5D2BA

Crystal structure of a mutated catalytic domain of human mmp12 in complex with an hydroxamate analogue of rxp470
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Macrophage metalloelastase
publication title Zinc-Metalloproteinase Inhibitors: Evaluation of the Complex Role Played by the Zinc-Binding Group on Potency and Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5d2bA00
2W13A 3O2XA 4XCTA 1C3IA 1OS2A 1WNIA 4FVLA 1BQOA 1GXDA 3EHYA 1FBLA 3F16A 3LJGA 1ZS0A 3LUNA 4R3VA 3HDBA 3KMEA 1XFZA 2E2DA 3KEJA 3Q2GA 1O0QA 5D1UA 3DSLA 4HMAA 4J4MA 4WZVA 4CTHA 1HFSA 3LE9A 5I43A 1QJJA 1ZXVA 1K7QA 1UTZA 4G0DA 2Z2DA 1KBCA 1UTTA 4GF1A 3E8RA 1UMTA 2OVXA 1BIWA 4DF9A 5D1TA 4GWMA 2OXUA 1B8YA 2EROA 3P24A 1KUKA 1OO9A 4JP4A 3RTSA 3LGPA 1BSWA 3KWVC 4IUWA 1O0TA 2USNA 4I35A 3ZVSA 1JIWP 3KECA 4ZR5A 3I7GA 5I3MA 4PKRA 1BKCA 3DNGA 3G5CA 1OMJA 3U1RA 2O36A 3NX7A 1PWWA 4WF6A 4DV8A 2DW1A 2I47A 3KHIA 1CK7A 2MZEA 3HY9A 3F1AA 1RMZA 2O3EA 4PKSA 5L79A 5BOTA 1R1JA 3UVCA 1D5JA 2E3XA 2JSDA 3ZUKA 2DW2A 2MZHA 1MMRA 1GKCA 4WKIA 1C7KA 1ROSA 1R54A 1H71P 1SMPA 3BA0A 4PKUA 2POJA 3KMCA 2JT6A 3TSKA 3P1VA 4JQGA 1G05A 3VI1A 2D1OA 4GR8A 2WOAA 3DPEA 1R1HA 1EUBA 2KRJA 1BUVM 4GR0A 1Y93A 3LUMA 4L19A 4GWNA 1GE6A 2WO9A 2W12A 4XM7A 1IADA 3HYGA 3LEAA 3USNA 1HV5A 4A7BA 1JANA 3EHXA 4H1QA 3KEKA 1HY7A 1BQQM 1YQYA 1ND1A 2W14A 5CXAA 1JAOA 3OHLA 3LQ0A 1GKDA 4GQLA 3WV3A 1KUIA 3OHOA 1JK3A 1XFUA 5JMYA 1ZTQA 1G49A 3TT4A 3EDGA 5I0LA 1XUCA 3LKAA 1JJ9A 3ZXHA 1C8TA 1MMQA 3EDHA 3V96B 3AIGA 1I73A 2OW0A 3LJZA 830CA 3HBUP 4G9LA 1AYKA 3O64A 4H30A 1SLMA 5I12A 3EWJA 2QPJA 1QJIA 2DDYA 4GUYA 2FV9A 1CGLA 1DMTA 1MNCA 1XFVA 1BKCE 1ASTA 2Y6CA 4H3XA 2HU6A 2OXZA 3B8ZA 4JPAA 2YIGA 966CA 2X3CA 1HTDA 2Y6DA 1BUDA 1YP1A 3B2ZA 3L0TA 3TS4A 2MZIA 4EFSA 3GBOA 1IAGA 3AYKA 5D1SA 1XUDA 2ERPA 1GO7P 2ERQA 3LILA 4L63A 3LQBA 1EAKA 1SLNA 1D8FA 4HX3A 5B5PA 1K7IA 1BM6A 2J0TA 4H2EA 4DD8A 4FXQA 2A8HA 1Z3JA 4PKWA 4JIJA 3L0VA 4JA1A 1CIZA 5BPAA 3WV1A 1MMPA 5D3CA 1CGEA 5B5OA 3MA2A 3ELMA 3RTTA 1JIZA 1KAPP 1D8MA 1XFWA 2OZRA 5H8XA 1IABA 1AKLA 1QICA 2CLTA 2W0DA 3LJTA 1CGFA 1JAQA 2OVZA 3DPFA 3AYUA 2JT5A 2OXWA 3KRYA 1YOUA 4AYKA 1CAQA 1QUAA 1SU3A 3F15A 3SHIA 3WV2A 2TCLA 1IAEA 3N2VA 4FU4A 1GE7A 2V4BA 3K7LA 3HY7A 3I7IA 1PWQA 4H84A 2D1NA 4QKZA 1BKCI 5CZMA 1J7NA 2RJPA 1JKYA 1RM8A 2DW0A 3EDZA 5D2BA 1I76A 3G42A 1A86A 1OM6A 5I4OA 2W15A 2L0RA 4XM6A 1OM7A 3N2UA 3LIKA 4XM8A 2DDFA 1A85A 1KUHA 1R55A 4DPEA 1ATLA 1QIAA 5L7FA 1KUGA 1ZP5A 1S4BP 1QIBA 1SRPA 2X7MA 3DL1A 4IJOA 2YB9A 4FXYP 3TVCA 1UMSA 1K7GA 2OW1A 1JAPA 2SRTA 3F17A 1G4KA 3B92A 1GO8P 4H82A 1CQRA 2MLSA 1XFXA 4AXQA 4GR3A 3F19A 1AF0A 1KUFA 3HDAP 1SATA 3LMCA 2MLRA 1BZSA 4AIGA 1EB6A 1IACA 2JIHA 5LABA 1PWUA 1Y8JA 1HFCA 4IN9A 1I1IP 1JH1A 1USNA 1FM1A 1G12A 1G9KA 2OW2A 