3N2UA

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor n-hydroxy-2-(4-methoxy-n(2-(3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2h-pyran-2-yloxy)ethyl)phenylsulfonamido)acetamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Structure-based approach to nanomolar, water soluble matrix metalloproteinases inhibitors (MMPIs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3n2uA00
4JA1A 3WV2A 3AYUA 4J4MA 3P1VA 4WZVA 3DPEA 3GBOA 3OHOA 4L6TA 4H30A 3HBVP 2A8HA 1ZS0A 4L63A 1Y8JA 1SU3A 2MLSA 1KUKA 3ELMA 2O3EA 4DPEA 2POJA 2N8RA 1XURA 1A85A 4ILWD 3LIRA 3F1AA 3G42A 1XFUA 3SHIA 1HY7A 2J0TA 5H8XA 3O2XA 3EHYA 1QIBA 2MLRA 4IUWA 4XM6A 3P24A 4WKIA 5D1SA 2DW1A 1XFWA 4A3WA 4WK7A 3O64A 4CTHA 1B3DA 2JT6A 2OW0A 4PKWA 2OXZA 2HU6A 1R1IA 1KAPP 1UTTA 4H76A 3KWVC 1HV5A 2MZHA 1DMTA 1OS9A 1O0TA 2E3XA 1MNCA 3LJGA 3Q2HA 1GO7P 4WKEA 4L19A 2DDFA 1Y93A 1FLSA 1QJIA 2Y6CA 1MMQA 2RJPA 4FVLA 2OY2A 3LJZA 2AYKA 1GE6A 2OY4A 3LKAA 4WF6A 1JIZA 1USNA 2L0RA 4AXQA 1SRPA 1S4BP 1HFCA 1KUFA 1ZXVA 1QICA 3HBUP 3K7LA 2WO9A 5B5PA 1QJJA 5JMYA 1JJ9A 2X7MA 3USNA 456CA 1GKCA 1PWUA 1JIWP 1HOVA 4H1QA 5LABA 4AYKA 1XFYA 830CA 3KHIA 1BUDA 1HTDA 2Y6DA 1BIWA 1D8FA 1FBLA 3L0TA 3G5CA 2EROA 3VI1A 3DNGA 1SMPA 5D1UA 1D5JA 2AIGP 1EUBA 1BQOA 3WV1A 1ASTA 1O0QA 1ZXCA 2E2DA 1QIAA 1L6JA 1KUGA 2DW2A 4H49A 2D1OA 1RMZA 1A86A 1OS2A 4HX3A 4PKTA 1R54A 5L79A 3N2VA 3MA2A 4HMAA 3N2UA 3LMCA 4ZR5A 2JIHA 3AYKA 1BM6A 2QPJA 3F19A 1B8YA 2W15A 4EFSA 3BA0A 3B8ZA 3HY7A 1BZSA 1BUVM 1CIZA 2JSDA 1IACA 1KUIA 5CZMA 4R3VA 2CLTA 2XS3A 3HYGA 2USNA 1KUHA 1OM8A 1PWVA 4DD8A 5I12A 1PWPA 2DDYA 1JKYA 5CUHA 1RM8A 1I76A 3LGPA 1UMTA 3OHLA 1R1JA 1IABA 3RTTA 2SRTA 1ATLA 1XFXA 1J7NA 1JANA 1AF0A 1CGFA 3WV3A 3U1RA 1PWWA 2OXUA 1OMJA 4AIGA 3V96B 3LQ0A 2W12A 3DSLA 1C8TA 1CQRA 3LJTA 2FV5A 3I7GA 2DW0A 1Z3JA 2ERQA 4DV8A 1IADA 1G9KA 3KECA 3EDIA 3AIGA 3B92A 1D7XA 1K7GA 3L0VA 4GF1A 2OVZA 2X3BA 5I0LA 3KEKA 4ON1A 4FXYP 1MMBA 4FXQA 4XM7A 2TCLA 4PKRA 3EDGA 3F15A 4DF9A 1OM7A 2J83A 3HB2P 3TSKA 1FM1A 4FU4A 1EAKA 2JNPA 3E8RA 3LE9A 2OVXA 3UVCA 3I7IA 1XUCA 5CXAA 2O36A 5I4OA 3HY9A 1GE5A 2RJQA 1JAPA 3DPFA 4GQLA 2I47A 2KRJA 1HFSA 1GO8P 3ZUKA 1G4KA 2D1NA 4H82A 1IAEA 3EWJA 2W13A 1G49A 1I73A 4G0DA 3ZVSA 3LEAA 2PJTA 1YQYA 3LQBA 5D7WA 1H71P 3TS4A 3TVCA 5BOTA 2W14A 4H3XA 1SATA 1I1IP 1R55A 5I43A 1CGEA 3Q2GA 1AKLA 4PKQA 1C3IA 3F18A 1OM6A 1AYKA 1JH1A 4XCTA 3LIKA 1D8MA 1K7QA 2CKIA 1G05A 3LUNA 1BKCI 3HDAP 1BQQM 2JT5A 1C7KA 5B5OA 4JPAA 1BKCE 1CGLA 2XS4A 2ERPA 1Y0VA 5BOYA 4I35A 4XBHA 2Z2DA 1JAQA 1OO9A 3NX7A 2OZRA 3LUMA 1K7IA 3VTGA 4GUYA 4GR8A 3LILA 3DWBA 5D1TA 1UMSA 2FV9A 4JQGA 2K2GA 1SLMA 2V4BA 1GE7A 5D3CA 5I2ZA 3EDZA 3TT4A 1UEAA 3KEJA 1JAOA 4G9LA 4Q1LA 3ZXHA 2OXWA 4GR3A 4I03A 3CKIA 1CAQA 5BPAA 1IAAA 1EB6A 2WO8A 1UTZA 