5D2BA

Crystal structure of a mutated catalytic domain of human mmp12 in complex with an hydroxamate analogue of rxp470
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Zinc-Metalloproteinase Inhibitors: Evaluation of the Complex Role Played by the Zinc-Binding Group on Potency and Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5d2bA00
1XURA 2Y6DA 4QKZA 5I12A 3USNA 3LQ0A 5BPAA 1O0QA 2WO9A 4JIJA 2OW2A 5D1TA 4XM7A 2K2GA 3L0VA 1R55A 4H3XA 1I76A 1Z3JA 1GKCA 5BOYA 3AYKA 1QJIA 1GE5A 1C8TA 3LIKA 2Y6CA 4AIGA 5I43A 2OW1A 1SLMA 1YP1A 2O3EA 1K7IA 5L7FA 4G0DA 1G4KA 4WKIA 2V4BA 1CAQA 4DD8A 4GR8A 4L63A 1HFSA 5I3MA 3CKIA 3G5CA 1G9KA 3DNGA 2DW2A 2ERPA 1QICA 3VI1A 1HV5A 3NX7A 1ZTQA 1USNA 3P24A 1S4BP 3HBUP 1XFWA 4A3WA 3LQBA 5B5OA 3O2XA 1O0TA 2DW0A 2DW1A 5CUHA 2E3XA 1ATLA 1BUVM 1H71P 1EUBA 3LK8A 2AIGP 3KEJA 1CXVA 1ZS0A 1BUDA 3F19A 2OW9A 2KRJA 1OM6A 1BKCE 4Q1LA 2DDYA 1KUFA 2MZHA 1L6JA 1PWVA 4WF6A 1ZXVA 3ZXHA 3LMCA 4FU4A 5D7WA 1Y8JA 4WKEA 1FLSA 2X3CA 1CIZA 5B5PA 1JIWP 1YQYA 3V96B 1SATA 3SHIA 5LABA 830CA 1EB6A 4XCTA 1BM6A 1R1HA 4H49A 3E8RA 3ZUKA 2D1NA 4HX3A 1R1JA 4PKQA 3Q2HA 2OXUA 2X3AA 4A7BA 1HTDA 1OS9A 3GBOA 4PKSA 3EDZA 1CGFA 1PWQA 4JA1A 3VTGA 1OM7A 2MZEA 3BA0A 5BOTA 1JANA 1QIBA 4R3VA 3TVCA 1GO7P 1GKDA 1AYKA 1JIZA 2TCLA 3WV2A 2OVXA 3B2ZA 1KUKA 3I7GA 1UTZA 3LILA 5D1SA 1MMQA 2K9CA 1B8YA 3P1VA 1XFUA 1BKCI 5I2ZA 5L79A 4I35A 2D1OA 2JT5A 1QJJA 1IACA 1JH1A 4L6TA 3Q2GA 4XM8A 2SRTA 3EWJA 4FVLA 2J0TA 2W0DA 3F15A 4PKVA 1UTTA 3LKAA 2W13A 4H76A 1IABA 4FXQA 3WV3A 1K7GA 4HMAA 1G49A 1D7XA 2JT6A 2WOAA 4L19A 1EAKA 4CTHA 1XFVA 2CKIA 4ZR5A 3K7LA 2OI0A 3KMEA 4H84A 1Y93A 2XS3A 2JSDA 1AF0A 3OHOA 1C3IA 1UMSA 3G42A 4DPEA 1HOVA 3EDGA 1C7KA 3HDBA 1PWPA 3HYGA 3F1AA 1JAOA 5I0LA 1B3DA 1I73A 1JKYA 2A8HA 5JMYA 2X3BA 4JP4A 3K7NA 1BIWA 3N2VA 1BQOA 1JAPA 1MNCA 4GUYA 1I1IP 2EROA 2PJTA 3I7IA 2ERQA 1SMPA 1D8MA 1ZVXA 1UMTA 1ZXCA 5I4OA 4GWMA 2X7MA 5CXAA 2FV5A 4GR0A 1J7NA 5H8XA 4AXQA 1PWUA 3EDHA 1OMJA 4GQLA 3LJTA 1IAGA 1IAEA 2OZRA 2OY4A 1MMBA 2E2DA 1YOUA 3F18A 1DMTA 1HY7A 1IADA 4WK7A 1G12A 1ASTA 1ND1A 1XFYA 1KUGA 3KWVC 1JAQA 2XS4A 2MLSA 1CQRA 3DWBA 2O36A 2OW0A 2YB9A 4XM6A 1JK3A 3HDAP 3LJGA 4GWNA 3KHIA 3MA2A 2W12A 2OXZA 2OY2A 4AUOA 1QUAA 1CGEA 3LIRA 2RJQA 3TSKA 1YCMA 3HB2P 4IUWA 4AYKA 1SRPA 4PKTA 5CZMA 3LGPA 4H2EA 456CA 4DF9A 1FBLA 4XBHA 3RTSA 3U1RA 3ZVSA 2FV9A 1A85A 3WV1A 2W15A 4ON1A 1OO9A 3DPFA 2W14A 3DSLA 4PKWA 3F17A 4G9LA 4H1QA 2JNPA 1DTHA 4GR3A 1R1IA 3DPEA 1ZP5A 1KUIA 3LJZA 1XFXA 1FM1A 3EHXA 2CLTA 1KUHA 1CK7A 1G05A 2YIGA 2RJPA 2USNA 3HBVP 1WNIA 1ROSA 1GXDA 1PWWA 1IAAA 3TT4A 3KMCA 1GE7A 1JJ9A 1XUCA 2POJA 1KAPP 1QIAA 3LUNA 2MZIA 1D8FA 4J4MA 1MMRA 2N8RA 1Y0VA 3DL1A 4H30A 4EFSA 3F16A 5D3CA 966CA 3OHLA 2AYKA 1CGLA 3O64A 2Z2DA 1OM8A 2QPJA 