3EDIA 2X3AA 2OI0A 1ZXCA 4L6TA 1Y0VA 2K2GA 5D7WA 5I2ZA 3HBVP 4H49A 4ON1A 1UEAA 5BOYA 1YCMA 3CKIA 3DWBA 5CUHA 2J83A 3LIRA 1MMBA 1Q3AA 4PKQA 2PJTA 3F18A 2OY2A 1PWVA 1GE5A 4A3WA 4I03A 1HOVA 1CXVA 456CA 3Q2HA 1OM8A 1PWPA 1B3DA 2WO8A 2XS4A 2K9CA 4Q1LA 4ILWD 2XS3A 1FLSA 4WK7A 4H76A 2JNPA 2OY4A 1IAAA 2CKIA 3HB2P 2RJQA 1OS9A 4AUOA 1XURA 3LK8A 2X3BA 1D7XA 1ZVXA 1DTHA 2AYKA 3K7NA 1XFYA 4PKTA 2FV5A 2OW9A 3VTGA 2AIGP 2N8RA 4WKEA 1L6JA 4PKVA 4XBHA 1R1IA
chains in the Genus database with same CATH superfamily
2W13A 3O2XA 4XCTA 1C3IA 1OS2A 1WNIA 4FVLA 1BQOA 1GXDA 3EHYA 1FBLA 3F16A 3LJGA 1ZS0A 3LUNA 4R3VA 3HDBA 3KMEA 1XFZA 2E2DA 3KEJA 3Q2GA 1O0QA 5D1UA 3DSLA 4HMAA 4J4MA 4WZVA 4CTHA 1HFSA 3LE9A 5I43A 1QJJA 1ZXVA 1K7QA 1UTZA 4G0DA 2Z2DA 1KBCA 1UTTA 4GF1A 3E8RA 1UMTA 2OVXA 3DTIA 1BIWA 4DF9A 5D1TA 4GWMA 2OXUA 1B8YA 2EROA 3P24A 1KUKA 1OO9A 4JP4A 3RTSA 3LGPA 1BSWA 3KWVC 4IUWA 1O0TA 2USNA 4I35A 3ZVSA 1JIWP 3KECA 4ZR5A 3I7GA 5I3MA 4PKRA 1BKCA 3DNGA 3G5CA 1OMJA 3U1RA 2O36A 3NX7A 1PWWA 4WF6A 4DV8A 2DW1A 2I47A 3KHIA 1CK7A 2MZEA 3HY9A 3F1AA 1RMZA 2O3EA 4PKSA 5L79A 5BOTA 1R1JA 3UVCA 1D5JA 2E3XA 2JSDA 3ZUKA 2DW2A 2MZHA 1MMRA 1GKCA 4WKIA 1C7KA 1ROSA 1TVIA 1R54A 1H71P 1SMPA 3BA0A 4PKUA 2POJA 3KMCA 2JT6A 3TSKA 3P1VA 4JQGA 1G05A 3VI1A 2D1OA 4GR8A 2WOAA 3DPEA 1R1HA 1EUBA 2KRJA 1BUVM 4GR0A 1Y93A 3LUMA 4L19A 4GWNA 1GE6A 2WO9A 2W12A 4XM7A 1IADA 3HYGA 3LEAA 3USNA 1HV5A 4A7BA 1JANA 1XAXA 3EHXA 4H1QA 3KEKA 1HY7A 1BQQM 1YQYA 1ND1A 2W14A 5CXAA 1JAOA 3OHLA 3LQ0A 1GKDA 4GQLA 3WV3A 1KUIA 3OHOA 1JK3A 1XFUA 5JMYA 1ZTQA 1G49A 3TT4A 3EDGA 5I0LA 3DTKA 1XUCA 3LKAA 1JJ9A 3ZXHA 1C8TA 1MMQA 3EDHA 3V96B 3AIGA 1I73A 2OW0A 3LJZA 830CA 3HBUP 4G9LA 1AYKA 3O64A 4H30A 1SLMA 5I12A 3EWJA 2QPJA 1QJIA 2DDYA 4GUYA 2FV9A 1CGLA 1DMTA 1MNCA 1XFVA 1BKCE 1ASTA 2Y6CA 4H3XA 2HU6A 2OXZA 3B8ZA 4JPAA 2YIGA 966CA 2X3CA 1HTDA 2Y6DA 1BUDA 1YP1A 3B2ZA 3L0TA 3TS4A 2MZIA 4EFSA 3GBOA 1IAGA 3AYKA 5D1SA 1XUDA 2ERPA 1GO7P 2ERQA 3LILA 4L63A 3LQBA 1EAKA 1SLNA 1D8FA 4HX3A 5B5PA 1K7IA 1BM6A 2J0TA 4H2EA 4DD8A 4FXQA 2A8HA 1Z3JA 4PKWA 4JIJA 3L0VA 4JA1A 1CIZA 5BPAA 3WV1A 1MMPA 5D3CA 1CGEA 5B5OA 3MA2A 3ELMA 1XM5A 3RTTA 1JIZA 1KAPP 1D8MA 1XFWA 2OZRA 5H8XA 1IABA 1AKLA 1OZ9A 1QICA 2CLTA 2W0DA 3LJTA 1CGFA 1JAQA 2OVZA 3DPFA 3AYUA 2JT5A 2OXWA 3KRYA 1YOUA 4AYKA 1CAQA 1QUAA 1SU3A 3F15A 3SHIA 3WV2A 2TCLA 1IAEA 3N2VA 4FU4A 1GE7A 2V4BA 3K7LA 3HY7A 3I7IA 1PWQA 4H84A 2D1NA 4QKZA 1BKCI 5CZMA 1J7NA 2RJPA 1JKYA 1RM8A 2DW0A 3EDZA 5D2BA 1I76A 3G42A 1A86A 1OM6A 5I4OA 2W15A 2L0RA 4XM6A 1OM7A 3N2UA 3LIKA 4XM8A 2DDFA 1A85A 1KUHA 1R55A 4DPEA 1ATLA 1QIAA 5L7FA 3DTEA 1KUGA 1ZP5A 1S4BP 1QIBA 1SRPA 2X7MA 3DL1A 4IJOA 2YB9A 4FXYP 3TVCA 1UMSA 1K7GA 2OW1A 1JAPA 2SRTA 3F17A 1G4KA 3B92A 1GO8P 4H82A 1CQRA 2MLSA 4L7AA 1XFXA 