1OS2A

Ternary enzyme-product-inhibitor complexes of human mmp12
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
165
structure length
165
Chain Sequence
MMGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title X-ray Structures of Binary and Ternary Enzyme-Product-Inhibitor Complexes of Matrix Metalloproteinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 42
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1os2A00
1FLSA 2MLSA 1JAOA 2OY4A 2E2DA 1BM6A 1QJJA 4GF1A 2XS3A 1GE7A 2A8HA 3KWVC 1SLMA 3L0VA 4A3WA 2OZRA 3DSLA 3VTGA 4PKRA 3KMEA 5BPAA 1BUDA 1JIZA 4XM7A 1IAAA 1HY7A 4GWNA 4H82A 3B92A 2CLTA 2RJPA 4Q1LA 1YQYA 1MMQA 2D1NA 4WKIA 5I43A 4DD8A 1IABA 2OW2A 1XFWA 3P1VA 4JP4A 3DL1A 1BUVM 2W14A 1J7NA 3K7NA 1MMPA 1R55A 1L6JA 3GBOA 1ASTA 1CGEA 3EDGA 4H30A 4JPAA 4WK7A 2JNPA 2DW1A 4PKUA 4HX3A 1DMTA 1QJIA 1G05A 1CGFA 2JT5A 3VI1A 1DTHA 3TSKA 1OM7A 3BA0A 3F1AA 3E8RA 1UTTA 3B8ZA 1FM1A 1YCMA 1OO9A 1Y0VA 1BKCI 2W15A 3LIRA 3O2XA 2OW9A 2USNA 1MNCA 5D1SA 5I3MA 1K7QA 1WNIA 2DDYA 1K7IA 1GE5A 2AIGP 4H49A 456CA 2SRTA 3Q2GA 4HMAA 1OS9A 1CAQA 4I35A 4AIGA 4DF9A 4EFSA 1GO7P 1CK7A 3KRYA 1Z3JA 1XFYA 5CXAA 5D2BA 5LABA 2POJA 3EHXA 3F15A 2OW0A 1XFXA 5B5OA 1ZVXA 3OHLA 4FXQA 1JANA 1KUFA 3WV2A 1PWPA 1PWQA 1EAKA 3LKAA 3F19A 1SMPA 4A7BA 2TCLA 3SHIA 1AF0A 3HDAP 3LE9A 3UVCA 4JIJA 1BZSA 3Q2HA 2Y6CA 3ZVSA 1G49A 1I73A 2DW2A 4I03A 2OI0A 3DPEA 3NX7A 2OW1A 3AYKA 2J83A 1EB6A 4J4MA 3EDZA 4L63A 1O0QA 3EDHA 1JK3A 3DNGA 1B8YA 1A86A 1SU3A 3LUMA 5D3CA 4DV8A 3LMCA 3OHOA 4XM8A 3N2VA 2L0RA 4ILWD 5H8XA 3KMCA 1BQOA 1R1JA 4H2EA 4G0DA 4QKZA 2X3CA 3LUNA 3LJTA 1ROSA 2JT6A 1SLNA 5L7FA 3G5CA 2K2GA 1YP1A 3MA2A 2DW0A 1EUBA 1XUDA 3P24A 2X7MA 3LGPA 1XUCA 3EHYA 4GQLA 1G12A 1JAPA 3ELMA 3LQ0A 3HBVP 1IAEA 2FV5A 2MZHA 4H84A 3RTSA 