3N2UA

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor n-hydroxy-2-(4-methoxy-n(2-(3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2h-pyran-2-yloxy)ethyl)phenylsulfonamido)acetamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Structure-based approach to nanomolar, water soluble matrix metalloproteinases inhibitors (MMPIs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3n2uA00
4GR0A 1QJIA 1MNCA 1BZSA 3WV3A 4XCTA 1L6JA 5L7FA 2X3AA 1HFCA 1Z3JA 1EAKA 4WKIA 3LEAA 1IACA 2OXUA 1RMZA 1OM8A 4JQGA 3KHIA 4H84A 3AYKA 3TS4A 1XFUA 2J83A 1BSWA 5H8XA 3DWBA 1YQYA 2E3XA 4I03A 1JIWP 3BA0A 1QICA 5D7WA 2W15A 1G05A 3N2VA 2JT5A 1R1JA 1CGFA 2DDFA 1R1IA 3LIKA 1ZTQA 5LABA 1G4KA 4I35A 4GWNA 1OM6A 3LJTA 2K2GA 5CUHA 3WV2A 4ZR5A 1IAGA 1KUFA 1GE7A 3GBOA 1SMPA 3KEKA 4GR3A 3HBVP 5I4OA 1BKCA 1EB6A 3LJZA 1DTHA 1HV5A 1Q3AA 2J0TA 3USNA 1UEAA 456CA 1DMTA 4FXQA 5D1SA 1O0QA 1GE5A 1XFZA 1YCMA 2POJA 4XM8A 1ROSA 1XUDA 2DW0A 3DL1A 4PKQA 4HX3A 2PJTA 2D1NA 1A85A 2QPJA 1ATLA 1YOUA 2MZIA 5I3MA 1A86A 1QIBA 1YP1A 1ZXVA 2N8RA 1HTDA 1PWPA 1BM6A 1OO9A 3LKAA 1XURA 3F19A 4EFSA 2WOAA 3LJGA 1K7IA 3LQBA 2SRTA 3B8ZA 1ZXCA 4H30A 1XFYA 3N2UA 830CA 3EHYA 3VI1A 1K7QA 1ZP5A 4DD8A 3HDBA 3TT4A 1O0TA 4AYKA 1OM7A 1S4BP 3HBUP 1IAEA 1RM8A 1MMPA 2W13A 1KUHA 1JAOA 2OY2A 3P1VA 1J7NA 1H71P 1JKYA 3F15A 3KWVC 3LGPA 1ZS0A 3EDHA 1HY7A 3KMEA 4GR8A 1SRPA 3DPEA 1USNA 3LQ0A 1FM1A 3OHOA 3RTSA 5BOYA 4JA1A 4GF1A 1IADA 5I43A 4PKUA 4WZVA 2OXWA 5BPAA 1UMTA 1KAPP 5L79A 3HY7A 1SLNA 3K7NA 3G42A 2I47A 2MZEA 3HYGA 1JH1A 4PKSA 4FXYP 3LUMA 2OW0A 1CIZA 2AYKA 966CA 2XS3A 3LK8A 2OZRA 3RTTA 4DV8A 1PWUA 3E8RA 1B8YA 4H82A 2E2DA 2OVZA 3LILA 2MLSA 3AYUA 4A3WA 4L63A 1JAPA 1GO8P 1R1HA 1OS9A 3F16A 3DNGA 2Z2DA 2L0RA 5D1TA 1OS2A 2A8HA 4J4MA 1KUIA 1GE6A 3KEJA 2YB9A 4IN9A 1JAQA 2D1OA 4L19A 4JIJA 3F18A 3HB2P 4AIGA 3DSLA 2W0DA 4PKTA 4H76A 3V96B 1XUCA 4PKVA 4JPAA 1FLSA 1G12A 5D1UA 1FBLA 2EROA 1Y8JA 3MA2A 2RJPA 3NX7A 1HOVA 2DW2A 3K7LA 4WK7A 2FV9A 2K9CA 2O36A 3B2ZA 3LMCA 2FV5A 3KECA 3TSKA 3L0TA 2OW9A 3EHXA 2DW1A 1OMJA 1CAQA 2CKIA 4XBHA 1AF0A 4DPEA 1SU3A 1ZVXA 1I76A 4FU4A 2X3CA 2ERPA 4AXQA 1JANA 4PKRA 2ERQA 2OY4A 3LE9A 1UTTA 3U1RA 3Q2GA 4L6TA 5I2ZA 4XM7A 3HY9A 1KUGA 1CXVA 2OW2A 1ASTA 2W12A 1BQOA 1BUDA 3AIGA 5CZMA 5JMYA 1R54A 1I1IP 3TVCA 1IAAA 1HFSA 2OXZA 1G49A 2OW1A 4DF9A 3WV1A 4GQLA 1B3DA 5B5PA 2WO8A 3EDZA 2HU6A 1ND1A 2JNPA 4WF6A 1PWQA 4WKEA 1GKDA 2DDYA 1Y93A 1MMBA 3O2XA 3I7GA 3OHLA 5BOTA 4GUYA 1G9KA 5D3CA 4QKZA 1BKCE 1CQRA 2XS4A 1XFXA 1CK7A 3EWJA 1BQQM 2USNA 4ILWD 4H2EA 4ON1A 3EDIA 1CGLA 4AUOA 3O64A 2JT6A 1PWWA 1SATA 1GKCA 1Y0VA 3F1AA 3CKIA 4H3XA 2RJQA 3KRYA 4IUWA 2X3BA 5D2BA 2Y6CA 4G0DA 3UVCA 4GWMA 1D8MA 3VTGA 4H49A 1MMQA 2OI0A 4IJOA 1BUVM 1XFWA 1C8TA 5I12A 4H1QA 4XM6A 1D8FA 1EUBA 