4AXQA 4GR3A 3F19A 1AF0A 1KUFA 3HDAP 1SATA 3LMCA 2MLRA 1BZSA 4AIGA 1EB6A 1IACA 2JIHA 5LABA 1PWUA 1Y8JA 1HFCA 4IN9A 1I1IP 1JH1A 1USNA 1FM1A 1G12A 1G9KA 2OW2A 3EDIA 2X3AA 2YUFA 2OI0A 1ZXCA 4L6TA 1Y0VA 2K2GA 5D7WA 5I2ZA 3HBVP 4H49A 4ON1A 1UEAA 5BOYA 1YCMA 3CKIA 3DWBA 5CUHA 2J83A 3LIRA 1MMBA 1Q3AA 4PKQA 2PJTA 3F18A 2OY2A 1PWVA 1GE5A 4A3WA 4I03A 1HOVA 1CXVA 456CA 3Q2HA 1OM8A 1PWPA 1B3DA 2WO8A 2XS4A 2K9CA 4Q1LA 4ILWD 2XS3A 1FLSA 4WK7A 4H76A 2JNPA 2OY4A 1IAAA 2CKIA 3HB2P 2RJQA 1OS9A 4AUOA 1XURA 3LK8A 2X3BA 1D7XA 1ZVXA 1DTHA 2AYKA 3K7NA 1XFYA 4PKTA 2FV5A 2OW9A 3VTGA 2AIGP 2N8RA 4WKEA 1L6JA 4PKVA 4XBHA 1R1IA
chains in the Genus database with same CATH topology
2W13A 3O2XA 4XCTA 1C3IA 1OS2A 1WNIA 4FVLA 1BQOA 1GXDA 3EHYA 1FBLA 3F16A 3LJGA 1ZS0A 3LUNA 4R3VA 3HDBA 3KMEA 1XFZA 2E2DA 3KEJA 3Q2GA 1O0QA 5D1UA 3DSLA 4HMAA 4J4MA 4WZVA 4CTHA 1HFSA 3LE9A 5I43A 1QJJA 1ZXVA 1K7QA 1UTZA 4G0DA 2Z2DA 1KBCA 1UTTA 4GF1A 3E8RA 1UMTA 2OVXA 3DTIA 1BIWA 4DF9A 5D1TA 4GWMA 2OXUA 1B8YA 2EROA 3P24A 1KUKA 1OO9A 4JP4A 3RTSA 3LGPA 1BSWA 3KWVC 4IUWA 1O0TA 2USNA 4I35A 3ZVSA 1JIWP 3KECA 4ZR5A 3I7GA 5I3MA 4PKRA 1BKCA 3DNGA 3G5CA 1OMJA 3U1RA 2O36A 3NX7A 1PWWA 4WF6A 4DV8A 2DW1A 2I47A 3KHIA 1CK7A 2MZEA 3HY9A 3F1AA 1RMZA 2O3EA 4PKSA 5L79A 5BOTA 1R1JA 3UVCA 1D5JA 2E3XA 2JSDA 3ZUKA 2DW2A 2MZHA 1MMRA 1GKCA 4WKIA 1C7KA 1ROSA 1R54A 1H71P 1SMPA 3BA0A 4PKUA 2POJA 3KMCA 2JT6A 3TSKA 3P1VA 4JQGA 1G05A 3VI1A 2D1OA 4GR8A 2WOAA 3DPEA 1R1HA 1EUBA 2KRJA 1BUVM 4GR0A 1Y93A 3LUMA 4L19A 4GWNA 1GE6A 2WO9A 2W12A 4XM7A 1IADA 3HYGA 3LEAA 3USNA 1HV5A 4A7BA 1JANA 3EHXA 4H1QA 3KEKA 1HY7A 1BQQM 1YQYA 1ND1A 2W14A 5CXAA 1JAOA 3OHLA 3LQ0A 1GKDA 4GQLA 3WV3A 1KUIA 3OHOA 1JK3A 1XFUA 5JMYA 1ZTQA 1G49A 3TT4A 3EDGA 5I0LA 3DTKA 1XUCA 3LKAA 1JJ9A 3ZXHA 1C8TA 1MMQA 3EDHA 3V96B 3AIGA 1I73A 2OW0A 3LJZA 830CA 3HBUP 4G9LA 1AYKA 3O64A 4H30A 1SLMA 5I12A 3EWJA 2QPJA 1QJIA 2DDYA 4GUYA 2FV9A 1CGLA 1DMTA 1MNCA 1XFVA 1BKCE 1ASTA 2Y6CA 4H3XA 2HU6A 2OXZA 3B8ZA 4JPAA 2YIGA 966CA 2X3CA 1HTDA 2Y6DA 1BUDA 1YP1A 3B2ZA 3L0TA 3TS4A 2MZIA 4EFSA 3GBOA 1IAGA 3AYKA 5D1SA 1XUDA 2ERPA 1GO7P 2ERQA 3LILA 4L63A 3LQBA 1EAKA 1SLNA 1D8FA 4HX3A 5B5PA 1K7IA 1BM6A 2J0TA 4H2EA 4DD8A 4FXQA 2A8HA 1Z3JA 4PKWA 4JIJA 3L0VA 4JA1A 1CIZA 5BPAA 3WV1A 1MMPA 5D3CA 1CGEA 5B5OA 3MA2A 3ELMA 3RTTA 1JIZA 1KAPP 1D8MA 1XFWA 2OZRA 5H8XA 1IABA 1AKLA 1QICA 2CLTA 2W0DA 3LJTA 1CGFA 1JAQA 2OVZA 3DPFA 3AYUA 2JT5A 2OXWA 3KRYA 1YOUA 4AYKA 1CAQA 1QUAA 1SU3A 3F15A 3SHIA 3WV2A 2TCLA 1IAEA 3N2VA 4FU4A 1GE7A 2V4BA 3K7LA 3HY7A 3I7IA 1PWQA 4H84A 2D1NA 4QKZA 1BKCI 5CZMA 1J7NA 2RJPA 1JKYA 1RM8A 2DW0A 3EDZA 5D2BA 1I76A 3G42A 1A86A 1OM6A 5I4OA 2W15A 2L0RA 4XM6A 1OM7A 3N2UA 3LIKA 4XM8A 2DDFA 1A85A 1KUHA 1R55A 4DPEA 1ATLA 1QIAA 5L7FA 3DTEA 1KUGA 1ZP5A 