA 5L79A 1BKCE 3DPFA 2W14A 5B5PA 4H84A 3HY7A 1JKYA 1OS2A 1XFYA 456CA 1B3DA 1YOUA 2CKIA 2W0DA 4PKSA 2Z2DA 2N8RA 2XS3A 3LEAA 1B8YA 1CAQA 1PWQA 1K7GA 3LUNA 1HFCA 2DW1A 1CQRA 4PKRA 1XUCA 1SMPA 3L0VA 3LK8A 4XCTA 3AIGA 2XS4A 1ND1A 1A86A 3F15A 1BQOA 1BZSA 2EROA 1UMSA 1KAPP 3ELMA 1Y8JA 4H3XA 1EUBA 3EDZA 4A7BA 2HU6A 4WKEA 4GR3A 3DSLA 1DMTA 4JIJA 1HOVA 2OXZA 3HY9A 2YUFA 2Y6CA 3DNGA 2OVXA 1GE5A 2CLTA 1A85A 3B8ZA 4Q1LA 1Y93A 1KUFA 5BPAA 2X3BA 1AF0A 1KUGA 2WOAA 2DDYA 3KRYA 1KUHA 1R1JA 3LQ0A 5I0LA 3KWVC 3K7LA 1C8TA 1AKLA 3HDBA 1MMBA 1CGEA 2X3AA 2WO8A 3BA0A 1ZXCA 3GBOA 2X7MA 3LJGA 1MNCA 1DTHA 4DD8A 2OY4A 1Z3JA 4QKZA 2TCLA 2OI0A 2AIGP 1UTZA 4PKVA 1BSWA 3TT4A 1R55A 1CGLA 1D8MA 2MLSA 3MA2A 2OVZA 1JH1A 4G9LA 1SATA 1RM8A 1BKCA 4PKWA 4H30A 4AUOA 1KUIA 4HMAA 2I47A 2MZEA 3VTGA 2A8HA 3LUMA 1BQQM 3EWJA 1I73A 1GXDA 4XM8A 1J7NA 2OXUA 1EB6A 2ERPA 4DV8A 2MZHA 1IACA 1XFUA 1JIWP 1PWWA 3ZVSA 1QUAA 1SRPA 2L0RA 1IABA 2OXWA 4HX3A 4IN9A 4WK7A 4GR8A 2JIHA 1L6JA 1UMTA 3V96B 1SLMA 4JQGA 3EHYA 1OM8A 4DF9A 1MMRA 3F16A 2OW0A 2Y6DA 3DTEA 3B92A 3P24A 4JA1A 2OY2A 1ZVXA 2OZRA 1IADA 3KMEA 3LGPA 3OHLA 2QPJA 2W13A 1K7QA 2X3CA 3AYKA 5D3CA 1QICA 3NX7A 3G42A 3DPEA 5D2BA 3Q2GA 2ERQA 4H2EA 1PWUA 3OHOA 3KECA 3P1VA 1KBCA 5B5OA 3HBVP 3LJTA 1ATLA 1JIZA 1RMZA 4XM7A 2OW1A 3WV1A 4L7AA 4AYKA 1C7KA 2YB9A 5CUHA 4ON1A 3LMCA 4GWNA 2KRJA 1XURA 1MMPA 4I03A 3F18A 3ZUKA 1CXVA 1OS9A 1UTTA 1SLNA 2W12A 1PWPA 1BM6A 1XFVA 4PKTA 5I2ZA 1D7XA 1Y0VA 1FLSA 2RJQA 2OW2A 5JMYA 5I4OA 1MMQA 3HBUP 5CZMA 3HB2P 1GKDA 1UEAA 4FVLA 1JJ9A 1BIWA 4L6TA 3ZXHA 2DDFA 4ZR5A 3LJZA 4DPEA 2J83A 4ILWD 4FU4A 3LILA 4AXQA 1OO9A 1YQYA 3LE9A 4GR0A 3DWBA 1R1HA 4IJOA 1I1IP 1OM7A 1WNIA 1Q3AA 3I7GA 3O64A 4L19A 3K7NA 1ROSA 5L7FA 3CKIA 3EDIA 1QJIA 3U1RA 2JT5A 3LIRA 2DW0A 2V4BA 3RTTA 3B2ZA 1C3IA 3KMCA 3LQBA 3AYUA 1GE7A 5I43A 3EDHA 1S4BP 1IAGA 3KEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0T A;  5H8X A;  2D1N A;  2JNP A;  1PWV A;  5D1S A;  1HV5 A;  1BKC I;  3TSK A;  1CIZ A;  4H1Q A;  1IAA A;  2SRT A;  1KUK A;  1G49 A;  2YIG A;  1USN A;  3TVC A;  2E3X A;  2K2G A;  1JAO A;  3VI1 A;  1JAN A;  3WV3 A;  