4A7BA 4JIJA 1CXVA 2YIGA 3F16A 4H2EA 1MMPA 2X3AA 1MMRA 966CA 2K9CA 1ZVXA 1BKCA 2YB9A 1IAGA 1SLNA 3KRYA 1Q3AA 1G12A 2W0DA 4PKUA 4XM8A 1YCMA 1GXDA 4H84A 2OW1A 3KMEA 3DL1A 3K7NA 4IJOA 3KMCA 2OI0A 1XUDA 4GWNA 2X3CA 5L7FA 2MZEA 1GKDA 5D2BA 1KBCA 3B2ZA 1QUAA 1WNIA 4QKZA 1PWQA 3F17A 2WOAA 4GWMA 3RTSA 5I3MA 1YOUA 2OW9A 4PKVA 4AUOA 1JK3A 1ND1A 4IN9A 1R1HA 1ZP5A 4JP4A 3LK8A 4GR0A 3EDHA 3EHXA 2OW2A 1BSWA 4PKSA 1XFZA 1XFVA 1ZTQA 1YP1A 1CK7A 1ROSA 2MZIA 3HDBA 1DTHA
chains in the Genus database with same CATH superfamily
4JA1A 3WV2A 3AYUA 4J4MA 3P1VA 4WZVA 3DPEA 3GBOA 3OHOA 4L6TA 4H30A 3HBVP 2A8HA 1ZS0A 4L63A 1Y8JA 1SU3A 2MLSA 1KUKA 3ELMA 2O3EA 4DPEA 2POJA 2N8RA 1OZ9A 1XURA 1A85A 4ILWD 3LIRA 3F1AA 3G42A 1XFUA 3SHIA 1HY7A 2J0TA 5H8XA 3O2XA 3EHYA 1QIBA 2MLRA 4IUWA 4XM6A 3P24A 4WKIA 5D1SA 2DW1A 1XFWA 4A3WA 4WK7A 3O64A 4CTHA 1B3DA 2JT6A 2OW0A 4PKWA 2OXZA 2HU6A 1R1IA 1KAPP 1UTTA 4H76A 3KWVC 1HV5A 2MZHA 1DMTA 1OS9A 1O0TA 2E3XA 1MNCA 3LJGA 3Q2HA 1GO7P 4WKEA 4L19A 2DDFA 1Y93A 1FLSA 1QJIA 2Y6CA 1MMQA 2RJPA 4FVLA 2OY2A 3LJZA 2AYKA 1GE6A 2OY4A 3LKAA 4WF6A 1JIZA 1USNA 2L0RA 4AXQA 1SRPA 1S4BP 1HFCA 1KUFA 1ZXVA 1QICA 3HBUP 3K7LA 2WO9A 5B5PA 1QJJA 5JMYA 1JJ9A 2X7MA 3USNA 456CA 1GKCA 1PWUA 1JIWP 1HOVA 4H1QA 5LABA 4AYKA 1XFYA 830CA 3KHIA 1BUDA 1HTDA 2Y6DA 1BIWA 1D8FA 1FBLA 3L0TA 3G5CA 2EROA 3VI1A 3DNGA 1SMPA 5D1UA 1D5JA 2AIGP 1EUBA 1BQOA 3WV1A 1ASTA 1O0QA 1ZXCA 2E2DA 3DTIA 1QIAA 1L6JA 1KUGA 2DW2A 4H49A 2D1OA 1RMZA 1A86A 1OS2A 4HX3A 4PKTA 1R54A 5L79A 3N2VA 3MA2A 4HMAA 3N2UA 3LMCA 4ZR5A 2JIHA 3AYKA 1BM6A 2QPJA 3F19A 1B8YA 2W15A 4EFSA 3BA0A 3DTKA 3B8ZA 3HY7A 1BZSA 1BUVM 1CIZA 2JSDA 1IACA 1KUIA 5CZMA 4R3VA 2CLTA 2XS3A 3HYGA 2USNA 1KUHA 1OM8A 1PWVA 4DD8A 5I12A 1PWPA 2DDYA 1JKYA 5CUHA 1RM8A 1I76A 3LGPA 1UMTA 3OHLA 1R1JA 1IABA 3RTTA 2SRTA 1ATLA 1XFXA 1J7NA 1JANA 1AF0A 1CGFA 3WV3A 3U1RA 1PWWA 2OXUA 1OMJA 4AIGA 3V96B 3LQ0A 2W12A 3DSLA 1C8TA 1CQRA 3LJTA 2FV5A 4L7AA 3I7GA 2DW0A 1Z3JA 2ERQA 4DV8A 1IADA 1G9KA 3KECA 3EDIA 3AIGA 3B92A 1D7XA 1K7GA 3L0VA 4GF1A 2OVZA 3DTEA 2X3BA 5I0LA 3KEKA 4ON1A 4FXYP 1MMBA 4FXQA 4XM7A 2TCLA 4PKRA 3EDGA 3F15A 4DF9A 1OM7A 2J83A 3HB2P 3TSKA 1FM1A 4FU4A 1EAKA 2JNPA 3E8RA 3LE9A 2OVXA 3UVCA 3I7IA 1XUCA 5CXAA 2O36A 5I4OA 3HY9A 1GE5A 2RJQA 1JAPA 3DPFA 4GQLA 2I47A 2KRJA 1HFSA 1GO8P 3ZUKA 1G4KA 2D1NA 4H82A 1IAEA 3EWJA 2W13A 1G49A 1I73A 4G0DA 3ZVSA 3LEAA 2PJTA 1YQYA 3LQBA 5D7WA 1H71P 3TS4A 3TVCA 5BOTA 2W14A 4H3XA 1SATA 1I1IP 1R55A 5I43A 1CGEA 2YUFA 3Q2GA 1AKLA 4PKQA 1C3IA 3F18A 1OM6A 1AYKA 1JH1A 4XCTA 3LIKA 1D8MA 1K7QA 2CKIA 1G05A 3LUNA 1BKCI 3HDAP 1BQQM 2JT5A 1C7KA 5B5OA 4JPAA 1BKCE 1CGLA 2XS4A 2ERPA 1Y0VA 5BOYA 4I35A 4XBHA 1TVIA 2Z2DA 1JAQA 1OO9A 3NX7A 2OZRA 3LUMA 1K7IA 3VTGA 4GUYA 4GR8A 3LILA 3DWBA 5D1TA 1UMSA 2FV9A 