2WO8A 3KECA 5D2BA 2MLRA 2OXWA 4IJOA 1Q3AA 1R54A 3KEKA 2JIHA 3UVCA 4H82A 1K7QA 1BSWA 1GO8P 3N2UA 3LEAA 3LUMA 1RM8A 3KRYA 4GF1A 1BZSA 2L0RA 3L0TA 1GE6A 4JPAA 3EDIA 4ILWD 4PKRA 3RTTA 3AIGA 3AYUA 1RMZA 1MMPA 1XUDA 3HY9A 4FXYP 1KBCA 3LE9A 1UEAA 1SU3A 1HFCA 3B8ZA 2HU6A 3EHYA 3HY7A 1SLNA 1BQQM 4IN9A 2DDFA 4WZVA 2J83A 4JQGA 4DV8A 1XFZA 1BKCA 2I47A 1AKLA 3TS4A 1OS2A 5D1UA 1D5JA 4PKUA 3ELMA 1A86A 3B92A 2OVZA 4I03A
chains in the Genus database with same CATH superfamily
1XURA 2Y6DA 4QKZA 5I12A 3USNA 3LQ0A 5BPAA 1O0QA 2WO9A 4JIJA 2OW2A 5D1TA 4XM7A 2K2GA 3L0VA 1R55A 4H3XA 1I76A 1Z3JA 1GKCA 5BOYA 3AYKA 1QJIA 1GE5A 1C8TA 3LIKA 2Y6CA 4AIGA 5I43A 2OW1A 1SLMA 1YP1A 2O3EA 1K7IA 5L7FA 4G0DA 1G4KA 4WKIA 2V4BA 1CAQA 4DD8A 4GR8A 4L63A 1HFSA 5I3MA 3CKIA 3G5CA 1G9KA 3DNGA 2DW2A 2ERPA 1QICA 3VI1A 1HV5A 3NX7A 1TVIA 1ZTQA 1USNA 3P24A 1S4BP 3HBUP 1XFWA 4A3WA 3LQBA 1XM5A 3O2XA 1O0TA 5B5OA 2DW0A 2DW1A 5CUHA 2E3XA 1ATLA 1BUVM 1H71P 1EUBA 3LK8A 2AIGP 3KEJA 1CXVA 1ZS0A 1BUDA 3F19A 2OW9A 2KRJA 1OM6A 1BKCE 4Q1LA 2DDYA 1KUFA 2MZHA 1L6JA 1PWVA 4WF6A 1ZXVA 3ZXHA 3LMCA 4FU4A 5D7WA 1Y8JA 4WKEA 1FLSA 2X3CA 1CIZA 5B5PA 1JIWP 1YQYA 3V96B 1SATA 3SHIA 5LABA 830CA 1EB6A 4XCTA 1BM6A 1R1HA 4H49A 3E8RA 3ZUKA 2D1NA 4HX3A 1R1JA 4PKQA 3Q2HA 2OXUA 4L7AA 2X3AA 4A7BA 1HTDA 1OS9A 3GBOA 4PKSA 3EDZA 1CGFA 1PWQA 4JA1A 3VTGA 1OM7A 2MZEA 3BA0A 5BOTA 1JANA 1QIBA 4R3VA 3TVCA 1GO7P 1GKDA 1AYKA 1JIZA 2TCLA 3WV2A 2OVXA 3B2ZA 1KUKA 3I7GA 1UTZA 3LILA 5D1SA 1MMQA 2K9CA 1B8YA 3P1VA 1XFUA 1BKCI 5I2ZA 5L79A 4I35A 2D1OA 2JT5A 1QJJA 1IACA 1JH1A 4L6TA 3Q2GA 4XM8A 2SRTA 3EWJA 4FVLA 2J0TA 2W0DA 3F15A 4PKVA 1UTTA 3LKAA 2W13A 4H76A 1IABA 4FXQA 3WV3A 1K7GA 4HMAA 1G49A 1D7XA 2JT6A 2WOAA 4L19A 1EAKA 4CTHA 1XFVA 2CKIA 4ZR5A 3K7LA 2OI0A 3KMEA 4H84A 1Y93A 2XS3A 2JSDA 1AF0A 3OHOA 1C3IA 1UMSA 3G42A 4DPEA 1HOVA 3EDGA 1C7KA 3HDBA 1PWPA 3HYGA 3F1AA 1JAOA 5I0LA 1B3DA 1I73A 1JKYA 2A8HA 3DTKA 2X3BA 4JP4A 3K7NA 5JMYA 1BIWA 3DTIA 3N2VA 1BQOA 1JAPA 1MNCA 4GUYA 1I1IP 2EROA 2PJTA 3I7IA 2ERQA 1SMPA 1D8MA 1ZVXA 1UMTA 1ZXCA 5I4OA 4GWMA 2X7MA 5CXAA 2FV5A 4GR0A 1J7NA 5H8XA 4AXQA 1PWUA 3EDHA 1OMJA 4GQLA 3LJTA 1IAGA 1IAEA 2OZRA 2OY4A 1MMBA 2E2DA 1YOUA 3F18A 1DMTA 1HY7A 1IADA 4WK7A 1G12A 1ASTA 1ND1A 1XFYA 1KUGA 3KWVC 1JAQA 2XS4A 2MLSA 1CQRA 3DWBA 2O36A 2OW0A 2YB9A 4XM6A 1JK3A 3HDAP 3LJGA 4GWNA 3KHIA 3MA2A 2W12A 2OXZA 2OY2A 4AUOA 1QUAA 1CGEA 3LIRA 2RJQA 3TSKA 1YCMA 3HB2P 4IUWA 4AYKA 1SRPA 4PKTA 5CZMA 3LGPA 4H2EA 456CA 4DF9A 1FBLA 4XBHA 3RTSA 1OZ9A 3U1RA 2FV9A 3ZVSA 1A85A 3WV1A 2W15A 4ON1A 1OO9A 3DPFA 2W14A 3DSLA 4PKWA 3F17A 4G9LA 4H1QA 2JNPA 1DTHA 4GR3A 1R1IA 3DPEA 1ZP5A 1KUIA 3LJZA 1XFXA 1FM1A 3EHXA 2CLTA 1KUHA 1CK7A 1G05A 2YIGA 2RJPA 2USNA 3HBVP 1WNIA 1ROSA 1GXDA 1PWWA 1IAAA 3TT4A 3KMCA 1GE7A 