1S4BP 1QIBA 1SRPA 2X7MA 3DL1A 4IJOA 2YB9A 4FXYP 3TVCA 1UMSA 1K7GA 2OW1A 1JAPA 2SRTA 3F17A 1G4KA 3B92A 1GO8P 4H82A 1CQRA 2MLSA 4L7AA 1XFXA 4AXQA 4GR3A 3F19A 1AF0A 1KUFA 3HDAP 1SATA 3LMCA 2MLRA 1BZSA 4AIGA 1EB6A 1IACA 2JIHA 5LABA 1PWUA 1Y8JA 1HFCA 4IN9A 1I1IP 1JH1A 1USNA 1FM1A 1G12A 1G9KA 2OW2A 3EDIA 2X3AA 2YUFA 2OI0A 1ZXCA 4L6TA 1Y0VA 2K2GA 5D7WA 5I2ZA 3HBVP 4H49A 4ON1A 1UEAA 5BOYA 1YCMA 3CKIA 3DWBA 5CUHA 2J83A 3LIRA 1MMBA 1Q3AA 4PKQA 2PJTA 3F18A 2OY2A 1PWVA 1GE5A 4A3WA 4I03A 1HOVA 1CXVA 456CA 3Q2HA 1OM8A 1PWPA 1B3DA 2WO8A 2XS4A 2K9CA 4Q1LA 4ILWD 2XS3A 1FLSA 4WK7A 4H76A 2JNPA 2OY4A 1IAAA 2CKIA 3HB2P 2RJQA 1OS9A 4AUOA 1XURA 3LK8A 2X3BA 1D7XA 1ZVXA 1DTHA 2AYKA 3K7NA 1XFYA 4PKTA 2FV5A 2OW9A 3VTGA 2AIGP 2N8RA 4WKEA 1L6JA 4PKVA 4XBHA 1R1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W13 A;  3O2X A;  4XCT A;  1C3I A;  1OS2 A;  1WNI A;  4FVL A;  1BQO A;  1GXD A;  3EHY A;  1FBL A;  3F16 A;  3LJG A;  1ZS0 A;  3LUN A;  4R3V A;  3HDB A;  3KME A;  1XFZ A;  2E2D A;  3KEJ A;  3Q2G A;  1O0Q A;  5D1U A;  3DSL A;  4HMA A;  4J4M A;  4WZV A;  4CTH A;  1HFS A;  3LE9 A;  5I43 A;  1QJJ A;  1ZXV A;  1K7Q A;  1UTZ A;  4G0D A;  2Z2D A;  1KBC A;  1UTT A;  4GF1 A;  3E8R A;  1UMT A;  2OVX A;  1BIW A;  4DF9 A;  5D1T A;  4GWM A;  2OXU A;  1B8Y A;  2ERO A;  3P24 A;  1KUK A;  1OO9 A;  4JP4 A;  3RTS A;  3LGP A;  1BSW A;  3KWV C;  4IUW A;  1O0T A;  2USN A;  4I35 A;  3ZVS A;  1JIW P;  3KEC A;  4ZR5 A;  3I7G A;  5I3M A;  4PKR A;  1BKC A;  3DNG A;  3G5C A;  1OMJ A;  3U1R A;  2O36 A;  3NX7 A;  1PWW A;  4WF6 A;  4DV8 A;  2DW1 A;  2I47 A;  3KHI A;  1CK7 A;  2MZE A;  3HY9 A;  3F1A A;  1RMZ A;  2O3E A;  4PKS A;  5L79 A;  5BOT A;  1R1J A;  3UVC A;  1D5J A;  2E3X A;  2JSD A;  3ZUK A;  2DW2 A;  2MZH A;  1MMR A;  1GKC A;  4WKI A;  1C7K A;  1ROS A;  1R54 A;  1H71 P;  1SMP A;  3BA0 A;  4PKU A;  2POJ A;  3KMC A;  2JT6 A;  3TSK A;  3P1V A;  4JQG A;  1G05 A;  3VI1 A;  2D1O A;  4GR8 A;  2WOA A;  3DPE A;  1R1H A;  1EUB A;  2KRJ A;  1BUV M;  4GR0 A;  1Y93 A;  3LUM A;  4L19 A;  4GWN A;  1GE6 A;  2WO9 A;  2W12 A;  4XM7 A;  1IAD A;  3HYG A;  3LEA A;  3USN A;  1HV5 A;  4A7B A;  1JAN A;  3EHX A;  4H1Q A;  3KEK A;  1HY7 A;  1BQQ M;  1YQY A;  1ND1 A;  2W14 A;  5CXA A;  1JAO A;  3OHL A;  3LQ0 A;  1GKD A;  4GQL A;  3WV3 A;  1KUI A;  3OHO A;  1JK3 A;  1XFU A;  5JMY A;  1ZTQ A;  1G49 A;  3TT4 A;  3EDG A;  5I0L A;  1XUC A;  3LKA A;  1JJ9 A;  3ZXH A;  1C8T A;  1MMQ A;  3EDH A;  3V96 B;  3AIG A;  1I73 A;  2OW0 A;  3LJZ A;  830C A;  3HBU P;  4G9L A;  1AYK A;  3O64 A;  4H30 A;  1SLM A;  5I12 A;  3EWJ A;  2QPJ A;  1QJI A;  2DDY A;  4GUY A;  2FV9 A;  1CGL A;  1DMT A;  1MNC A;  1XFV A;  1BKC E;  1AST A;  2Y6C A;  4H3X A;  2HU6 A;  2OXZ A;  3B8Z A;  4JPA A;  