4JQGA 2K2GA 1SLMA 2V4BA 1GE7A 5D3CA 5I2ZA 3EDZA 1XM5A 3TT4A 1UEAA 3KEJA 1JAOA 4G9LA 4Q1LA 3ZXHA 2OXWA 4GR3A 4I03A 3CKIA 1CAQA 5BPAA 1IAAA 1EB6A 2WO8A 1UTZA 4A7BA 4JIJA 1CXVA 2YIGA 3F16A 4H2EA 1MMPA 2X3AA 1MMRA 966CA 2K9CA 1ZVXA 1BKCA 2YB9A 1IAGA 1SLNA 3KRYA 1Q3AA 1G12A 2W0DA 4PKUA 4XM8A 1YCMA 1GXDA 4H84A 2OW1A 3KMEA 3DL1A 3K7NA 4IJOA 3KMCA 2OI0A 1XUDA 4GWNA 2X3CA 5L7FA 2MZEA 1GKDA 5D2BA 1KBCA 3B2ZA 1QUAA 1WNIA 4QKZA 1PWQA 3F17A 2WOAA 4GWMA 3RTSA 5I3MA 1YOUA 2OW9A 4PKVA 4AUOA 1JK3A 1ND1A 4IN9A 1R1HA 1ZP5A 4JP4A 3LK8A 4GR0A 3EDHA 3EHXA 2OW2A 1BSWA 4PKSA 1XFZA 1XFVA 1ZTQA 1YP1A 1CK7A 1ROSA 2MZIA 3HDBA 1XAXA 1DTHA
chains in the Genus database with same CATH topology
4JA1A 3WV2A 3AYUA 4J4MA 3P1VA 4WZVA 3DPEA 3GBOA 3OHOA 4L6TA 4H30A 3HBVP 2A8HA 1ZS0A 4L63A 1Y8JA 1SU3A 2MLSA 1KUKA 3ELMA 2O3EA 4DPEA 2POJA 2N8RA 1XURA 1A85A 4ILWD 3LIRA 3F1AA 3G42A 1XFUA 3SHIA 1HY7A 2J0TA 5H8XA 3O2XA 3EHYA 1QIBA 2MLRA 4IUWA 4XM6A 3P24A 4WKIA 5D1SA 2DW1A 1XFWA 4A3WA 4WK7A 3O64A 4CTHA 1B3DA 2JT6A 2OW0A 4PKWA 2OXZA 2HU6A 1R1IA 1KAPP 1UTTA 4H76A 3KWVC 1HV5A 2MZHA 1DMTA 1OS9A 1O0TA 2E3XA 1MNCA 3LJGA 3Q2HA 1GO7P 4WKEA 4L19A 2DDFA 1Y93A 1FLSA 1QJIA 2Y6CA 1MMQA 2RJPA 4FVLA 2OY2A 3LJZA 2AYKA 1GE6A 2OY4A 3LKAA 4WF6A 1JIZA 1USNA 2L0RA 4AXQA 1SRPA 1S4BP 1HFCA 1KUFA 1ZXVA 1QICA 3HBUP 3K7LA 2WO9A 5B5PA 1QJJA 5JMYA 1JJ9A 2X7MA 3USNA 456CA 1GKCA 1PWUA 1JIWP 1HOVA 4H1QA 5LABA 4AYKA 1XFYA 830CA 3KHIA 1BUDA 1HTDA 2Y6DA 1BIWA 1D8FA 1FBLA 3L0TA 3G5CA 2EROA 3VI1A 3DNGA 1SMPA 5D1UA 1D5JA 2AIGP 1EUBA 1BQOA 3WV1A 1ASTA 1O0QA 1ZXCA 2E2DA 3DTIA 1QIAA 1L6JA 1KUGA 2DW2A 4H49A 2D1OA 1RMZA 1A86A 1OS2A 4HX3A 4PKTA 1R54A 5L79A 3N2VA 3MA2A 4HMAA 3N2UA 3LMCA 4ZR5A 2JIHA 3AYKA 1BM6A 2QPJA 3F19A 1B8YA 2W15A 4EFSA 3BA0A 3DTKA 3B8ZA 3HY7A 1BZSA 1BUVM 1CIZA 2JSDA 1IACA 1KUIA 5CZMA 4R3VA 2CLTA 2XS3A 3HYGA 2USNA 1KUHA 1OM8A 1PWVA 4DD8A 5I12A 1PWPA 2DDYA 1JKYA 5CUHA 1RM8A 1I76A 3LGPA 1UMTA 3OHLA 1R1JA 1IABA 3RTTA 2SRTA 1ATLA 1XFXA 1J7NA 1JANA 1AF0A 1CGFA 3WV3A 3U1RA 1PWWA 2OXUA 1OMJA 4AIGA 3V96B 3LQ0A 2W12A 3DSLA 1C8TA 1CQRA 3LJTA 2FV5A 4L7AA 3I7GA 2DW0A 1Z3JA 2ERQA 4DV8A 1IADA 1G9KA 3KECA 3EDIA 3AIGA 3B92A 1D7XA 1K7GA 3L0VA 4GF1A 2OVZA 3DTEA 2X3BA 5I0LA 3KEKA 4ON1A 4FXYP 1MMBA 4FXQA 4XM7A 2TCLA 4PKRA 3EDGA 3F15A 4DF9A 1OM7A 2J83A 3HB2P 3TSKA 1FM1A 4FU4A 1EAKA 2JNPA 3E8RA 3LE9A 2OVXA 3UVCA 3I7IA 1XUCA 5CXAA 2O36A 5I4OA 3HY9A 1GE5A 2RJQA 1JAPA 3DPFA 4GQLA 2I47A 2KRJA 1HFSA 1GO8P 3ZUKA 1G4KA 2D1NA 4H82A 1IAEA 3EWJA 2W13A 1G49A 1I73A 4G0DA 3ZVSA 3LEAA 2PJTA 1YQYA 3LQBA 5D7WA 1H71P 3TS4A 3TVCA 5BOTA 2W14A 4H3XA 1SATA 1I1IP 1R55A 5I43A 1CGEA 2YUFA 3Q2GA 1AKLA 4PKQA 1C3IA 3F18A 1OM6A 1AYKA 1JH1A 4XCTA 3LIKA 1D8MA 1K7QA 2CKIA 1G05A 3LUNA 1BKCI 3HDAP 1BQQM 2JT5A 1C7KA 5B5OA 