5I12A 2CKIA 3TT4A 1KUIA 2WO9A 1QICA 2OXWA 1OMJA 3HB2P 4IN9A 3DWBA 1JH1A 2PJTA 4PKQA 3HYGA 4JA1A 5I2ZA 2O3EA 4G9LA 3KEJA 4ON1A 1JAQA 1JIWP 1K7GA 1C7KA 1HV5A 1OM8A 1KUHA 3ZUKA 1XFUA 5JMYA 4XBHA 1MMBA 4XCTA 3USNA 4AYKA 1XFZA 1ZXCA 2AYKA 1CQRA 5CZMA 1R1IA 4WZVA 3F17A 2O36A 4CTHA 1A85A 2MLRA 3KEKA 1C8TA 1KAPP 1Y93A 1AYKA 2RJQA 4GR3A 4AXQA 1PWVA 1UEAA 1CGLA 1MMRA 1PWWA 2W12A 3G42A 1D7XA 4GR0A 1OS2A 1ZS0A 4L19A 1YOUA 1C3IA 1S4BP 3KHIA 3CKIA 1Q3AA 1H71P 4AUOA 1PWUA 1QIBA 4IUWA 3LILA 1CXVA 1ZXVA 1I76A 3TS4A 4PKSA 3LK8A 1GKDA 2JIHA 3LIKA 3LQBA 2MZEA 1GXDA 4PKTA 2W13A 1AKLA 1OM6A 1G9KA 1B3DA 2OXZA 2J0TA 4PKVA 1BKCA 1R54A 3AYUA 5I0LA 1IADA 1IAGA 5B5PA 3LEAA 1GO8P 3HY9A 3O64A 1RMZA 3RTTA 1HFCA 1HFSA 1SATA 1D8MA 2OVXA 1GE6A 1QUAA 1GKCA 1I1IP 4FVLA 1KUGA 1USNA 3LJZA 2X3AA 3DPFA 3KECA 4GWMA 4H1QA 3U1RA 3F18A 1ATLA 1XFVA 2ERPA 1UMTA 1RM8A 1BSWA 3I7GA 5L79A 2YIGA 3B2ZA 2OY2A 1HTDA 5BOYA 1ZP5A 4JQGA 3N2UA 1R1HA 3HDBA 3AIGA 1O0TA 2XS4A 1D8FA 1JKYA 2JSDA 3K7LA 2WO8A 1KUKA 2I47A 2OXUA 4R3VA 4H3XA 2N8RA 3F16A 4FXYP 5I4OA 4XM6A 1JJ9A 5D1UA 3ZXHA 4DPEA 1HOVA 2FV9A 1BQQM 4ZR5A 4PKWA 1ZTQA 4WKEA 2OVZA 3V96B 1KBCA 2Z2DA 1BKCE 1D5JA 4GR8A 3WV3A 1XURA 1QIAA 3LJGA 1UMSA 2KRJA 2QPJA 1SRPA 2WOAA 5CUHA 2V4BA 3HY7A 4GUYA 3WV1A 4L6TA 5BOTA 2HU6A 2DDFA 2YB9A 2D1OA 830CA 2X3BA 966CA 1G4KA 2W0DA 4IJOA 2Y6DA 5D7WA 4WF6A 2E3XA 3I7IA 3L0TA 1FBLA 2K9CA 3EWJA 3HBUP 2EROA 2ERQA 2MZIA 4H76A 3EDIA 1IACA 5D1TA 3TVCA 1UTZA 1BIWA 1ND1A 1CIZA 1Y8JA 4FU4A
chains in the Genus database with same CATH superfamily