2YIG A;  966C A;  2X3C A;  1HTD A;  2Y6D A;  1BUD A;  1YP1 A;  3B2Z A;  3L0T A;  3TS4 A;  2MZI A;  4EFS A;  3GBO A;  1IAG A;  3AYK A;  5D1S A;  1XUD A;  2ERP A;  1GO7 P;  2ERQ A;  3LIL A;  4L63 A;  3LQB A;  1EAK A;  1SLN A;  1D8F A;  4HX3 A;  5B5P A;  1K7I A;  1BM6 A;  2J0T A;  4H2E A;  4DD8 A;  4FXQ A;  2A8H A;  1Z3J A;  4PKW A;  4JIJ A;  3L0V A;  4JA1 A;  1CIZ A;  5BPA A;  3WV1 A;  1MMP A;  5D3C A;  1CGE A;  5B5O A;  3MA2 A;  3ELM A;  3RTT A;  1JIZ A;  1KAP P;  1D8M A;  1XFW A;  2OZR A;  5H8X A;  1IAB A;  1AKL A;  1QIC A;  2CLT A;  2W0D A;  3LJT A;  1CGF A;  1JAQ A;  2OVZ A;  3DPF A;  3AYU A;  2JT5 A;  2OXW A;  3KRY A;  1YOU A;  4AYK A;  1CAQ A;  1QUA A;  1SU3 A;  3F15 A;  3SHI A;  3WV2 A;  2TCL A;  1IAE A;  3N2V A;  4FU4 A;  1GE7 A;  2V4B A;  3K7L A;  3HY7 A;  3I7I A;  1PWQ A;  4H84 A;  2D1N A;  4QKZ A;  1BKC I;  5CZM A;  1J7N A;  2RJP A;  1JKY A;  1RM8 A;  2DW0 A;  3EDZ A;  5D2B A;  1I76 A;  3G42 A;  1A86 A;  1OM6 A;  5I4O A;  2W15 A;  2L0R A;  4XM6 A;  1OM7 A;  3N2U A;  3LIK A;  4XM8 A;  2DDF A;  1A85 A;  1KUH A;  1R55 A;  4DPE A;  1ATL A;  1QIA A;  5L7F A;  1KUG A;  1ZP5 A;  1S4B P;  1QIB A;  1SRP A;  2X7M A;  3DL1 A;  4IJO A;  2YB9 A;  4FXY P;  3TVC A;  1UMS A;  1K7G A;  2OW1 A;  1JAP A;  2SRT A;  3F17 A;  1G4K A;  3B92 A;  1GO8 P;  4H82 A;  1CQR A;  2MLS A;  1XFX A;  4AXQ A;  4GR3 A;  3F19 A;  1AF0 A;  1KUF A;  3HDA P;  1SAT A;  3LMC A;  2MLR A;  1BZS A;  4AIG A;  1EB6 A;  1IAC A;  2JIH A;  5LAB A;  1PWU A;  1Y8J A;  1HFC A;  4IN9 A;  1I1I P;  1JH1 A;  1USN A;  1FM1 A;  1G12 A;  1G9K A;  2OW2 A;  3EDI A;  2X3A A;  2OI0 A;  1ZXC A;  4L6T A;  1Y0V A;  2K2G A;  5D7W A;  5I2Z A;  3HBV P;  4H49 A;  4ON1 A;  1UEA A;  5BOY A;  1YCM A;  3CKI A;  3DWB A;  5CUH A;  2J83 A;  3LIR A;  1MMB A;  1Q3A A;  4PKQ A;  2PJT A;  3F18 A;  2OY2 A;  1PWV A;  1GE5 A;  4A3W A;  4I03 A;  1HOV A;  1CXV A;  456C A;  3Q2H A;  1OM8 A;  1PWP A;  1B3D A;  2WO8 A;  2XS4 A;  2K9C A;  4Q1L A;  4ILW D;  2XS3 A;  1FLS A;  4WK7 A;  4H76 A;  2JNP A;  2OY4 A;  1IAA A;  2CKI A;  3HB2 P;  2RJQ A;  1OS9 A;  4AUO A;  1XUR A;  3LK8 A;  2X3B A;  1D7X A;  1ZVX A;  1DTH A;  2AYK A;  3K7N A;  1XFY A;  4PKT A;  2FV5 A;  2OW9 A;  3VTG A;  2AIG P;  2N8R A;  4WKE A;  1L6J A;  4PKV A;  4XBH A;  1R1I A; 
#chains in the Genus database with same CATH topology