1C3IA 1UMSA 2JIHA 1QIAA 3SHIA 2JSDA 1JJ9A 4CTHA 1KUKA 1QUAA 3G5CA 3HDAP 1CGEA 1PWVA 1D7XA 1I73A 2YIGA 3F17A 3I7IA 3LUNA 3KMCA 2W14A 2X7MA 1UTZA 3ZXHA 4A7BA 1C7KA 1IABA 2O3EA 1BKCI 2KRJA 3Q2HA 3ZUKA 4G9LA 3L0VA 1QJJA 1JIZA 2Y6DA 1KBCA 5CXAA 1AYKA 4R3VA 1GXDA 2WO9A 5B5OA 1WNIA 2AIGP 1GO7P 3ELMA 1XFVA 3ZVSA 1MMRA 4HMAA 3DPFA 4JP4A 3LIRA 3B92A 2V4BA 1D5JA 1BIWA 3EDGA 4PKWA 4Q1LA 1SLMA 5I0LA 2TCLA 1R55A 2CLTA 1JK3A 2OVXA 1AKLA 1K7GA 2MZHA 4FVLA 3P24A 2MLRA
chains in the Genus database with same CATH superfamily
4GR0A 1QJIA 1MNCA 1BZSA 3WV3A 4XCTA 1L6JA 5L7FA 2X3AA 1HFCA 1Z3JA 1EAKA 4WKIA 3LEAA 1IACA 2OXUA 1RMZA 1OM8A 4JQGA 3KHIA 4H84A 3AYKA 3TS4A 1XFUA 2J83A 1BSWA 5H8XA 3DWBA 1YQYA 2E3XA 1XAXA 4I03A 1JIWP 3BA0A 1QICA 5D7WA 2W15A 1G05A 3N2VA 2JT5A 1R1JA 1CGFA 2DDFA 1R1IA 3LIKA 1ZTQA 5LABA 1G4KA 4I35A 4GWNA 1OM6A 3LJTA 2K2GA 5CUHA 3WV2A 4ZR5A 1IAGA 1KUFA 1GE7A 3GBOA 1SMPA 3KEKA 4GR3A 3HBVP 5I4OA 1BKCA 1EB6A 3LJZA 1DTHA 1HV5A 1Q3AA 2J0TA 3USNA 1UEAA 456CA 1DMTA 4FXQA 5D1SA 1O0QA 1GE5A 1XFZA 1YCMA 2POJA 4XM8A 1ROSA 1XUDA 2DW0A 3DL1A 4PKQA 4HX3A 2PJTA 2D1NA 2YUFA 1A85A 2QPJA 1ATLA 1YOUA 2MZIA 5I3MA 1A86A 1QIBA 1YP1A 1ZXVA 2N8RA 1HTDA 1PWPA 1BM6A 1OO9A 3LKAA 1XURA 3F19A 4EFSA 2WOAA 3LJGA 1K7IA 3LQBA 2SRTA 3B8ZA 1ZXCA 4H30A 1XFYA 3N2UA 830CA 3EHYA 3VI1A 1OZ9A 1K7QA 1ZP5A 4DD8A 3HDBA 3TT4A 1O0TA 4AYKA 1OM7A 1S4BP 3HBUP 1IAEA 1RM8A 1MMPA 2W13A 1TVIA 1KUHA 1JAOA 2OY2A 3P1VA 1J7NA 1H71P 1JKYA 3F15A 3KWVC 3LGPA 1ZS0A 3EDHA 1HY7A 3KMEA 4GR8A 1SRPA 3DPEA 1USNA 3LQ0A 1FM1A 3OHOA 3RTSA 5BOYA 4JA1A 4GF1A 1IADA 5I43A 4PKUA 4WZVA 2OXWA 5BPAA 1UMTA 1KAPP 5L79A 3HY7A 1SLNA 3K7NA 3G42A 2I47A 2MZEA 3HYGA 1JH1A 4PKSA 4FXYP 3LUMA 2OW0A 1CIZA 2AYKA 966CA 2XS3A 3LK8A 2OZRA 3RTTA 4DV8A 1PWUA 3E8RA 1B8YA 4H82A 2E2DA 2OVZA 3LILA 2MLSA 3AYUA 4A3WA 4L63A 1JAPA 1GO8P 1R1HA 1OS9A 3F16A 3DNGA 2Z2DA 2L0RA 5D1TA 1OS2A 2A8HA 4J4MA 1KUIA 1GE6A 3KEJA 2YB9A 4IN9A 1JAQA 2D1OA 4L19A 4JIJA 3F18A 3HB2P 3DTIA 4AIGA 3DSLA 2W0DA 4PKTA 4H76A 3V96B 1XUCA 4PKVA 4JPAA 1FLSA 1G12A 5D1UA 1FBLA 2EROA 1Y8JA 3MA2A 2RJPA 3NX7A 1HOVA 2DW2A 3K7LA 4WK7A 2FV9A 2K9CA 2O36A 1XM5A 3B2ZA 3LMCA 2FV5A 3KECA 3TSKA 3L0TA 2OW9A 3EHXA 2DW1A 1OMJA 1CAQA 2CKIA 4XBHA 1AF0A 4DPEA 1SU3A 1ZVXA 1I76A 4FU4A 2X3CA 2ERPA 4AXQA 1JANA 4PKRA 2ERQA 3DTKA 2OY4A 3LE9A 1UTTA 3U1RA 3Q2GA 4L6TA 5I2ZA 4XM7A 3HY9A 1KUGA 1CXVA 2OW2A 1ASTA 2W12A 1BQOA 1BUDA 3AIGA 5CZMA 5JMYA 1R54A 1I1IP 3TVCA 1IAAA 1HFSA 2OXZA 1G49A 2OW1A 4DF9A 3WV1A 4GQLA 1B3DA 5B5PA 2WO8A 3EDZA 2HU6A 1ND1A 2JNPA 4WF6A 1PWQA 4WKEA 1GKDA 2DDYA 1Y93A 1MMBA 3O2XA 3I7GA 3OHLA 5BOTA 4L7AA 4GUYA 1G9KA 5D3CA 4QKZA 1BKCE 1CQRA 2XS4A 1XFXA 1CK7A 3EWJA 1BQQM 2USNA 4ILWD 4H2EA 4ON1A 3EDIA 1CGLA 4AUOA 3O64A 2JT6A 1PWWA 1SATA 1GKCA 1Y0VA 