1FLSA 2MLSA 1JAOA 2OY4A 2E2DA 1BM6A 1QJJA 4GF1A 2XS3A 1GE7A 2A8HA 3KWVC 1SLMA 3L0VA 4A3WA 2OZRA 3DSLA 3VTGA 4PKRA 3KMEA 5BPAA 1BUDA 1JIZA 4XM7A 1IAAA 1HY7A 1TVIA 4GWNA 4H82A 3B92A 2CLTA 2RJPA 4Q1LA 1YQYA 1MMQA 2D1NA 4WKIA 5I43A 4DD8A 1IABA 2OW2A 1XFWA 3P1VA 4JP4A 3DL1A 1BUVM 2W14A 1J7NA 3K7NA 1MMPA 1R55A 1L6JA 3GBOA 1ASTA 1CGEA 3EDGA 4H30A 4JPAA 4WK7A 2JNPA 2DW1A 4PKUA 4HX3A 1DMTA 1QJIA 1G05A 1CGFA 2JT5A 3VI1A 1DTHA 3TSKA 1OM7A 3BA0A 3F1AA 3E8RA 1UTTA 3B8ZA 1FM1A 1YCMA 1OO9A 1Y0VA 1BKCI 2W15A 3LIRA 3O2XA 2OW9A 2USNA 1MNCA 5D1SA 5I3MA 1K7QA 1WNIA 2DDYA 1K7IA 1GE5A 2AIGP 4H49A 456CA 2SRTA 3Q2GA 4HMAA 1OS9A 1CAQA 4I35A 4AIGA 4DF9A 4EFSA 1GO7P 1CK7A 3KRYA 1Z3JA 1XFYA 5CXAA 1XM5A 5D2BA 5LABA 2POJA 3EHXA 3F15A 2OW0A 1XFXA 5B5OA 1ZVXA 3OHLA 4FXQA 1JANA 1KUFA 3WV2A 1PWPA 1PWQA 1EAKA 3LKAA 3DTIA 3F19A 1SMPA 4A7BA 2TCLA 3SHIA 1AF0A 3HDAP 3LE9A 3UVCA 4JIJA 1BZSA 3Q2HA 2Y6CA 3ZVSA 3DTKA 1G49A 1I73A 2DW2A 4I03A 2OI0A 3DPEA 3NX7A 2OW1A 3AYKA 2J83A 1EB6A 4J4MA 3EDZA 4L63A 1O0QA 3EDHA 1JK3A 3DNGA 1B8YA 1A86A 1SU3A 3LUMA 5D3CA 4DV8A 3LMCA 3OHOA 4XM8A 3N2VA 2L0RA 4ILWD 5H8XA 2YUFA 3KMCA 1BQOA 1R1JA 4H2EA 4G0DA 4QKZA 2X3CA 3LUNA 3LJTA 1ROSA 2JT6A 1SLNA 5L7FA 3G5CA 2K2GA 1YP1A 3MA2A 2DW0A 1EUBA 1XUDA 3P24A 2X7MA 3LGPA 1XUCA 3EHYA 4GQLA 1G12A 1JAPA 3ELMA 3LQ0A 3HBVP 1IAEA 2FV5A 2MZHA 4H84A 3RTSA 5I12A 2CKIA 3TT4A 1KUIA 2WO9A 1QICA 2OXWA 1OMJA 3HB2P 4IN9A 3DWBA 1JH1A 2PJTA 4PKQA 3HYGA 4JA1A 5I2ZA 2O3EA 4G9LA 3KEJA 4ON1A 1JAQA 1JIWP 1K7GA 1C7KA 1HV5A 1OM8A 1KUHA 3ZUKA 1XFUA 5JMYA 4XBHA 1MMBA 4XCTA 3USNA 4AYKA 1XFZA 1ZXCA 2AYKA 1CQRA 5CZMA 1R1IA 4WZVA 3F17A 4L7AA 2O36A 4CTHA 1A85A 2MLRA 3KEKA 1C8TA 1KAPP 1Y93A 1AYKA 2RJQA 4GR3A 4AXQA 1PWVA 1UEAA 1CGLA 1MMRA 1PWWA 2W12A 3G42A 1D7XA 4GR0A 1OS2A 1ZS0A 4L19A 1YOUA 1C3IA 1S4BP 3KHIA 3CKIA 1Q3AA 1H71P 4AUOA 1PWUA 1QIBA 4IUWA 3LILA 1CXVA 1OZ9A 1ZXVA 1I76A 3TS4A 4PKSA 3LK8A 1GKDA 2JIHA 3LIKA 3LQBA 2MZEA 1GXDA 4PKTA 2W13A 1AKLA 1OM6A 1G9KA 1B3DA 2OXZA 2J0TA 4PKVA 1BKCA 