1JJ9A 1XUCA 2POJA 1KAPP 1QIAA 3LUNA 2MZIA 1D8FA 4J4MA 1MMRA 2N8RA 1XAXA 1Y0VA 3DL1A 4H30A 4EFSA 3F16A 5D3CA 966CA 3OHLA 2AYKA 1CGLA 3O64A 2Z2DA 1OM8A 2QPJA 2WO8A 3KECA 5D2BA 2MLRA 2OXWA 4IJOA 1Q3AA 1R54A 3KEKA 2JIHA 3UVCA 4H82A 1K7QA 1BSWA 1GO8P 3N2UA 3LEAA 3LUMA 1RM8A 3KRYA 4GF1A 1BZSA 2L0RA 3L0TA 1GE6A 4JPAA 3EDIA 4ILWD 3DTEA 4PKRA 3RTTA 3AIGA 3AYUA 1RMZA 1MMPA 1XUDA 3HY9A 4FXYP 1KBCA 3LE9A 1UEAA 1SU3A 1HFCA 3B8ZA 2HU6A 3EHYA 3HY7A 1SLNA 1BQQM 4IN9A 2DDFA 4WZVA 2J83A 4JQGA 4DV8A 1XFZA 1BKCA 2I47A 1AKLA 3TS4A 1OS2A 5D1UA 1D5JA 4PKUA 2YUFA 3ELMA 1A86A 3B92A 2OVZA 4I03A
chains in the Genus database with same CATH topology
1XURA 2Y6DA 4QKZA 5I12A 3USNA 3LQ0A 5BPAA 1O0QA 2WO9A 4JIJA 2OW2A 5D1TA 4XM7A 2K2GA 3L0VA 1R55A 4H3XA 1I76A 1Z3JA 1GKCA 5BOYA 3AYKA 1QJIA 1GE5A 1C8TA 3LIKA 2Y6CA 4AIGA 5I43A 2OW1A 1SLMA 1YP1A 2O3EA 1K7IA 5L7FA 4G0DA 1G4KA 4WKIA 2V4BA 1CAQA 4DD8A 4GR8A 4L63A 1HFSA 5I3MA 3CKIA 3G5CA 1G9KA 3DNGA 2DW2A 2ERPA 1QICA 3VI1A 1HV5A 3NX7A 1ZTQA 1USNA 3P24A 1S4BP 3HBUP 1XFWA 4A3WA 3LQBA 5B5OA 3O2XA 1O0TA 2DW0A 2DW1A 5CUHA 2E3XA 1ATLA 1BUVM 1H71P 1EUBA 3LK8A 2AIGP 3KEJA 1CXVA 1ZS0A 1BUDA 3F19A 2OW9A 2KRJA 1OM6A 1BKCE 4Q1LA 2DDYA 1KUFA 2MZHA 1L6JA 1PWVA 4WF6A 1ZXVA 3ZXHA 3LMCA 4FU4A 5D7WA 1Y8JA 4WKEA 1FLSA 2X3CA 1CIZA 5B5PA 1JIWP 1YQYA 3V96B 1SATA 3SHIA 5LABA 830CA 1EB6A 4XCTA 1BM6A 1R1HA 4H49A 3E8RA 3ZUKA 2D1NA 4HX3A 1R1JA 4PKQA 3Q2HA 2OXUA 4L7AA 2X3AA 4A7BA 1HTDA 1OS9A 3GBOA 4PKSA 3EDZA 1CGFA 1PWQA 4JA1A 3VTGA 1OM7A 2MZEA 3BA0A 5BOTA 1JANA 1QIBA 4R3VA 3TVCA 1GO7P 1GKDA 1AYKA 1JIZA 2TCLA 3WV2A 2OVXA 3B2ZA 1KUKA 3I7GA 1UTZA 3LILA 5D1SA 1MMQA 2K9CA 1B8YA 3P1VA 1XFUA 1BKCI 5I2ZA 5L79A 4I35A 2D1OA 2JT5A 1QJJA 1IACA 1JH1A 4L6TA 3Q2GA 4XM8A 2SRTA 3EWJA 4FVLA 2J0TA 2W0DA 3F15A 4PKVA 1UTTA 3LKAA 2W13A 4H76A 1IABA 4FXQA 3WV3A 1K7GA 4HMAA 1G49A 1D7XA 2JT6A 2WOAA 4L19A 1EAKA 4CTHA 1XFVA 2CKIA 4ZR5A 3K7LA 2OI0A 3KMEA 4H84A 1Y93A 2XS3A 2JSDA 1AF0A 3OHOA 1C3IA 1UMSA 3G42A 4DPEA 1HOVA 3EDGA 1C7KA 3HDBA 1PWPA 3HYGA 3F1AA 1JAOA 5I0LA 1B3DA 1I73A 1JKYA 2A8HA 3DTKA 2X3BA 4JP4A 3K7NA 5JMYA 1BIWA 3DTIA 3N2VA 1BQOA 1JAPA 1MNCA 4GUYA 1I1IP 2EROA 2PJTA 3I7IA 2ERQA 1SMPA 1D8MA 1ZVXA 1UMTA 1ZXCA 5I4OA 4GWMA 2X7MA 5CXAA 2FV5A 4GR0A 1J7NA 5H8XA 4AXQA 1PWUA 3EDHA 1OMJA 4GQLA 3LJTA 1IAGA 1IAEA 2OZRA 2OY4A 1MMBA 2E2DA 1YOUA 3F18A 1DMTA 1HY7A 1IADA 4WK7A 1G12A 1ASTA 1ND1A 1XFYA 1KUGA 3KWVC 1JAQA 2XS4A 2MLSA 1CQRA 3DWBA 2O36A 2OW0A 2YB9A 4XM6A 1JK3A 3HDAP 3LJGA 4GWNA 3KHIA 3MA2A 2W12A 2OXZA 2OY2A 4AUOA 1QUAA 1CGEA 3LIRA 2RJQA 3TSKA 1YCMA 3HB2P 4IUWA 4AYKA 1SRPA 4PKTA 5CZMA 3LGPA 4H2EA 456CA 4DF9A 1FBLA 4XBHA 3RTSA 3U1RA 3ZVSA 2FV9A 1A85A 3WV1A 2W15A 4ON1A 1OO9A 3DPFA 2W14A 3DSLA 4PKWA 3F17A 4G9LA 4H1QA 2JNPA 1DTHA 4GR3A 