3F1AA 3CKIA 4H3XA 2RJQA 3KRYA 4IUWA 2X3BA 5D2BA 3DTEA 2Y6CA 4G0DA 3UVCA 4GWMA 1D8MA 3VTGA 4H49A 1MMQA 2OI0A 4IJOA 1BUVM 1XFWA 1C8TA 5I12A 4H1QA 4XM6A 1D8FA 1EUBA 1C3IA 1UMSA 2JIHA 1QIAA 3SHIA 2JSDA 1JJ9A 4CTHA 1KUKA 1QUAA 3G5CA 3HDAP 1CGEA 1PWVA 1D7XA 1I73A 2YIGA 3F17A 3I7IA 3LUNA 3KMCA 2W14A 2X7MA 1UTZA 3ZXHA 4A7BA 1C7KA 1IABA 2O3EA 1BKCI 2KRJA 3Q2HA 3ZUKA 4G9LA 3L0VA 1QJJA 1JIZA 2Y6DA 1KBCA 5CXAA 1AYKA 4R3VA 1GXDA 2WO9A 5B5OA 1WNIA 2AIGP 1GO7P 3ELMA 1XFVA 3ZVSA 1MMRA 4HMAA 3DPFA 4JP4A 3LIRA 3B92A 2V4BA 1D5JA 1BIWA 3EDGA 4PKWA 4Q1LA 1SLMA 5I0LA 2TCLA 1R55A 2CLTA 1JK3A 2OVXA 1AKLA 1K7GA 2MZHA 4FVLA 3P24A 2MLRA
chains in the Genus database with same CATH topology
4GR0A 1QJIA 1MNCA 1BZSA 3WV3A 4XCTA 1L6JA 5L7FA 2X3AA 1HFCA 1Z3JA 1EAKA 4WKIA 3LEAA 1IACA 2OXUA 1RMZA 1OM8A 4JQGA 3KHIA 4H84A 3AYKA 3TS4A 1XFUA 2J83A 1BSWA 5H8XA 3DWBA 1YQYA 2E3XA 4I03A 1JIWP 3BA0A 1QICA 5D7WA 2W15A 1G05A 3N2VA 2JT5A 1R1JA 1CGFA 2DDFA 1R1IA 3LIKA 1ZTQA 5LABA 1G4KA 4I35A 4GWNA 1OM6A 3LJTA 2K2GA 5CUHA 3WV2A 4ZR5A 1IAGA 1KUFA 1GE7A 3GBOA 1SMPA 3KEKA 4GR3A 3HBVP 5I4OA 1BKCA 1EB6A 3LJZA 1DTHA 1HV5A 1Q3AA 2J0TA 3USNA 1UEAA 456CA 1DMTA 4FXQA 5D1SA 1O0QA 1GE5A 1XFZA 1YCMA 2POJA 4XM8A 1ROSA 1XUDA 2DW0A 3DL1A 4PKQA 4HX3A 2PJTA 2D1NA 2YUFA 1A85A 2QPJA 1ATLA 1YOUA 2MZIA 5I3MA 1A86A 1QIBA 1YP1A 1ZXVA 2N8RA 1HTDA 1PWPA 1BM6A 1OO9A 3LKAA 1XURA 3F19A 4EFSA 2WOAA 3LJGA 1K7IA 3LQBA 2SRTA 3B8ZA 1ZXCA 4H30A 1XFYA 3N2UA 830CA 3EHYA 3VI1A 1K7QA 1ZP5A 4DD8A 3HDBA 3TT4A 1O0TA 4AYKA 1OM7A 1S4BP 3HBUP 1IAEA 1RM8A 1MMPA 2W13A 1KUHA 1JAOA 2OY2A 3P1VA 1J7NA 1H71P 1JKYA 3F15A 3KWVC 3LGPA 1ZS0A 3EDHA 1HY7A 3KMEA 4GR8A 1SRPA 3DPEA 1USNA 3LQ0A 1FM1A 3OHOA 3RTSA 5BOYA 4JA1A 4GF1A 1IADA 5I43A 4PKUA 4WZVA 2OXWA 5BPAA 1UMTA 1KAPP 5L79A 3HY7A 1SLNA 3K7NA 3G42A 2I47A 2MZEA 3HYGA 1JH1A 4PKSA 4FXYP 3LUMA 2OW0A 1CIZA 2AYKA 966CA 2XS3A 3LK8A 2OZRA 3RTTA 4DV8A 1PWUA 3E8RA 1B8YA 4H82A 2E2DA 2OVZA 3LILA 2MLSA 3AYUA 4A3WA 4L63A 1JAPA 1GO8P 1R1HA 1OS9A 3F16A 3DNGA 2Z2DA 2L0RA 5D1TA 1OS2A 2A8HA 4J4MA 1KUIA 1GE6A 3KEJA 2YB9A 4IN9A 1JAQA 2D1OA 4L19A 4JIJA 3F18A 3HB2P 3DTIA 4AIGA 3DSLA 2W0DA 4PKTA 4H76A 3V96B 1XUCA 4PKVA 4JPAA 1FLSA 1G12A 5D1UA 1FBLA 2EROA 1Y8JA 3MA2A 2RJPA 3NX7A 1HOVA 2DW2A 3K7LA 4WK7A 2FV9A 2K9CA 2O36A 3B2ZA 3LMCA 2FV5A 3KECA 3TSKA 3L0TA 2OW9A 3EHXA 2DW1A 1OMJA 1CAQA 2CKIA 4XBHA 1AF0A 4DPEA 1SU3A 1ZVXA 1I76A 4FU4A 2X3CA 2ERPA 4AXQA 1JANA 4PKRA 2ERQA 3DTKA 2OY4A 3LE9A 1UTTA 3U1RA 3Q2GA 4L6TA 5I2ZA 4XM7A 3HY9A 1KUGA 1CXVA 2OW2A 1ASTA 2W12A 1BQOA 1BUDA 3AIGA 5CZMA 5JMYA 1R54A 1I1IP 3TVCA 1IAAA 1HFSA 2OXZA 1G49A 2OW1A 4DF9A 3WV1A 4GQLA 1B3DA 5B5PA 2WO8A 3EDZA 2HU6A 1ND1A 2JNPA 4WF6A 1PWQA 4WKEA 1GKDA 2DDYA 1Y93A 1MMBA 3O2XA 3I7GA 3OHLA 5BOTA 4L7AA 4GUYA 1G9KA 