1R54A 3AYUA 5I0LA 1IADA 1IAGA 5B5PA 3LEAA 1GO8P 3HY9A 3O64A 1RMZA 3RTTA 1XAXA 1HFCA 1HFSA 1SATA 1D8MA 2OVXA 1GE6A 1QUAA 1GKCA 1I1IP 4FVLA 1KUGA 1USNA 3LJZA 2X3AA 3DPFA 3KECA 4GWMA 4H1QA 3U1RA 3F18A 1ATLA 1XFVA 2ERPA 1UMTA 1RM8A 1BSWA 3I7GA 5L79A 2YIGA 3B2ZA 2OY2A 1HTDA 5BOYA 1ZP5A 4JQGA 3N2UA 1R1HA 3HDBA 3AIGA 1O0TA 2XS4A 1D8FA 1JKYA 2JSDA 3K7LA 2WO8A 1KUKA 2I47A 2OXUA 4R3VA 4H3XA 2N8RA 3F16A 4FXYP 5I4OA 4XM6A 1JJ9A 5D1UA 3ZXHA 4DPEA 1HOVA 2FV9A 1BQQM 4ZR5A 4PKWA 1ZTQA 4WKEA 2OVZA 3V96B 1KBCA 2Z2DA 1BKCE 1D5JA 4GR8A 3WV3A 1XURA 1QIAA 3LJGA 1UMSA 2KRJA 2QPJA 1SRPA 2WOAA 5CUHA 2V4BA 3HY7A 4GUYA 3WV1A 4L6TA 5BOTA 2HU6A 2DDFA 2YB9A 2D1OA 830CA 2X3BA 966CA 1G4KA 2W0DA 4IJOA 2Y6DA 5D7WA 4WF6A 2E3XA 3I7IA 3L0TA 1FBLA 2K9CA 3EWJA 3HBUP 2EROA 2ERQA 2MZIA 4H76A 3EDIA 1IACA 5D1TA 3DTEA 3TVCA 1UTZA 1BIWA 1ND1A 1CIZA 1Y8JA 4FU4A
chains in the Genus database with same CATH topology
1FLSA 2MLSA 1JAOA 2OY4A 2E2DA 1BM6A 1QJJA 4GF1A 2XS3A 1GE7A 2A8HA 3KWVC 1SLMA 3L0VA 4A3WA 2OZRA 3DSLA 3VTGA 4PKRA 3KMEA 5BPAA 1BUDA 1JIZA 4XM7A 1IAAA 1HY7A 4GWNA 4H82A 3B92A 2CLTA 2RJPA 4Q1LA 1YQYA 1MMQA 2D1NA 4WKIA 5I43A 4DD8A 1IABA 2OW2A 1XFWA 3P1VA 4JP4A 3DL1A 1BUVM 2W14A 1J7NA 3K7NA 1MMPA 1R55A 1L6JA 3GBOA 1ASTA 1CGEA 3EDGA 4H30A 4JPAA 4WK7A 2JNPA 2DW1A 4PKUA 4HX3A 1DMTA 1QJIA 1G05A 1CGFA 2JT5A 3VI1A 1DTHA 3TSKA 1OM7A 3BA0A 3F1AA 3E8RA 1UTTA 3B8ZA 1FM1A 1YCMA 1OO9A 1Y0VA 1BKCI 2W15A 3LIRA 3O2XA 2OW9A 2USNA 1MNCA 5D1SA 5I3MA 1K7QA 1WNIA 2DDYA 1K7IA 1GE5A 2AIGP 4H49A 456CA 2SRTA 3Q2GA 4HMAA 1OS9A 1CAQA 4I35A 4AIGA 4DF9A 4EFSA 1GO7P 1CK7A 3KRYA 1Z3JA 1XFYA 5CXAA 5D2BA 5LABA 2POJA 3EHXA 3F15A 2OW0A 1XFXA 5B5OA 1ZVXA 3OHLA 4FXQA 1JANA 1KUFA 3WV2A 1PWPA 1PWQA 1EAKA 3LKAA 3DTIA 3F19A 1SMPA 4A7BA 2TCLA 3SHIA 1AF0A 