4JPAA 1BKCE 1CGLA 2XS4A 2ERPA 1Y0VA 5BOYA 4I35A 4XBHA 2Z2DA 1JAQA 1OO9A 3NX7A 2OZRA 3LUMA 1K7IA 3VTGA 4GUYA 4GR8A 3LILA 3DWBA 5D1TA 1UMSA 2FV9A 4JQGA 2K2GA 1SLMA 2V4BA 1GE7A 5D3CA 5I2ZA 3EDZA 3TT4A 1UEAA 3KEJA 1JAOA 4G9LA 4Q1LA 3ZXHA 2OXWA 4GR3A 4I03A 3CKIA 1CAQA 5BPAA 1IAAA 1EB6A 2WO8A 1UTZA 4A7BA 4JIJA 1CXVA 2YIGA 3F16A 4H2EA 1MMPA 2X3AA 1MMRA 966CA 2K9CA 1ZVXA 1BKCA 2YB9A 1IAGA 1SLNA 3KRYA 1Q3AA 1G12A 2W0DA 4PKUA 4XM8A 1YCMA 1GXDA 4H84A 2OW1A 3KMEA 3DL1A 3K7NA 4IJOA 3KMCA 2OI0A 1XUDA 4GWNA 2X3CA 5L7FA 2MZEA 1GKDA 5D2BA 1KBCA 3B2ZA 1QUAA 1WNIA 4QKZA 1PWQA 3F17A 2WOAA 4GWMA 3RTSA 5I3MA 1YOUA 2OW9A 4PKVA 4AUOA 1JK3A 1ND1A 4IN9A 1R1HA 1ZP5A 4JP4A 3LK8A 4GR0A 3EDHA 3EHXA 2OW2A 1BSWA 4PKSA 1XFZA 1XFVA 1ZTQA 1YP1A 1CK7A 1ROSA 2MZIA 3HDBA 1DTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JA1 A;  3WV2 A;  3AYU A;  4J4M A;  3P1V A;  4WZV A;  3DPE A;  3GBO A;  3OHO A;  4L6T A;  4H30 A;  3HBV P;  2A8H A;  1ZS0 A;  4L63 A;  1Y8J A;  1SU3 A;  2MLS A;  1KUK A;  3ELM A;  2O3E A;  4DPE A;  2POJ A;  2N8R A;  1XUR A;  1A85 A;  4ILW D;  3LIR A;  3F1A A;  3G42 A;  1XFU A;  3SHI A;  1HY7 A;  2J0T A;  5H8X A;  3O2X A;  3EHY A;  1QIB A;  2MLR A;  4IUW A;  4XM6 A;  3P24 A;  4WKI A;  5D1S A;  2DW1 A;  1XFW A;  4A3W A;  4WK7 A;  3O64 A;  4CTH A;  1B3D A;  2JT6 A;  2OW0 A;  4PKW A;  2OXZ A;  2HU6 A;  1R1I A;  1KAP P;  1UTT A;  4H76 A;  3KWV C;  1HV5 A;  2MZH A;  1DMT A;  1OS9 A;  1O0T A;  2E3X A;  1MNC A;  3LJG A;  3Q2H A;  1GO7 P;  4WKE A;  4L19 A;  2DDF A;  1Y93 A;  1FLS A;  1QJI A;  2Y6C A;  1MMQ A;  2RJP A;  4FVL A;  2OY2 A;  3LJZ A;  2AYK A;  1GE6 A;  2OY4 A;  3LKA A;  4WF6 A;  1JIZ A;  1USN A;  2L0R A;  4AXQ A;  1SRP A;  1S4B P;  1HFC A;  1KUF A;  1ZXV A;  1QIC A;  3HBU P;  3K7L A;  2WO9 A;  5B5P A;  1QJJ A;  5JMY A;  1JJ9 A;  2X7M A;  3USN A;  456C A;  1GKC A;  1PWU A;  1JIW P;  1HOV A;  4H1Q A;  5LAB A;  4AYK A;  1XFY A;  830C A;  3KHI A;  1BUD A;  1HTD A;  2Y6D A;  1BIW A;  1D8F A;  1FBL A;  3L0T A;  3G5C A;  2ERO A;  3VI1 A;  3DNG A;  1SMP A;  5D1U A;  1D5J A;  2AIG P;  1EUB A;  1BQO A;  3WV1 A;  1AST A;  1O0Q A;  1ZXC A;  2E2D A;  1QIA A;  1L6J A;  1KUG A;  2DW2 A;  4H49 A;  2D1O A;  1RMZ A;  1A86 A;  1OS2 A;  4HX3 A;  4PKT A;  1R54 A;  5L79 A;  3N2V A;  3MA2 A;  4HMA A;  3N2U A;  3LMC A;  4ZR5 A;  2JIH A;  3AYK A;  1BM6 A;  2QPJ A;  3F19 A;  1B8Y A;  2W15 A;  4EFS A;  3BA0 A;  3B8Z A;  3HY7 A;  1BZS A;  1BUV M;  1CIZ A;  2JSD A;  1IAC A;  1KUI A;  5CZM A;  4R3V A;  2CLT A;  2XS3 A;  3HYG A;  2USN A;  1KUH A;  1OM8 A;  1PWV A;  4DD8 A;  5I12 A;  1PWP A;  2DDY A;  1JKY A;  5CUH A;  1RM8 A;  1I76 A;  3LGP A;  1UMT A;  3OHL A;  1R1J A;  1IAB A;  3RTT A;  2SRT A;  1ATL A;  1XFX A;  1J7N A;  1JAN A;  1AF0 