5D3CA 4QKZA 1BKCE 1CQRA 2XS4A 1XFXA 1CK7A 3EWJA 1BQQM 2USNA 4ILWD 4H2EA 4ON1A 3EDIA 1CGLA 4AUOA 3O64A 2JT6A 1PWWA 1SATA 1GKCA 1Y0VA 3F1AA 3CKIA 4H3XA 2RJQA 3KRYA 4IUWA 2X3BA 5D2BA 3DTEA 2Y6CA 4G0DA 3UVCA 4GWMA 1D8MA 3VTGA 4H49A 1MMQA 2OI0A 4IJOA 1BUVM 1XFWA 1C8TA 5I12A 4H1QA 4XM6A 1D8FA 1EUBA 1C3IA 1UMSA 2JIHA 1QIAA 3SHIA 2JSDA 1JJ9A 4CTHA 1KUKA 1QUAA 3G5CA 3HDAP 1CGEA 1PWVA 1D7XA 1I73A 2YIGA 3F17A 3I7IA 3LUNA 3KMCA 2W14A 2X7MA 1UTZA 3ZXHA 4A7BA 1C7KA 1IABA 2O3EA 1BKCI 2KRJA 3Q2HA 3ZUKA 4G9LA 3L0VA 1QJJA 1JIZA 2Y6DA 1KBCA 5CXAA 1AYKA 4R3VA 1GXDA 2WO9A 5B5OA 1WNIA 2AIGP 1GO7P 3ELMA 1XFVA 3ZVSA 1MMRA 4HMAA 3DPFA 4JP4A 3LIRA 3B92A 2V4BA 1D5JA 1BIWA 3EDGA 4PKWA 4Q1LA 1SLMA 5I0LA 2TCLA 1R55A 2CLTA 1JK3A 2OVXA 1AKLA 1K7GA 2MZHA 4FVLA 3P24A 2MLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR0 A;  1QJI A;  1MNC A;  1BZS A;  3WV3 A;  4XCT A;  1L6J A;  5L7F A;  2X3A A;  1HFC A;  1Z3J A;  1EAK A;  4WKI A;  3LEA A;  1IAC A;  2OXU A;  1RMZ A;  1OM8 A;  4JQG A;  3KHI A;  4H84 A;  3AYK A;  3TS4 A;  1XFU A;  2J83 A;  1BSW A;  5H8X A;  3DWB A;  1YQY A;  2E3X A;  4I03 A;  1JIW P;  3BA0 A;  1QIC A;  5D7W A;  2W15 A;  1G05 A;  3N2V A;  2JT5 A;  1R1J A;  1CGF A;  2DDF A;  1R1I A;  3LIK A;  1ZTQ A;  5LAB A;  1G4K A;  4I35 A;  4GWN A;  1OM6 A;  3LJT A;  2K2G A;  5CUH A;  3WV2 A;  4ZR5 A;  1IAG A;  1KUF A;  1GE7 A;  3GBO A;  1SMP A;  3KEK A;  4GR3 A;  3HBV P;  5I4O A;  1BKC A;  1EB6 A;  3LJZ A;  1DTH A;  1HV5 A;  1Q3A A;  2J0T A;  3USN A;  1UEA A;  456C A;  1DMT A;  4FXQ A;  5D1S A;  1O0Q A;  1GE5 A;  1XFZ A;  1YCM A;  2POJ A;  4XM8 A;  1ROS A;  1XUD A;  2DW0 A;  3DL1 A;  4PKQ A;  4HX3 A;  2PJT A;  2D1N A;  1A85 A;  2QPJ A;  1ATL A;  1YOU A;  2MZI A;  5I3M A;  1A86 A;  1QIB A;  1YP1 A;  1ZXV A;  2N8R A;  1HTD A;  1PWP A;  1BM6 A;  1OO9 A;  3LKA A;  1XUR A;  3F19 A;  4EFS A;  2WOA A;  3LJG A;  1K7I A;  3LQB A;  2SRT A;  3B8Z A;  1ZXC A;  4H30 A;  1XFY A;  3N2U A;  830C A;  3EHY A;  3VI1 A;  1K7Q A;  1ZP5 A;  4DD8 A;  3HDB A;  3TT4 A;  1O0T A;  4AYK A;  1OM7 A;  1S4B P;  3HBU P;  1IAE A;  1RM8 A;  1MMP A;  2W13 A;  1KUH A;  1JAO A;  2OY2 A;  3P1V A;  1J7N A;  1H71 P;  1JKY A;  3F15 A;  3KWV C;  3LGP A;  1ZS0 A;  3EDH A;  1HY7 A;  3KME A;  4GR8 A;  1SRP A;  3DPE A;  1USN A;  3LQ0 A;  1FM1 A;  3OHO A;  3RTS A;  5BOY A;  4JA1 A;  4GF1 A;  1IAD A;  5I43 A;  4PKU A;  4WZV A;  2OXW A;  5BPA A;  1UMT A;  1KAP P;  5L79 A;  3HY7 A;  1SLN A;  3K7N A;  3G42 A;  2I47 A;  2MZE A;  3HYG A;  1JH1 A;  4PKS A;  4FXY P;  3LUM A;  2OW0 A;  1CIZ A;  2AYK A;  966C A;  2XS3 A;  3LK8 A;  2OZR A;  3RTT A;  4DV8 A;  1PWU A;  3E8R A;  1B8Y A;  4H82 A;  2E2D A;  2OVZ A;  3LIL A;  2MLS A;  3AYU A;  4A3W A;  4L63 A;  1JAP A;  1GO8 P;  1R1H