3HDAP 3LE9A 3UVCA 4JIJA 1BZSA 3Q2HA 2Y6CA 3ZVSA 3DTKA 1G49A 1I73A 2DW2A 4I03A 2OI0A 3DPEA 3NX7A 2OW1A 3AYKA 2J83A 1EB6A 4J4MA 3EDZA 4L63A 1O0QA 3EDHA 1JK3A 3DNGA 1B8YA 1A86A 1SU3A 3LUMA 5D3CA 4DV8A 3LMCA 3OHOA 4XM8A 3N2VA 2L0RA 4ILWD 5H8XA 2YUFA 3KMCA 1BQOA 1R1JA 4H2EA 4G0DA 4QKZA 2X3CA 3LUNA 3LJTA 1ROSA 2JT6A 1SLNA 5L7FA 3G5CA 2K2GA 1YP1A 3MA2A 2DW0A 1EUBA 1XUDA 3P24A 2X7MA 3LGPA 1XUCA 3EHYA 4GQLA 1G12A 1JAPA 3ELMA 3LQ0A 3HBVP 1IAEA 2FV5A 2MZHA 4H84A 3RTSA 5I12A 2CKIA 3TT4A 1KUIA 2WO9A 1QICA 2OXWA 1OMJA 3HB2P 4IN9A 3DWBA 1JH1A 2PJTA 4PKQA 3HYGA 4JA1A 5I2ZA 2O3EA 4G9LA 3KEJA 4ON1A 1JAQA 1JIWP 1K7GA 1C7KA 1HV5A 1OM8A 1KUHA 3ZUKA 1XFUA 5JMYA 4XBHA 1MMBA 4XCTA 3USNA 4AYKA 1XFZA 1ZXCA 2AYKA 1CQRA 5CZMA 1R1IA 4WZVA 3F17A 4L7AA 2O36A 4CTHA 1A85A 2MLRA 3KEKA 1C8TA 1KAPP 1Y93A 1AYKA 2RJQA 4GR3A 4AXQA 1PWVA 1UEAA 1CGLA 1MMRA 1PWWA 2W12A 3G42A 1D7XA 4GR0A 1OS2A 1ZS0A 4L19A 1YOUA 1C3IA 1S4BP 3KHIA 3CKIA 1Q3AA 1H71P 4AUOA 1PWUA 1QIBA 4IUWA 3LILA 1CXVA 1ZXVA 1I76A 3TS4A 4PKSA 3LK8A 1GKDA 2JIHA 3LIKA 3LQBA 2MZEA 1GXDA 4PKTA 2W13A 1AKLA 1OM6A 1G9KA 1B3DA 2OXZA 2J0TA 4PKVA 1BKCA 1R54A 3AYUA 5I0LA 1IADA 1IAGA 5B5PA 3LEAA 1GO8P 3HY9A 3O64A 1RMZA 3RTTA 1HFCA 1HFSA 1SATA 1D8MA 2OVXA 1GE6A 1QUAA 1GKCA 1I1IP 4FVLA 1KUGA 1USNA 3LJZA 2X3AA 3DPFA 3KECA 4GWMA 4H1QA 3U1RA 3F18A 1ATLA 1XFVA 2ERPA 1UMTA 1RM8A 1BSWA 3I7GA 5L79A 2YIGA 3B2ZA 2OY2A 1HTDA 5BOYA 1ZP5A 4JQGA 3N2UA 1R1HA 3HDBA 3AIGA 1O0TA 2XS4A 1D8FA 1JKYA 2JSDA 3K7LA 2WO8A 1KUKA 2I47A 2OXUA 4R3VA 4H3XA 2N8RA 3F16A 4FXYP 5I4OA 4XM6A 1JJ9A 5D1UA 3ZXHA 4DPEA 1HOVA 2FV9A 1BQQM 4ZR5A 4PKWA 1ZTQA 4WKEA 2OVZA 3V96B 1KBCA 2Z2DA 1BKCE 1D5JA 4GR8A 3WV3A 1XURA 1QIAA 3LJGA 1UMSA 2KRJA 2QPJA 1SRPA 2WOAA 5CUHA 2V4BA 3HY7A 4GUYA 3WV1A 4L6TA 5BOTA 2HU6A 