1R1IA 3DPEA 1ZP5A 1KUIA 3LJZA 1XFXA 1FM1A 3EHXA 2CLTA 1KUHA 1CK7A 1G05A 2YIGA 2RJPA 2USNA 3HBVP 1WNIA 1ROSA 1GXDA 1PWWA 1IAAA 3TT4A 3KMCA 1GE7A 1JJ9A 1XUCA 2POJA 1KAPP 1QIAA 3LUNA 2MZIA 1D8FA 4J4MA 1MMRA 2N8RA 1Y0VA 3DL1A 4H30A 4EFSA 3F16A 5D3CA 966CA 3OHLA 2AYKA 1CGLA 3O64A 2Z2DA 1OM8A 2QPJA 2WO8A 3KECA 5D2BA 2MLRA 2OXWA 4IJOA 1Q3AA 1R54A 3KEKA 2JIHA 3UVCA 4H82A 1K7QA 1BSWA 1GO8P 3N2UA 3LEAA 3LUMA 1RM8A 3KRYA 4GF1A 1BZSA 2L0RA 3L0TA 1GE6A 4JPAA 3EDIA 4ILWD 3DTEA 4PKRA 3RTTA 3AIGA 3AYUA 1RMZA 1MMPA 1XUDA 3HY9A 4FXYP 1KBCA 3LE9A 1UEAA 1SU3A 1HFCA 3B8ZA 2HU6A 3EHYA 3HY7A 1SLNA 1BQQM 4IN9A 2DDFA 4WZVA 2J83A 4JQGA 4DV8A 1XFZA 1BKCA 2I47A 1AKLA 3TS4A 1OS2A 5D1UA 1D5JA 4PKUA 2YUFA 3ELMA 1A86A 3B92A 2OVZA 4I03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUR A;  2Y6D A;  4QKZ A;  5I12 A;  3USN A;  3LQ0 A;  5BPA A;  1O0Q A;  2WO9 A;  4JIJ A;  2OW2 A;  5D1T A;  4XM7 A;  2K2G A;  3L0V A;  1R55 A;  4H3X A;  1I76 A;  1Z3J A;  1GKC A;  5BOY A;  3AYK A;  1QJI A;  1GE5 A;  1C8T A;  3LIK A;  2Y6C A;  4AIG A;  5I43 A;  2OW1 A;  1SLM A;  1YP1 A;  2O3E A;  1K7I A;  5L7F A;  4G0D A;  1G4K A;  4WKI A;  2V4B A;  1CAQ A;  4DD8 A;  4GR8 A;  4L63 A;  1HFS A;  5I3M A;  3CKI A;  3G5C A;  1G9K A;  3DNG A;  2DW2 A;  2ERP A;  1QIC A;  3VI1 A;  1HV5 A;  3NX7 A;  1ZTQ A;  1USN A;  3P24 A;  1S4B P;  3HBU P;  1XFW A;  4A3W A;  3LQB A;  5B5O A;  3O2X A;  1O0T A;  2DW0 A;  2DW1 A;  5CUH A;  2E3X A;  1ATL A;  1BUV M;  1H71 P;  1EUB A;  3LK8 A;  2AIG P;  3KEJ A;  1CXV A;  1ZS0 A;  1BUD A;  3F19 A;  2OW9 A;  2KRJ A;  1OM6 A;  1BKC E;  4Q1L A;  2DDY A;  1KUF A;  2MZH A;  1L6J A;  1PWV A;  4WF6 A;  1ZXV A;  3ZXH A;  3LMC A;  4FU4 A;  5D7W A;  1Y8J A;  4WKE A;  1FLS A;  2X3C A;  1CIZ A;  5B5P A;  1JIW P;  1YQY A;  3V96 B;  1SAT A;  3SHI A;  5LAB A;  830C A;  1EB6 A;  4XCT A;  1BM6 A;  1R1H A;  4H49 A;  3E8R A;  3ZUK A;  2D1N A;  4HX3 A;  1R1J A;  4PKQ A;  3Q2H A;  2OXU A;  2X3A A;  4A7B A;  1HTD A;  1OS9 A;  3GBO A;  4PKS A;  3EDZ A;  1CGF A;  1PWQ A;  4JA1 A;  3VTG A;  1OM7 A;  2MZE A;  3BA0 A;  5BOT A;  1JAN A;  1QIB A;  4R3V A;  3TVC A;  1GO7 P;  1GKD A;  1AYK A;  1JIZ A;  2TCL A;  3WV2 A;  2OVX A;  3B2Z A;  1KUK A;  3I7G A;  1UTZ A;  3LIL A;  5D1S A;  1MMQ A;  2K9C A;  1B8Y A;  3P1V A;  1XFU A;  1BKC I;  5I2Z A;  5L79 A;  4I35 A;  2D1O A;  2JT5 A;  1QJJ A;  1IAC A;  1JH1 A;  4L6T A;  3Q2G A;  4XM8 A;  2SRT A;  3EWJ A;  4FVL A;  2J0T A;  2W0D A;  3F15 A;  4PKV A;  1UTT A;  3LKA A;  2W13 A;  4H76 A;  1IAB A;  4FXQ A;  3WV3 A;  1K7G A;  4HMA A;  1G49 A;  1D7X A;  2JT6 A;  2WOA A;  4L19 A;  1EAK A;  4CTH A;  1XFV A;  2CKI A;  4ZR5 A;  3K7L A;  2OI0 A;  3KME A;  4H84 A;  1Y93 A;  2XS3 A;  2JSD A;  1AF0 A;  3OHO A;  1C3I