A;  1OS9 A;  3F16 A;  3DNG A;  2Z2D A;  2L0R A;  5D1T A;  1OS2 A;  2A8H A;  4J4M A;  1KUI A;  1GE6 A;  3KEJ A;  2YB9 A;  4IN9 A;  1JAQ A;  2D1O A;  4L19 A;  4JIJ A;  3F18 A;  3HB2 P;  4AIG A;  3DSL A;  2W0D A;  4PKT A;  4H76 A;  3V96 B;  1XUC A;  4PKV A;  4JPA A;  1FLS A;  1G12 A;  5D1U A;  1FBL A;  2ERO A;  1Y8J A;  3MA2 A;  2RJP A;  3NX7 A;  1HOV A;  2DW2 A;  3K7L A;  4WK7 A;  2FV9 A;  2K9C A;  2O36 A;  3B2Z A;  3LMC A;  2FV5 A;  3KEC A;  3TSK A;  3L0T A;  2OW9 A;  3EHX A;  2DW1 A;  1OMJ A;  1CAQ A;  2CKI A;  4XBH A;  1AF0 A;  4DPE A;  1SU3 A;  1ZVX A;  1I76 A;  4FU4 A;  2X3C A;  2ERP A;  4AXQ A;  1JAN A;  4PKR A;  2ERQ A;  2OY4 A;  3LE9 A;  1UTT A;  3U1R A;  3Q2G A;  4L6T A;  5I2Z A;  4XM7 A;  3HY9 A;  1KUG A;  1CXV A;  2OW2 A;  1AST A;  2W12 A;  1BQO A;  1BUD A;  3AIG A;  5CZM A;  5JMY A;  1R54 A;  1I1I P;  3TVC A;  1IAA A;  1HFS A;  2OXZ A;  1G49 A;  2OW1 A;  4DF9 A;  3WV1 A;  4GQL A;  1B3D A;  5B5P A;  2WO8 A;  3EDZ A;  2HU6 A;  1ND1 A;  2JNP A;  4WF6 A;  1PWQ A;  4WKE A;  1GKD A;  2DDY A;  1Y93 A;  1MMB A;  3O2X A;  3I7G A;  3OHL A;  5BOT A;  4GUY A;  1G9K A;  5D3C A;  4QKZ A;  1BKC E;  1CQR A;  2XS4 A;  1XFX A;  1CK7 A;  3EWJ A;  1BQQ M;  2USN A;  4ILW D;  4H2E A;  4ON1 A;  3EDI A;  1CGL A;  4AUO A;  3O64 A;  2JT6 A;  1PWW A;  1SAT A;  1GKC A;  1Y0V A;  3F1A A;  3CKI A;  4H3X A;  2RJQ A;  3KRY A;  4IUW A;  2X3B A;  5D2B A;  2Y6C A;  4G0D A;  3UVC A;  4GWM A;  1D8M A;  3VTG A;  4H49 A;  1MMQ A;  2OI0 A;  4IJO A;  1BUV M;  1XFW A;  1C8T A;  5I12 A;  4H1Q A;  4XM6 A;  1D8F A;  1EUB A;  1C3I A;  1UMS A;  2JIH A;  1QIA A;  3SHI A;  2JSD A;  1JJ9 A;  4CTH A;  1KUK A;  1QUA A;  3G5C A;  3HDA P;  1CGE A;  1PWV A;  1D7X A;  1I73 A;  2YIG A;  3F17 A;  3I7I A;  3LUN A;  3KMC A;  2W14 A;  2X7M A;  1UTZ A;  3ZXH A;  4A7B A;  1C7K A;  1IAB A;  2O3E A;  1BKC I;  2KRJ A;  3Q2H A;  3ZUK A;  4G9L A;  3L0V A;  1QJJ A;  1JIZ A;  2Y6D A;  1KBC A;  5CXA A;  1AYK A;  4R3V A;  1GXD A;  2WO9 A;  5B5O A;  1WNI A;  2AIG P;  1GO7 P;  3ELM A;  1XFV A;  3ZVS A;  1MMR A;  4HMA A;  3DPF A;  4JP4 A;  3LIR A;  3B92 A;  2V4B A;  1D5J A;  1BIW A;  3EDG A;  4PKW A;  4Q1L A;  1SLM A;  5I0L A;  2TCL A;  1R55 A;  2CLT A;  1JK3 A;  2OVX A;  1AKL A;  1K7G A;  2MZH A;  4FVL A;  3P24 A;  2MLR A; 
#chains in the Genus database with same CATH topology