1XFX A;  1YP1 A;  1JAP A;  3USN A;  2E2D A;  5LAB A;  5I3M A;  1D5J A;  3N2U A;  3LIK A;  3EDG A;  1G05 A;  1JAQ A;  2PJT A;  2D1O A;  4WZV A;  4JP4 A;  4EFS A;  5BOY A;  4CTH A;  1QJJ A;  5D7W A;  1CGF A;  2JSD A;  3WV2 A;  4GUY A;  830C A;  3F1A A;  4IUW A;  1HY7 A;  1ZTQ A;  4GWM A;  1XFW A;  3I7I A;  5D1T A;  1ZXV A;  2O36 A;  2JT6 A;  1IAE A;  3N2V A;  1O0Q A;  3F17 A;  3Q2H A;  4PKQ A;  3O2X A;  3F19 A;  5I12 A;  1CK7 A;  4H82 A;  1FM1 A;  1ZP5 A;  4FXY P;  2DW2 A;  2K9C A;  2MZI A;  2OW9 A;  4H49 A;  1AST A;  5D1U A;  1FBL A;  5BOT A;  1K7I A;  1ZS0 A;  1OM6 A;  1QIA A;  1EAK A;  1I76 A;  1HFS A;  3G5C A;  1GO8 P;  3HDA P;  3LKA A;  1G4K A;  2W15 A;  3RTS A;  1GE6 A;  1XUD A;  4XBH A;  4AIG A;  2RJP A;  1GKC A;  3KEJ A;  1G9K A;  4GQL A;  2O3E A;  4PKU A;  4WF6 A;  1AYK A;  1D8F A;  5CXA A;  1QIB A;  2AYK A;  1G12 A;  1O0T A;  1BUV M;  1R1I A;  1XFZ A;  966C A;  3UVC A;  4GF1 A;  1GO7 P;  2FV9 A;  1R54 A;  2USN A;  4JPA A;  2FV5 A;  3KHI A;  4WKI A;  1YCM A;  1HTD A;  2MLR A;  4FXQ A;  3HYG A;  2POJ A;  1H71 P;  4G0D A;  3E8R A;  1JK3 A;  4H76 A;  4R3V A;  3SHI A;  3DL1 A;  4XM6 A;  3TS4 A;  4I35 A;  4L63 A;  1OMJ A;  4A3W A;  2WO9 A;  3EHX A;  4J4M A;  1BUD A;  1SU3 A;  3L0T A;  5L79 A;  1BKC E;  3DPF A;  2W14 A;  5B5P A;  4H84 A;  3HY7 A;  1JKY A;  1OS2 A;  1XFY A;  456C A;  1B3D A;  1YOU A;  2CKI A;  2W0D A;  4PKS A;  2Z2D A;  2N8R A;  2XS3 A;  3LEA A;  1B8Y A;  1CAQ A;  1PWQ A;  1K7G A;  3LUN A;  1HFC A;  2DW1 A;  1CQR A;  4PKR A;  1XUC A;  1SMP A;  3L0V A;  3LK8 A;  4XCT A;  3AIG A;  2XS4 A;  1ND1 A;  1A86 A;  3F15 A;  1BQO A;  1BZS A;  2ERO A;  1UMS A;  1KAP P;  3ELM A;  1Y8J A;  4H3X A;  1EUB A;  3EDZ A;  4A7B A;  2HU6 A;  4WKE A;  4GR3 A;  3DSL A;  1DMT A;  4JIJ A;  1HOV A;  2OXZ A;  3HY9 A;  2Y6C A;  3DNG A;  2OVX A;  1GE5 A;  2CLT A;  1A85 A;  3B8Z A;  4Q1L A;  1Y93 A;  1KUF A;  5BPA A;  2X3B A;  1AF0 A;  1KUG A;  2WOA A;  2DDY A;  3KRY A;  1KUH A;  1R1J A;  3LQ0 A;  5I0L A;  3KWV C;  3K7L A;  1C8T A;  1AKL A;  3HDB A;  1MMB A;  1CGE A;  2X3A A;  2WO8 A;  3BA0 A;  1ZXC A;  3GBO A;  