A;  1UMS A;  3G42 A;  4DPE A;  1HOV A;  3EDG A;  1C7K A;  3HDB A;  1PWP A;  3HYG A;  3F1A A;  1JAO A;  5I0L A;  1B3D A;  1I73 A;  1JKY A;  2A8H A;  5JMY A;  2X3B A;  4JP4 A;  3K7N A;  1BIW A;  3N2V A;  1BQO A;  1JAP A;  1MNC A;  4GUY A;  1I1I P;  2ERO A;  2PJT A;  3I7I A;  2ERQ A;  1SMP A;  1D8M A;  1ZVX A;  1UMT A;  1ZXC A;  5I4O A;  4GWM A;  2X7M A;  5CXA A;  2FV5 A;  4GR0 A;  1J7N A;  5H8X A;  4AXQ A;  1PWU A;  3EDH A;  1OMJ A;  4GQL A;  3LJT A;  1IAG A;  1IAE A;  2OZR A;  2OY4 A;  1MMB A;  2E2D A;  1YOU A;  3F18 A;  1DMT A;  1HY7 A;  1IAD A;  4WK7 A;  1G12 A;  1AST A;  1ND1 A;  1XFY A;  1KUG A;  3KWV C;  1JAQ A;  2XS4 A;  2MLS A;  1CQR A;  3DWB A;  2O36 A;  2OW0 A;  2YB9 A;  4XM6 A;  1JK3 A;  3HDA P;  3LJG A;  4GWN A;  3KHI A;  3MA2 A;  2W12 A;  2OXZ A;  2OY2 A;  4AUO A;  1QUA A;  1CGE A;  3LIR A;  2RJQ A;  3TSK A;  1YCM A;  3HB2 P;  4IUW A;  4AYK A;  1SRP A;  4PKT A;  5CZM A;  3LGP A;  4H2E A;  456C A;  4DF9 A;  1FBL A;  4XBH A;  3RTS A;  3U1R A;  3ZVS A;  2FV9 A;  1A85 A;  3WV1 A;  2W15 A;  4ON1 A;  1OO9 A;  3DPF A;  2W14 A;  3DSL A;  4PKW A;  3F17 A;  4G9L A;  4H1Q A;  2JNP A;  1DTH A;  4GR3 A;  1R1I A;  3DPE A;  1ZP5 A;  1KUI A;  3LJZ A;  1XFX A;  1FM1 A;  3EHX A;  2CLT A;  1KUH A;  1CK7 A;  1G05 A;  2YIG A;  2RJP A;  2USN A;  3HBV P;  1WNI A;  1ROS A;  1GXD A;  1PWW A;  1IAA A;  3TT4 A;  3KMC A;  1GE7 A;  1JJ9 A;  1XUC A;  2POJ A;  1KAP P;  1QIA A;  3LUN A;  2MZI A;  1D8F A;  4J4M A;  1MMR A;  2N8R A;  1Y0V A;  3DL1 A;  4H30 A;  4EFS A;  3F16 A;  5D3C A;  966C A;  3OHL A;  2AYK A;  1CGL A;  3O64 A;  2Z2D A;  1OM8 A;  2QPJ A;  2WO8 A;  3KEC A;  5D2B A;  2MLR A;  2OXW A;  4IJO A;  1Q3A A;  1R54 A;  3KEK A;  2JIH A;  3UVC A;  4H82 A;  1K7Q A;  1BSW A;  1GO8 P;  3N2U A;  3LEA A;  3LUM A;  1RM8 A;  3KRY A;  4GF1 A;  1BZS A;  2L0R A;  3L0T A;  1GE6 A;  4JPA A;  3EDI A;  4ILW D;  4PKR A;  3RTT A;  3AIG A;  3AYU A;  1RMZ A;  1MMP A;  1XUD A;  3HY9 A;  4FXY P;  1KBC A;  3LE9 A;  1UEA A;  1SU3 A;  1HFC A;  3B8Z A;  2HU6 A;  3EHY A;  3HY7 A;  1SLN A;  1BQQ M;  4IN9 A;  2DDF A;  4WZV A;  2J83 A;  4JQG A;  4DV8 A;  1XFZ A;  1BKC A;  2I47 A;  1AKL A;  3TS4 A;  1OS2 A;  5D1U A;  1D5J A;  4PKU A;  3ELM A;  1A86 A;  3B92 A;  2OVZ A;  4I03 A; 
#chains in the Genus database with same CATH topology
 1XUR A;  2Y6D A;  4QKZ A;  5I12 A;  3USN A;  3LQ0 A;  5BPA A;  1O0Q A;  2WO9 A;  4JIJ A;  2OW2 A;  5D1T A;  4XM7 A;  2K2G A;  3L0V A;  1R55 A;  4H3X A;  1I76 A;  1Z3J A;  1GKC A;  5BOY A;  3AYK A;  1QJI A;  1GE5 A;  1C8T A;  3LIK A;  2Y6C A;  4AIG A;  5I43 A;  2OW1 A;  1SLM A;  1YP1 A;  2O3E A;  1K7I A;  5L7F A;  4G0D A;  1G4K A;  4WKI A;  2V4B A;  1CAQ A;  4DD8 A;  4GR8 A;  4L63 A;  1HFS A;  5I3M A;  3CKI