 2W13 A;  3O2X A;  4XCT A;  1C3I A;  1OS2 A;  1WNI A;  4FVL A;  1BQO A;  1GXD A;  3EHY A;  1FBL A;  3F16 A;  3LJG A;  1ZS0 A;  3LUN A;  4R3V A;  3HDB A;  3KME A;  1XFZ A;  2E2D A;  3KEJ A;  3Q2G A;  1O0Q A;  5D1U A;  3DSL A;  4HMA A;  4J4M A;  4WZV A;  4CTH A;  1HFS A;  3LE9 A;  5I43 A;  1QJJ A;  1ZXV A;  1K7Q A;  1UTZ A;  4G0D A;  2Z2D A;  1KBC A;  1UTT A;  4GF1 A;  3E8R A;  1UMT A;  2OVX A;  3DTI A;  1BIW A;  4DF9 A;  5D1T A;  4GWM A;  2OXU A;  1B8Y A;  2ERO A;  3P24 A;  1KUK A;  1OO9 A;  4JP4 A;  3RTS A;  3LGP A;  1BSW A;  3KWV C;  4IUW A;  1O0T A;  2USN A;  4I35 A;  3ZVS A;  1JIW P;  3KEC A;  4ZR5 A;  3I7G A;  5I3M A;  4PKR A;  1BKC A;  3DNG A;  3G5C A;  1OMJ A;  3U1R A;  2O36 A;  3NX7 A;  1PWW A;  4WF6 A;  4DV8 A;  2DW1 A;  2I47 A;  3KHI A;  1CK7 A;  2MZE A;  3HY9 A;  3F1A A;  1RMZ A;  2O3E A;  4PKS A;  5L79 A;  5BOT A;  1R1J A;  3UVC A;  1D5J A;  2E3X A;  2JSD A;  3ZUK A;  2DW2 A;  2MZH A;  1MMR A;  1GKC A;  4WKI A;  1C7K A;  1ROS A;  1TVI A;  1R54 A;  1H71 P;  1SMP A;  3BA0 A;  4PKU A;  2POJ A;  3KMC A;  2JT6 A;  3TSK A;  3P1V A;  4JQG A;  1G05 A;  3VI1 A;  2D1O A;  4GR8 A;  2WOA A;  3DPE A;  1R1H A;  1EUB A;  2KRJ A;  1BUV M;  4GR0 A;  1Y93 A;  3LUM A;  4L19 A;  4GWN A;  1GE6 A;  2WO9 A;  2W12 A;  4XM7 A;  1IAD A;  3HYG A;  3LEA A;  3USN A;  1HV5 A;  4A7B A;  1JAN A;  1XAX A;  3EHX A;  4H1Q A;  3KEK A;  1HY7 A;  1BQQ M;  1YQY A;  1ND1 A;  2W14 A;  5CXA A;  1JAO A;  3OHL A;  3LQ0 A;  1GKD A;  4GQL A;  3WV3 A;  1KUI A;  3OHO A;  1JK3 A;  1XFU A;  5JMY A;  1ZTQ A;  1G49 A;  3TT4 A;  3EDG A;  5I0L A;  3DTK A;  1XUC A;  3LKA A;  1JJ9 A;  3ZXH A;  1C8T A;  1MMQ A;  3EDH A;  3V96 B;  3AIG A;  1I73 A;  2OW0 A;  3LJZ A;  830C A;  3HBU P;  4G9L A;  1AYK A;  3O64 A;  4H30 A;  1SLM A;  5I12 A;  3EWJ A;  2QPJ A;  1QJI A;  2DDY A;  4GUY A;  2FV9 A;  1CGL A;  1DMT A;  1MNC A;  1XFV A;  1BKC E;  1AST A;  2Y6C A;  4H3X A;  2HU6 A;  2OXZ A;  3B8Z A;  4JPA A;  2YIG A;  966C A;  2X3C A;  1HTD A;  2Y6D A;  1BUD A;  1YP1 A;  3B2Z A;  3L0T A;  3TS4 A;  2MZI A;  4EFS A;  3GBO A;  1IAG A;  3AYK A;  5D1S A;  1XUD A;  2ERP A;  1GO7 P;  2ERQ A;  3LIL A;  4L63 A;  3LQB A;  1EAK A;  1SLN A;  1D8F A;  4HX3 A;  5B5P A;  1K7I A;  1BM6 A;  2J0T A;  4H2E A;  4DD8 A;  4FXQ A;  2A8H A;  1Z3J A;  4PKW A;  4JIJ A;  3L0V A;  4JA1 A;  1CIZ A;  5BPA A;  3WV1 A;  1MMP A;  5D3C A;  1CGE A;  5B5O A;  3MA2 A;  3ELM A;  1XM5 A;  3RTT A;  1JIZ A;  1KAP P;  1D8M A;  1XFW A;  2OZR A;  5H8X A;  1IAB A;  1AKL A;  1OZ9 A;  1QIC A;  2CLT A;  2W0D A;  3LJT A;  1CGF A;  1JAQ A;  2OVZ A;  3DPF A;  3AYU A;  2JT5 A;  2OXW A;  3KRY A;  1YOU A;  4AYK A;  1CAQ A;  1QUA A;  1SU3 A;  3F15 A;  3SHI A;  3WV2 A;  2TCL A;  1IAE A;  3N2V A;  4FU4 A;  1GE7 A;  2V4B A;  3K7L A;  3HY7 A;  3I7I A;  1PWQ A;  4H84 A;  2D1N A;  4QKZ A;  1BKC I;  5CZM A;  1J7N A;  2RJP A;  1JKY A;  1RM8 A;  2DW0 A;  3EDZ A;  5D2B A;  1I76 A;  3G42 A;  1A86 A;  1OM6 A;  5I4O A;  2W15 A;  2L0R A;  4XM6 A;  1OM7 A;  3N2U A;  3LIK A;  4XM8 A;  2DDF A;  1A85 A;  1KUH A;  1R55 A;  4DPE A;  1ATL A;  1QIA A;  5L7F A;  3DTE A;  1KUG A;  1ZP5 A;  1S4B P;  1QIB A;  1SRP A;  