 4GR0 A;  1QJI A;  1MNC A;  1BZS A;  3WV3 A;  4XCT A;  1L6J A;  5L7F A;  2X3A A;  1HFC A;  1Z3J A;  1EAK A;  4WKI A;  3LEA A;  1IAC A;  2OXU A;  1RMZ A;  1OM8 A;  4JQG A;  3KHI A;  4H84 A;  3AYK A;  3TS4 A;  1XFU A;  2J83 A;  1BSW A;  5H8X A;  3DWB A;  1YQY A;  2E3X A;  1XAX A;  4I03 A;  1JIW P;  3BA0 A;  1QIC A;  5D7W A;  2W15 A;  1G05 A;  3N2V A;  2JT5 A;  1R1J A;  1CGF A;  2DDF A;  1R1I A;  3LIK A;  1ZTQ A;  5LAB A;  1G4K A;  4I35 A;  4GWN A;  1OM6 A;  3LJT A;  2K2G A;  5CUH A;  3WV2 A;  4ZR5 A;  1IAG A;  1KUF A;  1GE7 A;  3GBO A;  1SMP A;  3KEK A;  4GR3 A;  3HBV P;  5I4O A;  1BKC A;  1EB6 A;  3LJZ A;  1DTH A;  1HV5 A;  1Q3A A;  2J0T A;  3USN A;  1UEA A;  456C A;  1DMT A;  4FXQ A;  5D1S A;  1O0Q A;  1GE5 A;  1XFZ A;  1YCM A;  2POJ A;  4XM8 A;  1ROS A;  1XUD A;  2DW0 A;  3DL1 A;  4PKQ A;  4HX3 A;  2PJT A;  2D1N A;  2YUF A;  1A85 A;  2QPJ A;  1ATL A;  1YOU A;  2MZI A;  5I3M A;  1A86 A;  1QIB A;  1YP1 A;  1ZXV A;  2N8R A;  1HTD A;  1PWP A;  1BM6 A;  1OO9 A;  3LKA A;  1XUR A;  3F19 A;  4EFS A;  2WOA A;  3LJG A;  1K7I A;  3LQB A;  2SRT A;  3B8Z A;  1ZXC A;  4H30 A;  1XFY A;  3N2U A;  830C A;  3EHY A;  3VI1 A;  1OZ9 A;  1K7Q A;  1ZP5 A;  4DD8 A;  3HDB A;  3TT4 A;  1O0T A;  4AYK A;  1OM7 A;  1S4B P;  3HBU P;  1IAE A;  1RM8 A;  1MMP A;  2W13 A;  1TVI A;  1KUH A;  1JAO A;  2OY2 A;  3P1V A;  1J7N A;  1H71 P;  1JKY A;  3F15 A;  3KWV C;  3LGP A;  1ZS0 A;  3EDH A;  1HY7 A;  3KME A;  4GR8 A;  1SRP A;  3DPE A;  1USN A;  3LQ0 A;  1FM1 A;  3OHO A;  3RTS A;  5BOY A;  4JA1 A;  4GF1 A;  1IAD A;  5I43 A;  4PKU A;  4WZV A;  2OXW A;  5BPA A;  1UMT A;  1KAP P;  5L79 A;  3HY7 A;  1SLN A;  3K7N A;  3G42 A;  2I47 A;  2MZE A;  3HYG A;  1JH1 A;  4PKS A;  4FXY P;  3LUM A;  2OW0 A;  1CIZ A;  2AYK A;  966C A;  2XS3 A;  3LK8 A;  2OZR A;  3RTT A;  4DV8 A;  1PWU A;  3E8R A;  1B8Y A;  4H82 A;  2E2D A;  2OVZ A;  3LIL A;  2MLS A;  3AYU A;  4A3W A;  4L63 A;  1JAP A;  1GO8 P;  1R1H A;  1OS9 A;  3F16 A;  3DNG A;  2Z2D A;  2L0R A;  5D1T A;  1OS2 A;  2A8H A;  4J4M A;  1KUI A;  1GE6 A;  3KEJ A;  2YB9 A;  4IN9 A;  1JAQ A;  2D1O A;  4L19 A;  4JIJ A;  3F18 A;  3HB2 P;  3DTI A;  4AIG A;  3DSL A;  2W0D A;  4PKT A;  4H76 A;  3V96 B;  1XUC A;  4PKV A;  4JPA A;  1FLS A;  1G12 A;  5D1U A;  1FBL A;  2ERO A;  1Y8J A;  3MA2 A;  2RJP A;  3NX7 A;  1HOV A;  2DW2 A;  3K7L A;  4WK7 A;  2FV9 A;  2K9C A;  2O36 A;  1XM5 A;  3B2Z A;  3LMC A;  2FV5 A;  3KEC A;  3TSK A;  3L0T A;  2OW9 A;  3EHX A;  2DW1 A;  1OMJ A;  1CAQ A;  2CKI A;  4XBH A;  1AF0 A;  4DPE A;  1SU3 A;  1ZVX A;  1I76 A;  4FU4 A;  2X3C A;  2ERP A;  4AXQ A;  1JAN A;  4PKR A;  2ERQ A;  3DTK A;  2OY4 A;  3LE9 A;  1UTT A;  3U1R A;  3Q2G A;  4L6T A;  5I2Z A;  4XM7 A;  3HY9 A;  1KUG A;  1CXV A;  2OW2 A;  1AST A;  2W12 A;  1BQO A;  1BUD A;  3AIG A;  5CZM A;  5JMY A;  1R54 A;  1I1I P;  3TVC A;  1IAA A;  1HFS A;  2OXZ A;  1G49 A;  2OW1 A;  4DF9 A;  3WV1 A;  4GQL A;  1B3D A;  5B5P A;  2WO8 A;  3EDZ A;  2HU6 A;  1ND1 A;  2JNP A;  4WF6 A;  1PWQ A;  4WKE A;  1GKD A;  2DDY A;  1Y93 A;  1MMB A;  3O2X A;  3I7G A;  3OHL A;  5BOT A;  4L7A A;  4GUY A;  1G9K A;  5D3C A;  4QKZ A;  1BKC E;  1CQR