A;  3G5C A;  1G9K A;  3DNG A;  2DW2 A;  2ERP A;  1QIC A;  3VI1 A;  1HV5 A;  3NX7 A;  1TVI A;  1ZTQ A;  1USN A;  3P24 A;  1S4B P;  3HBU P;  1XFW A;  4A3W A;  3LQB A;  1XM5 A;  3O2X A;  1O0T A;  5B5O A;  2DW0 A;  2DW1 A;  5CUH A;  2E3X A;  1ATL A;  1BUV M;  1H71 P;  1EUB A;  3LK8 A;  2AIG P;  3KEJ A;  1CXV A;  1ZS0 A;  1BUD A;  3F19 A;  2OW9 A;  2KRJ A;  1OM6 A;  1BKC E;  4Q1L A;  2DDY A;  1KUF A;  2MZH A;  1L6J A;  1PWV A;  4WF6 A;  1ZXV A;  3ZXH A;  3LMC A;  4FU4 A;  5D7W A;  1Y8J A;  4WKE A;  1FLS A;  2X3C A;  1CIZ A;  5B5P A;  1JIW P;  1YQY A;  3V96 B;  1SAT A;  3SHI A;  5LAB A;  830C A;  1EB6 A;  4XCT A;  1BM6 A;  1R1H A;  4H49 A;  3E8R A;  3ZUK A;  2D1N A;  4HX3 A;  1R1J A;  4PKQ A;  3Q2H A;  2OXU A;  4L7A A;  2X3A A;  4A7B A;  1HTD A;  1OS9 A;  3GBO A;  4PKS A;  3EDZ A;  1CGF A;  1PWQ A;  4JA1 A;  3VTG A;  1OM7 A;  2MZE A;  3BA0 A;  5BOT A;  1JAN A;  1QIB A;  4R3V A;  3TVC A;  1GO7 P;  1GKD A;  1AYK A;  1JIZ A;  2TCL A;  3WV2 A;  2OVX A;  3B2Z A;  1KUK A;  3I7G A;  1UTZ A;  3LIL A;  5D1S A;  1MMQ A;  2K9C A;  1B8Y A;  3P1V A;  1XFU A;  1BKC I;  5I2Z A;  5L79 A;  4I35 A;  2D1O A;  2JT5 A;  1QJJ A;  1IAC A;  1JH1 A;  4L6T A;  3Q2G A;  4XM8 A;  2SRT A;  3EWJ A;  4FVL A;  2J0T A;  2W0D A;  3F15 A;  4PKV A;  1UTT A;  3LKA A;  2W13 A;  4H76 A;  1IAB A;  4FXQ A;  3WV3 A;  1K7G A;  4HMA A;  1G49 A;  1D7X A;  2JT6 A;  2WOA A;  4L19 A;  1EAK A;  4CTH A;  1XFV A;  2CKI A;  4ZR5 A;  3K7L A;  2OI0 A;  3KME A;  4H84 A;  1Y93 A;  2XS3 A;  2JSD A;  1AF0 A;  3OHO A;  1C3I A;  1UMS A;  3G42 A;  4DPE A;  1HOV A;  3EDG A;  1C7K A;  3HDB A;  1PWP A;  3HYG A;  3F1A A;  1JAO A;  5I0L A;  1B3D A;  1I73 A;  1JKY A;  2A8H A;  3DTK A;  2X3B A;  4JP4 A;  3K7N A;  5JMY A;  1BIW A;  3DTI A;  3N2V A;  1BQO A;  1JAP A;  1MNC A;  4GUY A;  1I1I P;  2ERO A;  2PJT A;  3I7I A;  2ERQ A;  1SMP A;  1D8M A;  1ZVX A;  1UMT A;  1ZXC A;  5I4O A;  4GWM A;  2X7M A;  5CXA A;  2FV5 A;  4GR0 A;  1J7N A;  5H8X A;  4AXQ A;  1PWU A;  3EDH A;  1OMJ A;  4GQL A;  3LJT A;  1IAG A;  1IAE A;  2OZR A;  2OY4 A;  1MMB A;  2E2D A;  1YOU A;  3F18 A;  1DMT A;  1HY7 A;  1IAD A;  4WK7 A;  1G12 A;  1AST A;  1ND1 A;  1XFY A;  1KUG A;  3KWV C;  1JAQ A;  2XS4 A;  2MLS A;  1CQR A;  3DWB A;  2O36 A;  2OW0 A;  2YB9 A;  4XM6 A;  1JK3 A;  3HDA P;  3LJG A;  4GWN A;  3KHI A;  3MA2 A;  2W12 A;  2OXZ A;  2OY2 A;  4AUO A;  1QUA A;  1CGE A;  3LIR A;  2RJQ A;  3TSK A;  1YCM A;  3HB2 P;  4IUW A;  4AYK A;  1SRP A;  4PKT A;  5CZM A;  3LGP A;  4H2E A;  456C A;  4DF9 A;  1FBL A;  4XBH A;  3RTS A;  1OZ9 A;  3U1R A;  2FV9 A;  3ZVS A;  1A85 A;  3WV1 A;  2W15 A;  4ON1 A;  1OO9 A;  3DPF A;  2W14 A;  3DSL A;  4PKW A;  3F17 A;  4G9L A;  4H1Q A;  2JNP A;  1DTH A;  4GR3 A;  