2X7M A;  3DL1 A;  4IJO A;  2YB9 A;  4FXY P;  3TVC A;  1UMS A;  1K7G A;  2OW1 A;  1JAP A;  2SRT A;  3F17 A;  1G4K A;  3B92 A;  1GO8 P;  4H82 A;  1CQR A;  2MLS A;  4L7A A;  1XFX A;  4AXQ A;  4GR3 A;  3F19 A;  1AF0 A;  1KUF A;  3HDA P;  1SAT A;  3LMC A;  2MLR A;  1BZS A;  4AIG A;  1EB6 A;  1IAC A;  2JIH A;  5LAB A;  1PWU A;  1Y8J A;  1HFC A;  4IN9 A;  1I1I P;  1JH1 A;  1USN A;  1FM1 A;  1G12 A;  1G9K A;  2OW2 A;  3EDI A;  2X3A A;  2YUF A;  2OI0 A;  1ZXC A;  4L6T A;  1Y0V A;  2K2G A;  5D7W A;  5I2Z A;  3HBV P;  4H49 A;  4ON1 A;  1UEA A;  5BOY A;  1YCM A;  3CKI A;  3DWB A;  5CUH A;  2J83 A;  3LIR A;  1MMB A;  1Q3A A;  4PKQ A;  2PJT A;  3F18 A;  2OY2 A;  1PWV A;  1GE5 A;  4A3W A;  4I03 A;  1HOV A;  1CXV A;  456C A;  3Q2H A;  1OM8 A;  1PWP A;  1B3D A;  2WO8 A;  2XS4 A;  2K9C A;  4Q1L A;  4ILW D;  2XS3 A;  1FLS A;  4WK7 A;  4H76 A;  2JNP A;  2OY4 A;  1IAA A;  2CKI A;  3HB2 P;  2RJQ A;  1OS9 A;  4AUO A;  1XUR A;  3LK8 A;  2X3B A;  1D7X A;  1ZVX A;  1DTH A;  2AYK A;  3K7N A;  1XFY A;  4PKT A;  2FV5 A;  2OW9 A;  3VTG A;  2AIG P;  2N8R A;  4WKE A;  1L6J A;  4PKV A;  4XBH A;  1R1I A; 
#chains in the Genus database with same CATH homology
 2W13 A;  3O2X A;  4XCT A;  1C3I A;  1OS2 A;  1WNI A;  4FVL A;  1BQO A;  1GXD A;  3EHY A;  1FBL A;  3F16 A;  3LJG A;  1ZS0 A;  3LUN A;  4R3V A;  3HDB A;  3KME A;  1XFZ A;  2E2D A;  3KEJ A;  3Q2G A;  1O0Q A;  5D1U A;  3DSL A;  4HMA A;  4J4M A;  4WZV A;  4CTH A;  1HFS A;  3LE9 A;  5I43 A;  1QJJ A;  1ZXV A;  1K7Q A;  1UTZ A;  4G0D A;  2Z2D A;  1KBC A;  1UTT A;  4GF1 A;  3E8R A;  1UMT A;  2OVX A;  3DTI A;  1BIW A;  4DF9 A;  5D1T A;  4GWM A;  2OXU A;  1B8Y A;  2ERO A;  3P24 A;  1KUK A;  1OO9 A;  4JP4 A;  3RTS A;  3LGP A;  1BSW A;  3KWV C;  4IUW A;  1O0T A;  2USN A;  4I35 A;  3ZVS A;  1JIW P;  3KEC A;  4ZR5 A;  3I7G A;  5I3M A;  4PKR A;  1BKC A;  3DNG A;  3G5C A;  1OMJ A;  3U1R A;  2O36 A;  3NX7 A;  1PWW A;  4WF6 A;  4DV8 A;  2DW1 A;  2I47 A;  3KHI A;  1CK7 A;  2MZE A;  3HY9 A;  3F1A A;  1RMZ A;  2O3E A;  4PKS A;  5L79 A;  5BOT A;  1R1J A;  3UVC A;  1D5J A;  2E3X A;  2JSD A;  3ZUK A;  2DW2 A;  2MZH A;  1MMR A;  1GKC A;  4WKI A;  1C7K A;  1ROS A;  1R54 A;  1H71 P;  1SMP A;  3BA0 A;  4PKU A;  2POJ A;  3KMC A;  2JT6 A;  3TSK A;  3P1V A;  4JQG A;  1G05 A;  3VI1 A;  2D1O A;  4GR8 A;  2WOA A;  3DPE A;  1R1H A;  1EUB A;  2KRJ A;  1BUV M;  4GR0 A;  1Y93 A;  3LUM A;  4L19 A;  4GWN A;  1GE6 A;  2WO9 A;  2W12 A;  4XM7 A;  1IAD A;  3HYG A;  3LEA A;  3USN A;  1HV5 A;  4A7B A;  1JAN A;  3EHX A;  4H1Q A;  3KEK A;  1HY7 A;  1BQQ M;  1YQY A;  1ND1 A;  2W14 A;  5CXA A;  1JAO A;  3OHL A;  3LQ0 A;  1GKD A;  4GQL A;  3WV3 A;  1KUI A;  3OHO A;  1JK3 A;  1XFU A;  5JMY A;  1ZTQ A;  1G49 A;  3TT4 A;  