2X7M A;  3LJG A;  1MNC A;  1DTH A;  4DD8 A;  2OY4 A;  1Z3J A;  4QKZ A;  2TCL A;  2OI0 A;  2AIG P;  1UTZ A;  4PKV A;  1BSW A;  3TT4 A;  1R55 A;  1CGL A;  1D8M A;  2MLS A;  3MA2 A;  2OVZ A;  1JH1 A;  4G9L A;  1SAT A;  1RM8 A;  1BKC A;  4PKW A;  4H30 A;  4AUO A;  1KUI A;  4HMA A;  2I47 A;  2MZE A;  3VTG A;  2A8H A;  3LUM A;  1BQQ M;  3EWJ A;  1I73 A;  1GXD A;  4XM8 A;  1J7N A;  2OXU A;  1EB6 A;  2ERP A;  4DV8 A;  2MZH A;  1IAC A;  1XFU A;  1JIW P;  1PWW A;  3ZVS A;  1QUA A;  1SRP A;  2L0R A;  1IAB A;  2OXW A;  4HX3 A;  4IN9 A;  4WK7 A;  4GR8 A;  2JIH A;  1L6J A;  1UMT A;  3V96 B;  1SLM A;  4JQG A;  3EHY A;  1OM8 A;  4DF9 A;  1MMR A;  3F16 A;  2OW0 A;  2Y6D A;  3B92 A;  3P24 A;  4JA1 A;  2OY2 A;  1ZVX A;  2OZR A;  1IAD A;  3KME A;  3LGP A;  3OHL A;  2QPJ A;  2W13 A;  1K7Q A;  2X3C A;  3AYK A;  5D3C A;  1QIC A;  3NX7 A;  3G42 A;  3DPE A;  5D2B A;  3Q2G A;  2ERQ A;  4H2E A;  1PWU A;  3OHO A;  3KEC A;  3P1V A;  1KBC A;  5B5O A;  3HBV P;  3LJT A;  1ATL A;  1JIZ A;  1RMZ A;  4XM7 A;  2OW1 A;  3WV1 A;  4AYK A;  1C7K A;  2YB9 A;  5CUH A;  4ON1 A;  3LMC A;  4GWN A;  2KRJ A;  1XUR A;  1MMP A;  4I03 A;  3F18 A;  3ZUK A;  1CXV A;  1OS9 A;  1UTT A;  1SLN A;  2W12 A;  1PWP A;  1BM6 A;  1XFV A;  4PKT A;  5I2Z A;  1D7X A;  1Y0V A;  1FLS A;  2RJQ A;  2OW2 A;  5JMY A;  5I4O A;  1MMQ A;  3HBU P;  5CZM A;  3HB2 P;  1GKD A;  1UEA A;  4FVL A;  1JJ9 A;  1BIW A;  4L6T A;  3ZXH A;  2DDF A;  4ZR5 A;  3LJZ A;  4DPE A;  2J83 A;  4ILW D;  4FU4 A;  3LIL A;  4AXQ A;  1OO9 A;  1YQY A;  3LE9 A;  4GR0 A;  3DWB A;  1R1H A;  4IJO A;  1I1I P;  1OM7 A;  1WNI A;  1Q3A A;  3I7G A;  3O64 A;  4L19 A;  3K7N A;  1ROS A;  5L7F A;  3CKI A;  3EDI A;  1QJI A;  3U1R A;  2JT5 A;  3LIR A;  2DW0 A;  2V4B A;  3RTT A;  3B2Z A;  1C3I A;  3KMC A;  3LQB A;  3AYU A;  1GE7 A;  5I43 A;  3EDH A;  1S4B P;  1IAG A;  3KEK A; 
#chains in the Genus database with same CATH topology