1R1I A;  3DPE A;  1ZP5 A;  1KUI A;  3LJZ A;  1XFX A;  1FM1 A;  3EHX A;  2CLT A;  1KUH A;  1CK7 A;  1G05 A;  2YIG A;  2RJP A;  2USN A;  3HBV P;  1WNI A;  1ROS A;  1GXD A;  1PWW A;  1IAA A;  3TT4 A;  3KMC A;  1GE7 A;  1JJ9 A;  1XUC A;  2POJ A;  1KAP P;  1QIA A;  3LUN A;  2MZI A;  1D8F A;  4J4M A;  1MMR A;  2N8R A;  1XAX A;  1Y0V A;  3DL1 A;  4H30 A;  4EFS A;  3F16 A;  5D3C A;  966C A;  3OHL A;  2AYK A;  1CGL A;  3O64 A;  2Z2D A;  1OM8 A;  2QPJ A;  2WO8 A;  3KEC A;  5D2B A;  2MLR A;  2OXW A;  4IJO A;  1Q3A A;  1R54 A;  3KEK A;  2JIH A;  3UVC A;  4H82 A;  1K7Q A;  1BSW A;  1GO8 P;  3N2U A;  3LEA A;  3LUM A;  1RM8 A;  3KRY A;  4GF1 A;  1BZS A;  2L0R A;  3L0T A;  1GE6 A;  4JPA A;  3EDI A;  4ILW D;  3DTE A;  4PKR A;  3RTT A;  3AIG A;  3AYU A;  1RMZ A;  1MMP A;  1XUD A;  3HY9 A;  4FXY P;  1KBC A;  3LE9 A;  1UEA A;  1SU3 A;  1HFC A;  3B8Z A;  2HU6 A;  3EHY A;  3HY7 A;  1SLN A;  1BQQ M;  4IN9 A;  2DDF A;  4WZV A;  2J83 A;  4JQG A;  4DV8 A;  1XFZ A;  1BKC A;  2I47 A;  1AKL A;  3TS4 A;  1OS2 A;  5D1U A;  1D5J A;  4PKU A;  2YUF A;  3ELM A;  1A86 A;  3B92 A;  2OVZ A;  4I03 A; 
#chains in the Genus database with same CATH homology
 1XUR A;  2Y6D A;  4QKZ A;  5I12 A;  3USN A;  3LQ0 A;  5BPA A;  1O0Q A;  2WO9 A;  4JIJ A;  2OW2 A;  5D1T A;  4XM7 A;  2K2G A;  3L0V A;  1R55 A;  4H3X A;  1I76 A;  1Z3J A;  1GKC A;  5BOY A;  3AYK A;  1QJI A;  1GE5 A;  1C8T A;  3LIK A;  2Y6C A;  4AIG A;  5I43 A;  2OW1 A;  1SLM A;  1YP1 A;  2O3E A;  1K7I A;  5L7F A;  4G0D A;  1G4K A;  4WKI A;  2V4B A;  1CAQ A;  4DD8 A;  4GR8 A;  4L63 A;  1HFS A;  5I3M A;  3CKI A;  3G5C A;  1G9K A;  3DNG A;  2DW2 A;  2ERP A;  1QIC A;  3VI1 A;  1HV5 A;  3NX7 A;  1ZTQ A;  1USN A;  3P24 A;  1S4B P;  3HBU P;  1XFW A;  4A3W A;  3LQB A;  5B5O A;  3O2X A;  1O0T A;  2DW0 A;  2DW1 A;  5CUH A;  2E3X A;  1ATL A;  1BUV M;  1H71 P;  1EUB A;  3LK8 A;  2AIG P;  3KEJ A;  1CXV A;  1ZS0 A;  1BUD A;  3F19 A;  2OW9 A;  2KRJ A;  1OM6 A;  1BKC E;  4Q1L A;  2DDY A;  1KUF A;  2MZH A;  1L6J A;  1PWV A;  4WF6 A;  1ZXV A;  3ZXH A;  3LMC A;  4FU4 A;  5D7W A;  1Y8J A;  4WKE A;  1FLS A;  2X3C A;  1CIZ A;  5B5P A;  1JIW P;  1YQY A;  3V96 B;  1SAT A;  3SHI A;  5LAB A;  830C A;  1EB6 A;  4XCT A;  1BM6 A;  1R1H A;  4H49 A;  3E8R A;  3ZUK A;  2D1N A;  4HX3 A;  1R1J A;  4PKQ A;  3Q2H A;  2OXU A;  4L7A A;  2X3A A;  4A7B A;  1HTD A;  1OS9 A;  3GBO A;  4PKS A;  3EDZ A;  1CGF A;  1PWQ A;  4JA1 A;  3VTG A;  1OM7 A;  2MZE A;  3BA0 A;  5BOT A;  1JAN A;  1QIB A;  4R3V A;  3TVC A;  1GO7 P;  1GKD A;  1AYK A;  1JIZ A;  2TCL A;  3WV2 A;  2OVX A;  3B2Z A;  1KUK A;  3I7G A;  1UTZ A;  3LIL A;  5D1S A;  1MMQ A;  2K9C A;  1B8Y A;  3P1V A;  1XFU A;  1BKC I;  5I2Z A;  5L79 A;  4I35 A;  2D1O A;  2JT5 A;  