3EDG A;  5I0L A;  3DTK A;  1XUC A;  3LKA A;  1JJ9 A;  3ZXH A;  1C8T A;  1MMQ A;  3EDH A;  3V96 B;  3AIG A;  1I73 A;  2OW0 A;  3LJZ A;  830C A;  3HBU P;  4G9L A;  1AYK A;  3O64 A;  4H30 A;  1SLM A;  5I12 A;  3EWJ A;  2QPJ A;  1QJI A;  2DDY A;  4GUY A;  2FV9 A;  1CGL A;  1DMT A;  1MNC A;  1XFV A;  1BKC E;  1AST A;  2Y6C A;  4H3X A;  2HU6 A;  2OXZ A;  3B8Z A;  4JPA A;  2YIG A;  966C A;  2X3C A;  1HTD A;  2Y6D A;  1BUD A;  1YP1 A;  3B2Z A;  3L0T A;  3TS4 A;  2MZI A;  4EFS A;  3GBO A;  1IAG A;  3AYK A;  5D1S A;  1XUD A;  2ERP A;  1GO7 P;  2ERQ A;  3LIL A;  4L63 A;  3LQB A;  1EAK A;  1SLN A;  1D8F A;  4HX3 A;  5B5P A;  1K7I A;  1BM6 A;  2J0T A;  4H2E A;  4DD8 A;  4FXQ A;  2A8H A;  1Z3J A;  4PKW A;  4JIJ A;  3L0V A;  4JA1 A;  1CIZ A;  5BPA A;  3WV1 A;  1MMP A;  5D3C A;  1CGE A;  5B5O A;  3MA2 A;  3ELM A;  3RTT A;  1JIZ A;  1KAP P;  1D8M A;  1XFW A;  2OZR A;  5H8X A;  1IAB A;  1AKL A;  1QIC A;  2CLT A;  2W0D A;  3LJT A;  1CGF A;  1JAQ A;  2OVZ A;  3DPF A;  3AYU A;  2JT5 A;  2OXW A;  3KRY A;  1YOU A;  4AYK A;  1CAQ A;  1QUA A;  1SU3 A;  3F15 A;  3SHI A;  3WV2 A;  2TCL A;  1IAE A;  3N2V A;  4FU4 A;  1GE7 A;  2V4B A;  3K7L A;  3HY7 A;  3I7I A;  1PWQ A;  4H84 A;  2D1N A;  4QKZ A;  1BKC I;  5CZM A;  1J7N A;  2RJP A;  1JKY A;  1RM8 A;  2DW0 A;  3EDZ A;  5D2B A;  1I76 A;  3G42 A;  1A86 A;  1OM6 A;  5I4O A;  2W15 A;  2L0R A;  4XM6 A;  1OM7 A;  3N2U A;  3LIK A;  4XM8 A;  2DDF A;  1A85 A;  1KUH A;  1R55 A;  4DPE A;  1ATL A;  1QIA A;  5L7F A;  3DTE A;  1KUG A;  1ZP5 A;  1S4B P;  1QIB A;  1SRP A;  2X7M A;  3DL1 A;  4IJO A;  2YB9 A;  4FXY P;  3TVC A;  1UMS A;  1K7G A;  2OW1 A;  1JAP A;  2SRT A;  3F17 A;  1G4K A;  3B92 A;  1GO8 P;  4H82 A;  1CQR A;  2MLS A;  4L7A A;  1XFX A;  4AXQ A;  4GR3 A;  3F19 A;  1AF0 A;  1KUF A;  3HDA P;  1SAT A;  3LMC A;  2MLR A;  1BZS A;  4AIG A;  1EB6 A;  1IAC A;  2JIH A;  5LAB A;  1PWU A;  1Y8J A;  1HFC A;  4IN9 A;  1I1I P;  1JH1 A;  1USN A;  1FM1 A;  1G12 A;  1G9K A;  2OW2 A;  3EDI A;  2X3A A;  2YUF A;  2OI0 A;  1ZXC A;  4L6T A;  1Y0V A;  2K2G A;  5D7W A;  5I2Z A;  3HBV P;  4H49 A;  4ON1 A;  1UEA A;  5BOY A;  1YCM A;  3CKI A;  3DWB A;  5CUH A;  2J83 A;  3LIR A;  1MMB A;  1Q3A A;  4PKQ A;  2PJT A;  3F18 A;  2OY2 A;  1PWV A;  1GE5 A;  4A3W A;  4I03 A;  1HOV A;  1CXV A;  456C A;  3Q2H A;  1OM8 A;  1PWP A;  1B3D A;  2WO8 A;  2XS4 A;  2K9C A;  4Q1L A;  4ILW D;  2XS3 A;  1FLS A;  4WK7 A;  4H76 A;  2JNP A;  2OY4 A;  1IAA A;  2CKI A;  3HB2 P;  2RJQ A;  1OS9 A;  4AUO A;  1XUR A;  3LK8 A;  2X3B A;  1D7X A;  1ZVX A;  1DTH A;  2AYK A;  3K7N A;  1XFY A;  4PKT A;  2FV5 A;  2OW9 A;  3VTG A;  2AIG P;  2N8R A;  4WKE A;  1L6J A;  4PKV A;  4XBH A;  1R1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...