 2J0T A;  5H8X A;  2D1N A;  2JNP A;  1PWV A;  5D1S A;  1HV5 A;  1BKC I;  3TSK A;  1CIZ A;  4H1Q A;  1IAA A;  2SRT A;  1KUK A;  1G49 A;  2YIG A;  1USN A;  3TVC A;  2E3X A;  2K2G A;  1JAO A;  3VI1 A;  1JAN A;  3WV3 A;  1XFX A;  1YP1 A;  1JAP A;  3USN A;  2E2D A;  5LAB A;  5I3M A;  1D5J A;  3N2U A;  3LIK A;  3EDG A;  1G05 A;  1JAQ A;  2PJT A;  2D1O A;  4WZV A;  4JP4 A;  4EFS A;  5BOY A;  4CTH A;  1QJJ A;  5D7W A;  1CGF A;  2JSD A;  3WV2 A;  4GUY A;  830C A;  3F1A A;  4IUW A;  1HY7 A;  1ZTQ A;  4GWM A;  1XFW A;  3I7I A;  5D1T A;  1ZXV A;  2O36 A;  2JT6 A;  1IAE A;  3N2V A;  1O0Q A;  3F17 A;  3Q2H A;  4PKQ A;  1OZ9 A;  3O2X A;  3F19 A;  5I12 A;  1CK7 A;  4H82 A;  1FM1 A;  1ZP5 A;  4FXY P;  2DW2 A;  2K9C A;  2MZI A;  2OW9 A;  4H49 A;  1AST A;  5D1U A;  3DTI A;  1FBL A;  5BOT A;  1K7I A;  1ZS0 A;  1OM6 A;  1QIA A;  1EAK A;  1I76 A;  1HFS A;  3G5C A;  1GO8 P;  3HDA P;  3LKA A;  1G4K A;  2W15 A;  3RTS A;  1GE6 A;  1XUD A;  4XBH A;  4AIG A;  2RJP A;  1GKC A;  3KEJ A;  1G9K A;  4GQL A;  2O3E A;  4PKU A;  4WF6 A;  1AYK A;  1D8F A;  5CXA A;  1QIB A;  2AYK A;  1G12 A;  1O0T A;  1BUV M;  1R1I A;  1XFZ A;  966C A;  3UVC A;  4GF1 A;  1GO7 P;  2FV9 A;  1R54 A;  2USN A;  4JPA A;  2FV5 A;  3KHI A;  4WKI A;  1YCM A;  3DTK A;  1HTD A;  2MLR A;  4FXQ A;  3HYG A;  2POJ A;  1H71 P;  4G0D A;  3E8R A;  1JK3 A;  4H76 A;  4R3V A;  3SHI A;  3DL1 A;  4XM6 A;  3TS4 A;  4I35 A;  4L63 A;  1OMJ A;  4A3W A;  2WO9 A;  1XM5 A;  3EHX A;  4J4M A;  1BUD A;  1SU3 A;  3L0T A;  5L79 A;  1BKC E;  3DPF A;  2W14 A;  5B5P A;  4H84 A;  3HY7 A;  1JKY A;  1OS2 A;  1XFY A;  456C A;  1B3D A;  1YOU A;  2CKI A;  2W0D A;  4PKS A;  2Z2D A;  2N8R A;  2XS3 A;  3LEA A;  1B8Y A;  1CAQ A;  1TVI A;  1PWQ A;  1K7G A;  3LUN A;  1HFC A;  2DW1 A;  1CQR A;  4PKR A;  1XUC A;  1SMP A;  3L0V A;  3LK8 A;  4XCT A;  3AIG A;  2XS4 A;  1ND1 A;  1A86 A;  3F15 A;  1BQO A;  1BZS A;  2ERO A;  1UMS A;  1KAP P;  3ELM A;  1Y8J A;  4H3X A;  1EUB A;  3EDZ A;  4A7B A;  2HU6 A;  4WKE A;  4GR3 A;  3DSL A;  1DMT A;  4JIJ A;  1HOV A;  2OXZ A;  3HY9 A;  2YUF A;  2Y6C A;  3DNG A;  2OVX A;  1GE5 A;  2CLT A;  1A85 A;  3B8Z A;  4Q1L A;  1Y93 A;  1KUF A;  5BPA A;  2X3B A;  1AF0 A;  1KUG A;  2WOA A;  2DDY A;  3KRY A;  1KUH A;  1R1J A;  3LQ0 A;  5I0L A;  3KWV C;  3K7L A;  1C8T