2DDFA 2YB9A 2D1OA 830CA 2X3BA 966CA 1G4KA 2W0DA 4IJOA 2Y6DA 5D7WA 4WF6A 2E3XA 3I7IA 3L0TA 1FBLA 2K9CA 3EWJA 3HBUP 2EROA 2ERQA 2MZIA 4H76A 3EDIA 1IACA 5D1TA 3DTEA 3TVCA 1UTZA 1BIWA 1ND1A 1CIZA 1Y8JA 4FU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FLS A;  2MLS A;  1JAO A;  2OY4 A;  2E2D A;  1BM6 A;  1QJJ A;  4GF1 A;  2XS3 A;  1GE7 A;  2A8H A;  3KWV C;  1SLM A;  3L0V A;  4A3W A;  2OZR A;  3DSL A;  3VTG A;  4PKR A;  3KME A;  5BPA A;  1BUD A;  1JIZ A;  4XM7 A;  1IAA A;  1HY7 A;  4GWN A;  4H82 A;  3B92 A;  2CLT A;  2RJP A;  4Q1L A;  1YQY A;  1MMQ A;  2D1N A;  4WKI A;  5I43 A;  4DD8 A;  1IAB A;  2OW2 A;  1XFW A;  3P1V A;  4JP4 A;  3DL1 A;  1BUV M;  2W14 A;  1J7N A;  3K7N A;  1MMP A;  1R55 A;  1L6J A;  3GBO A;  1AST A;  1CGE A;  3EDG A;  4H30 A;  4JPA A;  4WK7 A;  2JNP A;  2DW1 A;  4PKU A;  4HX3 A;  1DMT A;  1QJI A;  1G05 A;  1CGF A;  2JT5 A;  3VI1 A;  1DTH A;  3TSK A;  1OM7 A;  3BA0 A;  3F1A A;  3E8R A;  1UTT A;  3B8Z A;  1FM1 A;  1YCM A;  1OO9 A;  1Y0V A;  1BKC I;  2W15 A;  3LIR A;  3O2X A;  2OW9 A;  2USN A;  1MNC A;  5D1S A;  5I3M A;  1K7Q A;  1WNI A;  2DDY A;  1K7I A;  1GE5 A;  2AIG P;  4H49 A;  456C A;  2SRT A;  3Q2G A;  4HMA A;  1OS9 A;  1CAQ A;  4I35 A;  4AIG A;  4DF9 A;  4EFS A;  1GO7 P;  1CK7 A;  3KRY A;  1Z3J A;  1XFY A;  5CXA A;  5D2B A;  5LAB A;  2POJ A;  3EHX A;  3F15 A;  2OW0 A;  1XFX A;  5B5O A;  1ZVX A;  3OHL A;  4FXQ A;  1JAN A;  1KUF A;  3WV2 A;  1PWP A;  1PWQ A;  1EAK A;  3LKA A;  3F19 A;  1SMP A;  4A7B A;  2TCL A;  3SHI A;  1AF0 A;  3HDA P;  3LE9 A;  3UVC A;  4JIJ A;  1BZS A;  3Q2H A;  2Y6C A;  3ZVS A;  1G49 A;  1I73 A;  2DW2 A;  4I03 A;  2OI0 A;  3DPE A;  3NX7 A;  2OW1 A;  3AYK A;  2J83 A;  1EB6 A;  4J4M A;  3EDZ A;  4L63 A;  1O0Q A;  3EDH A;  1JK3 A;  