A;  2XS4 A;  1XFX A;  1CK7 A;  3EWJ A;  1BQQ M;  2USN A;  4ILW D;  4H2E A;  4ON1 A;  3EDI A;  1CGL A;  4AUO A;  3O64 A;  2JT6 A;  1PWW A;  1SAT A;  1GKC A;  1Y0V A;  3F1A A;  3CKI A;  4H3X A;  2RJQ A;  3KRY A;  4IUW A;  2X3B A;  5D2B A;  3DTE A;  2Y6C A;  4G0D A;  3UVC A;  4GWM A;  1D8M A;  3VTG A;  4H49 A;  1MMQ A;  2OI0 A;  4IJO A;  1BUV M;  1XFW A;  1C8T A;  5I12 A;  4H1Q A;  4XM6 A;  1D8F A;  1EUB A;  1C3I A;  1UMS A;  2JIH A;  1QIA A;  3SHI A;  2JSD A;  1JJ9 A;  4CTH A;  1KUK A;  1QUA A;  3G5C A;  3HDA P;  1CGE A;  1PWV A;  1D7X A;  1I73 A;  2YIG A;  3F17 A;  3I7I A;  3LUN A;  3KMC A;  2W14 A;  2X7M A;  1UTZ A;  3ZXH A;  4A7B A;  1C7K A;  1IAB A;  2O3E A;  1BKC I;  2KRJ A;  3Q2H A;  3ZUK A;  4G9L A;  3L0V A;  1QJJ A;  1JIZ A;  2Y6D A;  1KBC A;  5CXA A;  1AYK A;  4R3V A;  1GXD A;  2WO9 A;  5B5O A;  1WNI A;  2AIG P;  1GO7 P;  3ELM A;  1XFV A;  3ZVS A;  1MMR A;  4HMA A;  3DPF A;  4JP4 A;  3LIR A;  3B92 A;  2V4B A;  1D5J A;  1BIW A;  3EDG A;  4PKW A;  4Q1L A;  1SLM A;  5I0L A;  2TCL A;  1R55 A;  2CLT A;  1JK3 A;  2OVX A;  1AKL A;  1K7G A;  2MZH A;  4FVL A;  3P24 A;  2MLR A; 
#chains in the Genus database with same CATH homology
 4GR0 A;  1QJI A;  1MNC A;  1BZS A;  3WV3 A;  4XCT A;  1L6J A;  5L7F A;  2X3A A;  1HFC A;  1Z3J A;  1EAK A;  4WKI A;  3LEA A;  1IAC A;  2OXU A;  1RMZ A;  1OM8 A;  4JQG A;  3KHI A;  4H84 A;  3AYK A;  3TS4 A;  1XFU A;  2J83 A;  1BSW A;  5H8X A;  3DWB A;  1YQY A;  2E3X A;  4I03 A;  1JIW P;  3BA0 A;  1QIC A;  5D7W A;  2W15 A;  1G05 A;  3N2V A;  2JT5 A;  1R1J A;  1CGF A;  2DDF A;  1R1I A;  3LIK A;  1ZTQ A;  5LAB A;  1G4K A;  4I35 A;  4GWN A;  1OM6 A;  3LJT A;  2K2G A;  5CUH A;  3WV2 A;  4ZR5 A;  1IAG A;  1KUF A;  1GE7 A;  3GBO A;  1SMP A;  3KEK A;  4GR3 A;  3HBV P;  5I4O A;  1BKC A;  1EB6 A;  3LJZ A;  1DTH A;  1HV5 A;  1Q3A A;  2J0T A;  3USN A;  1UEA A;  456C A;  1DMT A;  4FXQ A;  5D1S A;  1O0Q A;  1GE5 A;  1XFZ A;  1YCM A;  2POJ A;  4XM8 A;  1ROS A;  1XUD A;  2DW0 A;  3DL1 A;  4PKQ A;  4HX3 A;  2PJT A;  2D1N A;  2YUF A;  1A85 A;  2QPJ A;  1ATL A;  1YOU A;  2MZI A;  5I3M A;  1A86 A;  1QIB A;  1YP1 A;  1ZXV A;  2N8R A;  1HTD A;  1PWP A;  1BM6 A;  1OO9 A;  3LKA A;  1XUR A;  3F19 A;  4EFS A;  2WOA A;  3LJG A;  1K7I A;  3LQB A;  2SRT A;  3B8Z A;  1ZXC A;  4H30 A;  1XFY A;  3N2U A;  830C A;  3EHY A;  3VI1 A;  1K7Q A;  1ZP5 A;  4DD8 A;  3HDB A;  3TT4 A;  1O0T A;  4AYK A;  1OM7 A;  1S4B P;  3HBU P;  1IAE A;  1RM8 A;  1MMP A;  2W13 A;  1KUH A;  1JAO A;  2OY2 A;  3P1V A;  1J7N A;  1H71 P;  1JKY A;  3F15 A;  3KWV C;  3LGP A;  1ZS0 A;  3EDH A;  1HY7 A;  3KME A;  4GR8 A;  1SRP A;  3DPE A;  1USN A;  3LQ0 A;  1FM1 A;  3OHO A;  3RTS A;  5BOY A;  4JA1 A;  4GF1 A;  1IAD A;  5I43 A;  4PKU A;  