A;  1AKL A;  3HDB A;  1MMB A;  1CGE A;  2X3A A;  2WO8 A;  3BA0 A;  1ZXC A;  3GBO A;  2X7M A;  3LJG A;  1MNC A;  1DTH A;  4DD8 A;  2OY4 A;  1Z3J A;  4QKZ A;  2TCL A;  2OI0 A;  2AIG P;  1UTZ A;  4PKV A;  1BSW A;  3TT4 A;  1R55 A;  1CGL A;  1D8M A;  2MLS A;  1XAX A;  3MA2 A;  2OVZ A;  1JH1 A;  4G9L A;  1SAT A;  1RM8 A;  1BKC A;  4PKW A;  4H30 A;  4AUO A;  1KUI A;  4HMA A;  2I47 A;  2MZE A;  3VTG A;  2A8H A;  3LUM A;  1BQQ M;  3EWJ A;  1I73 A;  1GXD A;  4XM8 A;  1J7N A;  2OXU A;  1EB6 A;  2ERP A;  4DV8 A;  2MZH A;  1IAC A;  1XFU A;  1JIW P;  1PWW A;  3ZVS A;  1QUA A;  1SRP A;  2L0R A;  1IAB A;  2OXW A;  4HX3 A;  4IN9 A;  4WK7 A;  4GR8 A;  2JIH A;  1L6J A;  1UMT A;  3V96 B;  1SLM A;  4JQG A;  3EHY A;  1OM8 A;  4DF9 A;  1MMR A;  3F16 A;  2OW0 A;  2Y6D A;  3DTE A;  3B92 A;  3P24 A;  4JA1 A;  2OY2 A;  1ZVX A;  2OZR A;  1IAD A;  3KME A;  3LGP A;  3OHL A;  2QPJ A;  2W13 A;  1K7Q A;  2X3C A;  3AYK A;  5D3C A;  1QIC A;  3NX7 A;  3G42 A;  3DPE A;  5D2B A;  3Q2G A;  2ERQ A;  4H2E A;  1PWU A;  3OHO A;  3KEC A;  3P1V A;  1KBC A;  5B5O A;  3HBV P;  3LJT A;  1ATL A;  1JIZ A;  1RMZ A;  4XM7 A;  2OW1 A;  3WV1 A;  4L7A A;  4AYK A;  1C7K A;  2YB9 A;  5CUH A;  4ON1 A;  3LMC A;  4GWN A;  2KRJ A;  1XUR A;  1MMP A;  4I03 A;  3F18 A;  3ZUK A;  1CXV A;  1OS9 A;  1UTT A;  1SLN A;  2W12 A;  1PWP A;  1BM6 A;  1XFV A;  4PKT A;  5I2Z A;  1D7X A;  1Y0V A;  1FLS A;  2RJQ A;  2OW2 A;  5JMY A;  5I4O A;  1MMQ A;  3HBU P;  5CZM A;  3HB2 P;  1GKD A;  1UEA A;  4FVL A;  1JJ9 A;  1BIW A;  4L6T A;  3ZXH A;  2DDF A;  4ZR5 A;  3LJZ A;  4DPE A;  2J83 A;  4ILW D;  4FU4 A;  3LIL A;  4AXQ A;  1OO9 A;  1YQY A;  3LE9 A;  4GR0 A;  3DWB A;  1R1H A;  4IJO A;  1I1I P;  1OM7 A;  1WNI A;  1Q3A A;  3I7G A;  3O64 A;  4L19 A;  3K7N A;  1ROS A;  5L7F A;  3CKI A;  3EDI A;  1QJI A;  3U1R A;  2JT5 A;  3LIR A;  2DW0 A;  2V4B A;  3RTT A;  3B2Z A;  1C3I A;  3KMC A;  3LQB A;  3AYU A;  1GE7 A;  5I43 A;  3EDH A;  1S4B P;  1IAG A;  3KEK A; 
#chains in the Genus database with same CATH homology