A;  1CGF A;  3WV3 A;  3U1R A;  1PWW A;  2OXU A;  1OMJ A;  4AIG A;  3V96 B;  3LQ0 A;  2W12 A;  3DSL A;  1C8T A;  1CQR A;  3LJT A;  2FV5 A;  3I7G A;  2DW0 A;  1Z3J A;  2ERQ A;  4DV8 A;  1IAD A;  1G9K A;  3KEC A;  3EDI A;  3AIG A;  3B92 A;  1D7X A;  1K7G A;  3L0V A;  4GF1 A;  2OVZ A;  2X3B A;  5I0L A;  3KEK A;  4ON1 A;  4FXY P;  1MMB A;  4FXQ A;  4XM7 A;  2TCL A;  4PKR A;  3EDG A;  3F15 A;  4DF9 A;  1OM7 A;  2J83 A;  3HB2 P;  3TSK A;  1FM1 A;  4FU4 A;  1EAK A;  2JNP A;  3E8R A;  3LE9 A;  2OVX A;  3UVC A;  3I7I A;  1XUC A;  5CXA A;  2O36 A;  5I4O A;  3HY9 A;  1GE5 A;  2RJQ A;  1JAP A;  3DPF A;  4GQL A;  2I47 A;  2KRJ A;  1HFS A;  1GO8 P;  3ZUK A;  1G4K A;  2D1N A;  4H82 A;  1IAE A;  3EWJ A;  2W13 A;  1G49 A;  1I73 A;  4G0D A;  3ZVS A;  3LEA A;  2PJT A;  1YQY A;  3LQB A;  5D7W A;  1H71 P;  3TS4 A;  3TVC A;  5BOT A;  2W14 A;  4H3X A;  1SAT A;  1I1I P;  1R55 A;  5I43 A;  1CGE A;  3Q2G A;  1AKL A;  4PKQ A;  1C3I A;  3F18 A;  1OM6 A;  1AYK A;  1JH1 A;  4XCT A;  3LIK A;  1D8M A;  1K7Q A;  2CKI A;  1G05 A;  3LUN A;  1BKC I;  3HDA P;  1BQQ M;  2JT5 A;  1C7K A;  5B5O A;  4JPA A;  1BKC E;  1CGL A;  2XS4 A;  2ERP A;  1Y0V A;  5BOY A;  4I35 A;  4XBH A;  2Z2D A;  1JAQ A;  1OO9 A;  3NX7 A;  2OZR A;  3LUM A;  1K7I A;  3VTG A;  4GUY A;  4GR8 A;  3LIL A;  3DWB A;  5D1T A;  1UMS A;  2FV9 A;  4JQG A;  2K2G A;  1SLM A;  2V4B A;  1GE7 A;  5D3C A;  5I2Z A;  3EDZ A;  3TT4 A;  1UEA A;  3KEJ A;  1JAO A;  4G9L A;  4Q1L A;  3ZXH A;  2OXW A;  4GR3 A;  4I03 A;  3CKI A;  1CAQ A;  5BPA A;  1IAA A;  1EB6 A;  2WO8 A;  1UTZ A;  4A7B A;  4JIJ A;  1CXV A;  2YIG A;  3F16 A;  4H2E A;  1MMP A;  2X3A A;  1MMR A;  966C A;  2K9C A;  1ZVX A;  1BKC A;  2YB9 A;  1IAG A;  1SLN A;  3KRY A;  1Q3A A;  1G12 A;  2W0D A;  4PKU A;  4XM8 A;  1YCM A;  1GXD A;  4H84 A;  2OW1 A;  3KME A;  3DL1 A;  3K7N A;  4IJO A;  3KMC A;  2OI0 A;  1XUD A;  4GWN A;  2X3C A;  5L7F A;  2MZE A;  1GKD A;  5D2B A;  1KBC A;  3B2Z A;  1QUA A;  1WNI A;  4QKZ A;  1PWQ A;  3F17 A;  2WOA A;  4GWM A;  3RTS A;  5I3M A;  1YOU A;  2OW9 A;  4PKV A;  4AUO A;  1JK3 A;  1ND1 A;  4IN9 A;  1R1H A;  1ZP5 A;  4JP4 A;  3LK8 A;  4GR0 A;  3EDH A;  3EHX A;  2OW2 A;  1BSW A;  4PKS A;  1XFZ A;  1XFV A;  1ZTQ A;  1YP1 A;  1CK7 A;  1ROS A;  2MZI A;  3HDB A;  1DTH A; 
#chains in the Genus database with same CATH topology