4WZV A;  2OXW A;  5BPA A;  1UMT A;  1KAP P;  5L79 A;  3HY7 A;  1SLN A;  3K7N A;  3G42 A;  2I47 A;  2MZE A;  3HYG A;  1JH1 A;  4PKS A;  4FXY P;  3LUM A;  2OW0 A;  1CIZ A;  2AYK A;  966C A;  2XS3 A;  3LK8 A;  2OZR A;  3RTT A;  4DV8 A;  1PWU A;  3E8R A;  1B8Y A;  4H82 A;  2E2D A;  2OVZ A;  3LIL A;  2MLS A;  3AYU A;  4A3W A;  4L63 A;  1JAP A;  1GO8 P;  1R1H A;  1OS9 A;  3F16 A;  3DNG A;  2Z2D A;  2L0R A;  5D1T A;  1OS2 A;  2A8H A;  4J4M A;  1KUI A;  1GE6 A;  3KEJ A;  2YB9 A;  4IN9 A;  1JAQ A;  2D1O A;  4L19 A;  4JIJ A;  3F18 A;  3HB2 P;  3DTI A;  4AIG A;  3DSL A;  2W0D A;  4PKT A;  4H76 A;  3V96 B;  1XUC A;  4PKV A;  4JPA A;  1FLS A;  1G12 A;  5D1U A;  1FBL A;  2ERO A;  1Y8J A;  3MA2 A;  2RJP A;  3NX7 A;  1HOV A;  2DW2 A;  3K7L A;  4WK7 A;  2FV9 A;  2K9C A;  2O36 A;  3B2Z A;  3LMC A;  2FV5 A;  3KEC A;  3TSK A;  3L0T A;  2OW9 A;  3EHX A;  2DW1 A;  1OMJ A;  1CAQ A;  2CKI A;  4XBH A;  1AF0 A;  4DPE A;  1SU3 A;  1ZVX A;  1I76 A;  4FU4 A;  2X3C A;  2ERP A;  4AXQ A;  1JAN A;  4PKR A;  2ERQ A;  3DTK A;  2OY4 A;  3LE9 A;  1UTT A;  3U1R A;  3Q2G A;  4L6T A;  5I2Z A;  4XM7 A;  3HY9 A;  1KUG A;  1CXV A;  2OW2 A;  1AST A;  2W12 A;  1BQO A;  1BUD A;  3AIG A;  5CZM A;  5JMY A;  1R54 A;  1I1I P;  3TVC A;  1IAA A;  1HFS A;  2OXZ A;  1G49 A;  2OW1 A;  4DF9 A;  3WV1 A;  4GQL A;  1B3D A;  5B5P A;  2WO8 A;  3EDZ A;  2HU6 A;  1ND1 A;  2JNP A;  4WF6 A;  1PWQ A;  4WKE A;  1GKD A;  2DDY A;  1Y93 A;  1MMB A;  3O2X A;  3I7G A;  3OHL A;  5BOT A;  4L7A A;  4GUY A;  1G9K A;  5D3C A;  4QKZ A;  1BKC E;  1CQR A;  2XS4 A;  1XFX A;  1CK7 A;  3EWJ A;  1BQQ M;  2USN A;  4ILW D;  4H2E A;  4ON1 A;  3EDI A;  1CGL A;  4AUO A;  3O64 A;  2JT6 A;  1PWW A;  1SAT A;  1GKC A;  1Y0V A;  3F1A A;  3CKI A;  4H3X A;  2RJQ A;  3KRY A;  4IUW A;  2X3B A;  5D2B A;  3DTE A;  2Y6C A;  4G0D A;  3UVC A;  4GWM A;  1D8M A;  3VTG A;  4H49 A;  1MMQ A;  2OI0 A;  4IJO A;  1BUV M;  1XFW A;  1C8T A;  5I12 A;  4H1Q A;  4XM6 A;  1D8F A;  1EUB A;  1C3I A;  1UMS A;  2JIH A;  1QIA A;  3SHI A;  2JSD A;  1JJ9 A;  4CTH A;  1KUK A;  1QUA A;  3G5C A;  3HDA P;  1CGE A;  1PWV A;  1D7X A;  1I73 A;  2YIG A;  3F17 A;  3I7I A;  3LUN A;  3KMC A;  2W14 A;  2X7M A;  1UTZ A;  3ZXH A;  4A7B A;  1C7K A;  1IAB A;  2O3E A;  1BKC I;  2KRJ A;  3Q2H A;  3ZUK A;  4G9L A;  3L0V A;  1QJJ A;  1JIZ A;  2Y6D A;  1KBC A;  5CXA A;  1AYK A;  4R3V A;  1GXD A;  2WO9 A;  5B5O A;  1WNI A;  2AIG P;  1GO7 P;  3ELM A;  1XFV A;  3ZVS A;  1MMR A;  4HMA A;  3DPF A;  4JP4 A;  3LIR A;  3B92 A;  2V4B A;  1D5J A;  1BIW A;  3EDG A;  4PKW A;  4Q1L A;  1SLM A;  5I0L A;  2TCL A;  1R55 A;  2CLT A;  1JK3 A;  2OVX A;  1AKL A;  1K7G A;  2MZH A;  4FVL A;  3P24 A;  2MLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...