 2J0T A;  5H8X A;  2D1N A;  2JNP A;  1PWV A;  5D1S A;  1HV5 A;  1BKC I;  3TSK A;  1CIZ A;  4H1Q A;  1IAA A;  2SRT A;  1KUK A;  1G49 A;  2YIG A;  1USN A;  3TVC A;  2E3X A;  2K2G A;  1JAO A;  3VI1 A;  1JAN A;  3WV3 A;  1XFX A;  1YP1 A;  1JAP A;  3USN A;  2E2D A;  5LAB A;  5I3M A;  1D5J A;  3N2U A;  3LIK A;  3EDG A;  1G05 A;  1JAQ A;  2PJT A;  2D1O A;  4WZV A;  4JP4 A;  4EFS A;  5BOY A;  4CTH A;  1QJJ A;  5D7W A;  1CGF A;  2JSD A;  3WV2 A;  4GUY A;  830C A;  3F1A A;  4IUW A;  1HY7 A;  1ZTQ A;  4GWM A;  1XFW A;  3I7I A;  5D1T A;  1ZXV A;  2O36 A;  2JT6 A;  1IAE A;  3N2V A;  1O0Q A;  3F17 A;  3Q2H A;  4PKQ A;  3O2X A;  3F19 A;  5I12 A;  1CK7 A;  4H82 A;  1FM1 A;  1ZP5 A;  4FXY P;  2DW2 A;  2K9C A;  2MZI A;  2OW9 A;  4H49 A;  1AST A;  5D1U A;  3DTI A;  1FBL A;  5BOT A;  1K7I A;  1ZS0 A;  1OM6 A;  1QIA A;  1EAK A;  1I76 A;  1HFS A;  3G5C A;  1GO8 P;  3HDA P;  3LKA A;  1G4K A;  2W15 A;  3RTS A;  1GE6 A;  1XUD A;  4XBH A;  4AIG A;  2RJP A;  1GKC A;  3KEJ A;  1G9K A;  4GQL A;  2O3E A;  4PKU A;  4WF6 A;  1AYK A;  1D8F A;  5CXA A;  1QIB A;  2AYK A;  1G12 A;  1O0T A;  1BUV M;  1R1I A;  1XFZ A;  966C A;  3UVC A;  4GF1 A;  1GO7 P;  2FV9 A;  1R54 A;  2USN A;  4JPA A;  2FV5 A;  3KHI A;  4WKI A;  1YCM A;  3DTK A;  1HTD A;  2MLR A;  4FXQ A;  3HYG A;  2POJ A;  1H71 P;  4G0D A;  3E8R A;  1JK3 A;  4H76 A;  4R3V A;  3SHI A;  3DL1 A;  4XM6 A;  3TS4 A;  4I35 A;  4L63 A;  1OMJ A;  4A3W A;  2WO9 A;  3EHX A;  4J4M A;  1BUD A;  1SU3 A;  3L0T A;  5L79 A;  1BKC E;  3DPF A;  2W14 A;  5B5P A;  4H84 A;  3HY7 A;  1JKY A;  1OS2 A;  1XFY A;  456C A;  1B3D A;  1YOU A;  2CKI A;  2W0D A;  4PKS A;  2Z2D A;  2N8R A;  2XS3 A;  3LEA A;  1B8Y A;  1CAQ A;  1PWQ A;  1K7G A;  3LUN A;  1HFC A;  2DW1 A;  1CQR A;  4PKR A;  1XUC A;  1SMP A;  3L0V A;  3LK8 A;  4XCT A;  3AIG A;  2XS4 A;  1ND1 A;  1A86 A;  3F15 A;  1BQO A;  1BZS A;  2ERO A;  1UMS A;  1KAP P;  3ELM A;  1Y8J A;  4H3X A;  1EUB A;  3EDZ A;  4A7B A;  2HU6 A;  4WKE A;  4GR3 A;  3DSL A;  1DMT A;  4JIJ A;  1HOV A;  2OXZ A;  3HY9 A;  2YUF A;  2Y6C A;  3DNG A;  2OVX A;  1GE5 A;  2CLT A;  1A85 A;  3B8Z A;  4Q1L A;  1Y93 A;  1KUF A;  5BPA A;  2X3B A;  1AF0 A;  1KUG A;  