 4JA1 A;  3WV2 A;  3AYU A;  4J4M A;  3P1V A;  4WZV A;  3DPE A;  3GBO A;  3OHO A;  4L6T A;  4H30 A;  3HBV P;  2A8H A;  1ZS0 A;  4L63 A;  1Y8J A;  1SU3 A;  2MLS A;  1KUK A;  3ELM A;  2O3E A;  4DPE A;  2POJ A;  2N8R A;  1OZ9 A;  1XUR A;  1A85 A;  4ILW D;  3LIR A;  3F1A A;  3G42 A;  1XFU A;  3SHI A;  1HY7 A;  2J0T A;  5H8X A;  3O2X A;  3EHY A;  1QIB A;  2MLR A;  4IUW A;  4XM6 A;  3P24 A;  4WKI A;  5D1S A;  2DW1 A;  1XFW A;  4A3W A;  4WK7 A;  3O64 A;  4CTH A;  1B3D A;  2JT6 A;  2OW0 A;  4PKW A;  2OXZ A;  2HU6 A;  1R1I A;  1KAP P;  1UTT A;  4H76 A;  3KWV C;  1HV5 A;  2MZH A;  1DMT A;  1OS9 A;  1O0T A;  2E3X A;  1MNC A;  3LJG A;  3Q2H A;  1GO7 P;  4WKE A;  4L19 A;  2DDF A;  1Y93 A;  1FLS A;  1QJI A;  2Y6C A;  1MMQ A;  2RJP A;  4FVL A;  2OY2 A;  3LJZ A;  2AYK A;  1GE6 A;  2OY4 A;  3LKA A;  4WF6 A;  1JIZ A;  1USN A;  2L0R A;  4AXQ A;  1SRP A;  1S4B P;  1HFC A;  1KUF A;  1ZXV A;  1QIC A;  3HBU P;  3K7L A;  2WO9 A;  5B5P A;  1QJJ A;  5JMY A;  1JJ9 A;  2X7M A;  3USN A;  456C A;  1GKC A;  1PWU A;  1JIW P;  1HOV A;  4H1Q A;  5LAB A;  4AYK A;  1XFY A;  830C A;  3KHI A;  1BUD A;  1HTD A;  2Y6D A;  1BIW A;  1D8F A;  1FBL A;  3L0T A;  3G5C A;  2ERO A;  3VI1 A;  3DNG A;  1SMP A;  5D1U A;  1D5J A;  2AIG P;  1EUB A;  1BQO A;  3WV1 A;  1AST A;  1O0Q A;  1ZXC A;  2E2D A;  3DTI A;  1QIA A;  1L6J A;  1KUG A;  2DW2 A;  4H49 A;  2D1O A;  1RMZ A;  1A86 A;  1OS2 A;  4HX3 A;  4PKT A;  1R54 A;  5L79 A;  3N2V A;  3MA2 A;  4HMA A;  3N2U A;  3LMC A;  4ZR5 A;  2JIH A;  3AYK A;  1BM6 A;  2QPJ A;  3F19 A;  1B8Y A;  2W15 A;  4EFS A;  3BA0 A;  3DTK A;  3B8Z A;  3HY7 A;  1BZS A;  1BUV M;  1CIZ A;  2JSD A;  1IAC A;  1KUI A;  5CZM A;  4R3V A;  2CLT A;  2XS3 A;  3HYG A;  2USN A;  1KUH A;  1OM8 A;  1PWV A;  4DD8 A;  5I12 A;  1PWP A;  2DDY A;  1JKY A;  5CUH A;  1RM8 A;  1I76 A;  3LGP A;  1UMT A;  3OHL A;  1R1J A;  1IAB A;  3RTT A;  2SRT A;  1ATL A;  1XFX A;  1J7N A;  1JAN A;  1AF0 A;  1CGF A;  3WV3 A;  3U1R A;  1PWW A;  2OXU A;  1OMJ A;  4AIG A;  3V96 B;  3LQ0 A;  2W12 A;  3DSL A;  1C8T A;  1CQR A;  3LJT A;  2FV5 A;  4L7A A;  3I7G A;  2DW0 A;  1Z3J A;  2ERQ A;  4DV8 A;  1IAD A;  1G9K A;  3KEC A;  3EDI A;  3AIG A;  3B92 A;  1D7X A;  1K7G A;  3L0V A;  4GF1 A;  2OVZ A;  3DTE A;  2X3B A;  5I0L A;  3KEK A;  4ON1 A;  4FXY P;  1MMB A;  4FXQ A;  4XM7 A;  2TCL A;  4PKR A;  3EDG A;  3F15 A;  4DF9 A;  1OM7 A;  2J83 A;  3HB2 P;  3TSK A;  1FM1 A;  4FU4 A;  1EAK A;  2JNP A;  3E8R A;  3LE9 A;  2OVX A;  3UVC A;  3I7I A;  1XUC A;  5CXA A;  2O36 A;  5I4O A;  3HY9 A;  1GE5 A;  2RJQ A;  1JAP A;  3DPF A;  4GQL A;  2I47 A;  2KRJ A;  1HFS A;  1GO8 P;  3ZUK A;  1G4K A;  2D1N A;  4H82 A;  1IAE A;  3EWJ A;  2W13 A;  1G49 A;  1I73 A;  4G0D A;  3ZVS A;  3LEA A;  2PJT A;  1YQY A;  3LQB A;  5D7W A;  1H71 P;  3TS4 A;  3TVC A;  5BOT A;  2W14 A;  4H3X A;  1SAT A;  1I1I P;  1R55 A;  5I43 A;  1CGE A;  2YUF A;  3Q2G A;  1AKL A;  4PKQ A;  1C3I A;  3F18 A;  1OM6 A;  1AYK A;  1JH1 A;  4XCT A;  3LIK A;  1D8M A;  1K7Q A;  2CKI A;  1G05 A;  3LUN A;  1BKC I;  3HDA P;  1BQQ M;  2JT5 A;  1C7K A;  5B5O A;  4JPA A;  1BKC E;  1CGL A;  2XS4 A;  2ERP A;  1Y0V A;  5BOY