1QJJ A;  1IAC A;  1JH1 A;  4L6T A;  3Q2G A;  4XM8 A;  2SRT A;  3EWJ A;  4FVL A;  2J0T A;  2W0D A;  3F15 A;  4PKV A;  1UTT A;  3LKA A;  2W13 A;  4H76 A;  1IAB A;  4FXQ A;  3WV3 A;  1K7G A;  4HMA A;  1G49 A;  1D7X A;  2JT6 A;  2WOA A;  4L19 A;  1EAK A;  4CTH A;  1XFV A;  2CKI A;  4ZR5 A;  3K7L A;  2OI0 A;  3KME A;  4H84 A;  1Y93 A;  2XS3 A;  2JSD A;  1AF0 A;  3OHO A;  1C3I A;  1UMS A;  3G42 A;  4DPE A;  1HOV A;  3EDG A;  1C7K A;  3HDB A;  1PWP A;  3HYG A;  3F1A A;  1JAO A;  5I0L A;  1B3D A;  1I73 A;  1JKY A;  2A8H A;  3DTK A;  2X3B A;  4JP4 A;  3K7N A;  5JMY A;  1BIW A;  3DTI A;  3N2V A;  1BQO A;  1JAP A;  1MNC A;  4GUY A;  1I1I P;  2ERO A;  2PJT A;  3I7I A;  2ERQ A;  1SMP A;  1D8M A;  1ZVX A;  1UMT A;  1ZXC A;  5I4O A;  4GWM A;  2X7M A;  5CXA A;  2FV5 A;  4GR0 A;  1J7N A;  5H8X A;  4AXQ A;  1PWU A;  3EDH A;  1OMJ A;  4GQL A;  3LJT A;  1IAG A;  1IAE A;  2OZR A;  2OY4 A;  1MMB A;  2E2D A;  1YOU A;  3F18 A;  1DMT A;  1HY7 A;  1IAD A;  4WK7 A;  1G12 A;  1AST A;  1ND1 A;  1XFY A;  1KUG A;  3KWV C;  1JAQ A;  2XS4 A;  2MLS A;  1CQR A;  3DWB A;  2O36 A;  2OW0 A;  2YB9 A;  4XM6 A;  1JK3 A;  3HDA P;  3LJG A;  4GWN A;  3KHI A;  3MA2 A;  2W12 A;  2OXZ A;  2OY2 A;  4AUO A;  1QUA A;  1CGE A;  3LIR A;  2RJQ A;  3TSK A;  1YCM A;  3HB2 P;  4IUW A;  4AYK A;  1SRP A;  4PKT A;  5CZM A;  3LGP A;  4H2E A;  456C A;  4DF9 A;  1FBL A;  4XBH A;  3RTS A;  3U1R A;  3ZVS A;  2FV9 A;  1A85 A;  3WV1 A;  2W15 A;  4ON1 A;  1OO9 A;  3DPF A;  2W14 A;  3DSL A;  4PKW A;  3F17 A;  4G9L A;  4H1Q A;  2JNP A;  1DTH A;  4GR3 A;  1R1I A;  3DPE A;  1ZP5 A;  1KUI A;  3LJZ A;  1XFX A;  1FM1 A;  3EHX A;  2CLT A;  1KUH A;  1CK7 A;  1G05 A;  2YIG A;  2RJP A;  2USN A;  3HBV P;  1WNI A;  1ROS A;  1GXD A;  1PWW A;  1IAA A;  3TT4 A;  3KMC A;  1GE7 A;  1JJ9 A;  1XUC A;  2POJ A;  1KAP P;  1QIA A;  3LUN A;  2MZI A;  1D8F A;  4J4M A;  1MMR A;  2N8R A;  1Y0V A;  3DL1 A;  4H30 A;  4EFS A;  3F16 A;  5D3C A;  966C A;  3OHL A;  2AYK A;  1CGL A;  3O64 A;  2Z2D A;  1OM8 A;  2QPJ A;  2WO8 A;  3KEC A;  5D2B A;  2MLR A;  2OXW A;  4IJO A;  1Q3A A;  1R54 A;  3KEK A;  2JIH A;  3UVC A;  4H82 A;  1K7Q A;  1BSW A;  1GO8 P;  3N2U A;  3LEA A;  3LUM A;  1RM8 A;  3KRY A;  4GF1 A;  1BZS A;  2L0R A;  3L0T A;  1GE6 A;  4JPA A;  3EDI A;  4ILW D;  3DTE A;  4PKR A;  3RTT A;  3AIG A;  3AYU A;  1RMZ A;  1MMP A;  1XUD A;  3HY9 A;  4FXY P;  1KBC A;  3LE9 A;  1UEA A;  1SU3 A;  1HFC A;  3B8Z A;  2HU6 A;  3EHY A;  3HY7 A;  1SLN A;  1BQQ M;  4IN9 A;  2DDF A;  4WZV A;  2J83 A;  4JQG A;  4DV8 A;  1XFZ A;  1BKC A;  2I47 A;  1AKL A;  3TS4 A;  1OS2 A;  5D1U A;  1D5J A;  4PKU A;  2YUF A;  3ELM A;  1A86 A;  3B92 A;  2OVZ A;  4I03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...