2WOA A;  2DDY A;  3KRY A;  1KUH A;  1R1J A;  3LQ0 A;  5I0L A;  3KWV C;  3K7L A;  1C8T A;  1AKL A;  3HDB A;  1MMB A;  1CGE A;  2X3A A;  2WO8 A;  3BA0 A;  1ZXC A;  3GBO A;  2X7M A;  3LJG A;  1MNC A;  1DTH A;  4DD8 A;  2OY4 A;  1Z3J A;  4QKZ A;  2TCL A;  2OI0 A;  2AIG P;  1UTZ A;  4PKV A;  1BSW A;  3TT4 A;  1R55 A;  1CGL A;  1D8M A;  2MLS A;  3MA2 A;  2OVZ A;  1JH1 A;  4G9L A;  1SAT A;  1RM8 A;  1BKC A;  4PKW A;  4H30 A;  4AUO A;  1KUI A;  4HMA A;  2I47 A;  2MZE A;  3VTG A;  2A8H A;  3LUM A;  1BQQ M;  3EWJ A;  1I73 A;  1GXD A;  4XM8 A;  1J7N A;  2OXU A;  1EB6 A;  2ERP A;  4DV8 A;  2MZH A;  1IAC A;  1XFU A;  1JIW P;  1PWW A;  3ZVS A;  1QUA A;  1SRP A;  2L0R A;  1IAB A;  2OXW A;  4HX3 A;  4IN9 A;  4WK7 A;  4GR8 A;  2JIH A;  1L6J A;  1UMT A;  3V96 B;  1SLM A;  4JQG A;  3EHY A;  1OM8 A;  4DF9 A;  1MMR A;  3F16 A;  2OW0 A;  2Y6D A;  3DTE A;  3B92 A;  3P24 A;  4JA1 A;  2OY2 A;  1ZVX A;  2OZR A;  1IAD A;  3KME A;  3LGP A;  3OHL A;  2QPJ A;  2W13 A;  1K7Q A;  2X3C A;  3AYK A;  5D3C A;  1QIC A;  3NX7 A;  3G42 A;  3DPE A;  5D2B A;  3Q2G A;  2ERQ A;  4H2E A;  1PWU A;  3OHO A;  3KEC A;  3P1V A;  1KBC A;  5B5O A;  3HBV P;  3LJT A;  1ATL A;  1JIZ A;  1RMZ A;  4XM7 A;  2OW1 A;  3WV1 A;  4L7A A;  4AYK A;  1C7K A;  2YB9 A;  5CUH A;  4ON1 A;  3LMC A;  4GWN A;  2KRJ A;  1XUR A;  1MMP A;  4I03 A;  3F18 A;  3ZUK A;  1CXV A;  1OS9 A;  1UTT A;  1SLN A;  2W12 A;  1PWP A;  1BM6 A;  1XFV A;  4PKT A;  5I2Z A;  1D7X A;  1Y0V A;  1FLS A;  2RJQ A;  2OW2 A;  5JMY A;  5I4O A;  1MMQ A;  3HBU P;  5CZM A;  3HB2 P;  1GKD A;  1UEA A;  4FVL A;  1JJ9 A;  1BIW A;  4L6T A;  3ZXH A;  2DDF A;  4ZR5 A;  3LJZ A;  4DPE A;  2J83 A;  4ILW D;  4FU4 A;  3LIL A;  4AXQ A;  1OO9 A;  1YQY A;  3LE9 A;  4GR0 A;  3DWB A;  1R1H A;  4IJO A;  1I1I P;  1OM7 A;  1WNI A;  1Q3A A;  3I7G A;  3O64 A;  4L19 A;  3K7N A;  1ROS A;  5L7F A;  3CKI A;  3EDI A;  1QJI A;  3U1R A;  2JT5 A;  3LIR A;  2DW0 A;  2V4B A;  3RTT A;  3B2Z A;  1C3I A;  3KMC A;  3LQB A;  3AYU A;  1GE7 A;  5I43 A;  3EDH A;  1S4B P;  1IAG A;  3KEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...