A;  4I35 A;  4XBH A;  1TVI A;  2Z2D A;  1JAQ A;  1OO9 A;  3NX7 A;  2OZR A;  3LUM A;  1K7I A;  3VTG A;  4GUY A;  4GR8 A;  3LIL A;  3DWB A;  5D1T A;  1UMS A;  2FV9 A;  4JQG A;  2K2G A;  1SLM A;  2V4B A;  1GE7 A;  5D3C A;  5I2Z A;  3EDZ A;  1XM5 A;  3TT4 A;  1UEA A;  3KEJ A;  1JAO A;  4G9L A;  4Q1L A;  3ZXH A;  2OXW A;  4GR3 A;  4I03 A;  3CKI A;  1CAQ A;  5BPA A;  1IAA A;  1EB6 A;  2WO8 A;  1UTZ A;  4A7B A;  4JIJ A;  1CXV A;  2YIG A;  3F16 A;  4H2E A;  1MMP A;  2X3A A;  1MMR A;  966C A;  2K9C A;  1ZVX A;  1BKC A;  2YB9 A;  1IAG A;  1SLN A;  3KRY A;  1Q3A A;  1G12 A;  2W0D A;  4PKU A;  4XM8 A;  1YCM A;  1GXD A;  4H84 A;  2OW1 A;  3KME A;  3DL1 A;  3K7N A;  4IJO A;  3KMC A;  2OI0 A;  1XUD A;  4GWN A;  2X3C A;  5L7F A;  2MZE A;  1GKD A;  5D2B A;  1KBC A;  3B2Z A;  1QUA A;  1WNI A;  4QKZ A;  1PWQ A;  3F17 A;  2WOA A;  4GWM A;  3RTS A;  5I3M A;  1YOU A;  2OW9 A;  4PKV A;  4AUO A;  1JK3 A;  1ND1 A;  4IN9 A;  1R1H A;  1ZP5 A;  4JP4 A;  3LK8 A;  4GR0 A;  3EDH A;  3EHX A;  2OW2 A;  1BSW A;  4PKS A;  1XFZ A;  1XFV A;  1ZTQ A;  1YP1 A;  1CK7 A;  1ROS A;  2MZI A;  3HDB A;  1XAX A;  1DTH A; 
#chains in the Genus database with same CATH homology
 4JA1 A;  3WV2 A;  3AYU A;  4J4M A;  3P1V A;  4WZV A;  3DPE A;  3GBO A;  3OHO A;  4L6T A;  4H30 A;  3HBV P;  2A8H A;  1ZS0 A;  4L63 A;  1Y8J A;  1SU3 A;  2MLS A;  1KUK A;  3ELM A;  2O3E A;  4DPE A;  2POJ A;  2N8R A;  1XUR A;  1A85 A;  4ILW D;  3LIR A;  3F1A A;  3G42 A;  1XFU A;  3SHI A;  1HY7 A;  2J0T A;  5H8X A;  3O2X A;  3EHY A;  1QIB A;  2MLR A;  4IUW A;  4XM6 A;  3P24 A;  4WKI A;  5D1S A;  2DW1 A;  1XFW A;  4A3W A;  4WK7 A;  3O64 A;  4CTH A;  1B3D A;  2JT6 A;  2OW0 A;  4PKW A;  2OXZ A;  2HU6 A;  1R1I A;  1KAP P;  1UTT A;  4H76 A;  3KWV C;  1HV5 A;  2MZH A;  1DMT A;  1OS9 A;  1O0T A;  2E3X A;  1MNC A;  3LJG A;  3Q2H A;  1GO7 P;  4WKE A;  4L19 A;  2DDF A;  1Y93 A;  1FLS A;  1QJI A;  2Y6C A;  1MMQ A;  2RJP A;  4FVL A;  2OY2 A;  3LJZ A;  2AYK A;  1GE6 A;  2OY4 A;  3LKA A;  4WF6 A;  1JIZ A;  1USN A;  2L0R A;  4AXQ A;  1SRP A;  1S4B P;  1HFC A;  1KUF A;  1ZXV A;  1QIC A;  3HBU P;  3K7L A;  2WO9 A;  5B5P A;  1QJJ A;  5JMY A;  1JJ9 A;  2X7M A;  3USN A;  456C A;  1GKC A;  1PWU A;  1JIW P;  1HOV A;  4H1Q A;  5LAB A;  4AYK A;  1XFY A;  830C A;  3KHI A;  1BUD A;  1HTD A;  2Y6D A;  1BIW A;  1D8F A;  1FBL A;  3L0T A;  3G5C A;  2ERO A;  3VI1 A;  3DNG A;  1SMP A;  5D1U A;  1D5J A;  2AIG P;  1EUB A;  1BQO A;  3WV1 A;  1AST A;  1O0Q A;  1ZXC A;  2E2D A;  3DTI A;  1QIA A;  1L6J A;  1KUG A;  2DW2 A;  4H49 A;  2D1O A;  1RMZ A;  1A86 A;  1OS2 A;  4HX3 A;  4PKT A;  1R54 A;  5L79 A;  3N2V A;  3MA2 A;  4HMA A;  3N2U A;  3LMC A;  4ZR5 A;  2JIH A;  3AYK A;  1BM6 A;  2QPJ A;  3F19 A;  1B8Y A;  2W15 A;  4EFS A;  3BA0 A;  3DTK A;  3B8Z A;  3HY7 A;  1BZS A;  1BUV M;  1CIZ A;  2JSD A;  1IAC A;  1KUI A;  5CZM A;  4R3V A;  2CLT A;  2XS3 A;  3HYG A;  2USN A;  1KUH A;  1OM8 A;  1PWV A;  4DD8 A;  5I12 A;  1PWP A;  2DDY A;  1JKY A;  5CUH A;  1RM8 A;  1I76 A;  3LGP A;  1UMT A;  3OHL A;  1R1J A;  1IAB A;  3RTT A;  2SRT A;  1ATL A;  1XFX A;  1J7N A;  1JAN A;  1AF0 A;  1CGF A;  3WV3 A;  3U1R A;  1PWW A;  2OXU A;  1OMJ A;  4AIG A;  3V96 B;  3LQ0 A;  2W12 A;  3DSL A;  1C8T A;  1CQR A;  3LJT A;  2FV5 A;  4L7A A;  3I7G A;  2DW0 A;  1Z3J A;  2ERQ A;  4DV8 A;  1IAD A;  1G9K A;  3KEC A;  3EDI A;  3AIG A;  3B92 A;  1D7X A;  1K7G A;  3L0V A;  4GF1 A;  2OVZ A;  3DTE A;  2X3B A;  5I0L A;  3KEK A;  4ON1 A;  4FXY P;  1MMB A;  4FXQ A;  4XM7 A;  2TCL A;  4PKR A;  3EDG A;  3F15 A;  4DF9 A;  1OM7 A;  2J83 A;  3HB2 P;  3TSK A;  1FM1 A;  4FU4 A;  1EAK A;  2JNP A;  3E8R A;  3LE9 A;  2OVX A;  3UVC A;  3I7I A;  1XUC A;  5CXA A;  2O36 A;  5I4O A;  3HY9 A;  1GE5 A;  2RJQ A;  1JAP A;  3DPF A;  4GQL A;  2I47 A;  2KRJ A;  1HFS A;  1GO8 P;  3ZUK A;  1G4K A;  2D1N A;  4H82 A;  1IAE A;  3EWJ A;  2W13 A;  1G49 A;  1I73 A;  4G0D A;  3ZVS A;  3LEA A;  2PJT A;  1YQY A;  3LQB A;  5D7W A;  1H71 P;  3TS4 A;  3TVC A;  5BOT A;  2W14 A;  4H3X A;  1SAT A;  1I1I P;  1R55 A;  5I43 A;  1CGE A;  2YUF A;  3Q2G A;  1AKL A;  4PKQ A;  1C3I A;  3F18 A;  1OM6 A;  1AYK A;  1JH1 A;  4XCT A;  3LIK A;  1D8M A;  1K7Q A;  2CKI A;  1G05 A;  3LUN A;  1BKC I;  3HDA P;  1BQQ M;  2JT5 A;  1C7K A;  5B5O A;  4JPA A;  1BKC E;  1CGL A;  2XS4 A;  2ERP A;  1Y0V A;  5BOY A;  4I35 A;  4XBH A;  2Z2D A;  1JAQ A;  1OO9 A;  3NX7 A;  2OZR A;  3LUM A;  1K7I A;  3VTG A;  4GUY A;  4GR8 A;  3LIL A;  3DWB A;  5D1T A;  1UMS A;  2FV9 A;  4JQG A;  2K2G A;  1SLM A;  2V4B A;  1GE7 A;  5D3C A;  5I2Z A;  3EDZ A;  3TT4 A;  1UEA A;  3KEJ A;  1JAO A;  4G9L A;  4Q1L A;  3ZXH A;  2OXW A;  4GR3 A;  4I03 A;  3CKI A;  1CAQ A;  5BPA A;  1IAA A;  1EB6 A;  2WO8 A;  1UTZ A;  4A7B A;  4JIJ A;  1CXV A;  2YIG A;  3F16 A;  4H2E A;  1MMP A;  2X3A A;  1MMR A;  966C A;  2K9C A;  1ZVX A;  1BKC A;  2YB9 A;  1IAG A;  1SLN A;  3KRY A;  1Q3A A;  1G12 A;  2W0D A;  4PKU A;  4XM8 A;  1YCM A;  1GXD A;  4H84 A;  2OW1 A;  3KME A;  3DL1 A;  3K7N A;  4IJO A;  3KMC A;  2OI0 A;  1XUD A;  4GWN A;  2X3C A;  5L7F A;  2MZE A;  1GKD A;  5D2B A;  1KBC A;  3B2Z A;  1QUA A;  1WNI A;  4QKZ A;  1PWQ A;  3F17 A;  2WOA A;  4GWM A;  3RTS A;  5I3M A;  1YOU A;  2OW9 A;  4PKV A;  4AUO A;  1JK3 A;  1ND1 A;  4IN9 A;  1R1H A;  1ZP5 A;  4JP4 A;  3LK8 A;  4GR0 A;  3EDH A;  3EHX A;  2OW2 A;  1BSW A;  4PKS A;  1XFZ A;  1XFV A;  1ZTQ A;  1YP1 A;  1CK7 A;  1ROS A;  2MZI A;  3HDB A;  1DTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...