3DNG A;  1B8Y A;  1A86 A;  1SU3 A;  3LUM A;  5D3C A;  4DV8 A;  3LMC A;  3OHO A;  4XM8 A;  3N2V A;  2L0R A;  4ILW D;  5H8X A;  3KMC A;  1BQO A;  1R1J A;  4H2E A;  4G0D A;  4QKZ A;  2X3C A;  3LUN A;  3LJT A;  1ROS A;  2JT6 A;  1SLN A;  5L7F A;  3G5C A;  2K2G A;  1YP1 A;  3MA2 A;  2DW0 A;  1EUB A;  1XUD A;  3P24 A;  2X7M A;  3LGP A;  1XUC A;  3EHY A;  4GQL A;  1G12 A;  1JAP A;  3ELM A;  3LQ0 A;  3HBV P;  1IAE A;  2FV5 A;  2MZH A;  4H84 A;  3RTS A;  5I12 A;  2CKI A;  3TT4 A;  1KUI A;  2WO9 A;  1QIC A;  2OXW A;  1OMJ A;  3HB2 P;  4IN9 A;  3DWB A;  1JH1 A;  2PJT A;  4PKQ A;  3HYG A;  4JA1 A;  5I2Z A;  2O3E A;  4G9L A;  3KEJ A;  4ON1 A;  1JAQ A;  1JIW P;  1K7G A;  1C7K A;  1HV5 A;  1OM8 A;  1KUH A;  3ZUK A;  1XFU A;  5JMY A;  4XBH A;  1MMB A;  4XCT A;  3USN A;  4AYK A;  1XFZ A;  1ZXC A;  2AYK A;  1CQR A;  5CZM A;  1R1I A;  4WZV A;  3F17 A;  2O36 A;  4CTH A;  1A85 A;  2MLR A;  3KEK A;  1C8T A;  1KAP P;  1Y93 A;  1AYK A;  2RJQ A;  4GR3 A;  4AXQ A;  1PWV A;  1UEA A;  1CGL A;  1MMR A;  1PWW A;  2W12 A;  3G42 A;  1D7X A;  4GR0 A;  1OS2 A;  1ZS0 A;  4L19 A;  1YOU A;  1C3I A;  1S4B P;  3KHI A;  3CKI A;  1Q3A A;  1H71 P;  4AUO A;  1PWU A;  1QIB A;  4IUW A;  3LIL A;  1CXV A;  1ZXV A;  1I76 A;  3TS4 A;  4PKS A;  3LK8 A;  1GKD A;  2JIH A;  3LIK A;  3LQB A;  2MZE A;  1GXD A;  4PKT A;  2W13 A;  1AKL A;  1OM6 A;  1G9K A;  1B3D A;  2OXZ A;  2J0T A;  4PKV A;  1BKC A;  1R54 A;  3AYU A;  5I0L A;  1IAD A;  1IAG A;  5B5P A;  3LEA A;  1GO8 P;  3HY9 A;  3O64 A;  1RMZ A;  3RTT A;  1HFC A;  1HFS A;  1SAT A;  1D8M A;  2OVX A;  1GE6 A;  1QUA A;  1GKC A;  1I1I P;  4FVL A;  1KUG A;  1USN A;  3LJZ A;  2X3A A;  3DPF A;  3KEC A;  4GWM A;  4H1Q A;  3U1R A;  3F18 A;  1ATL A;  1XFV A;  2ERP A;  1UMT A;  1RM8 A;  1BSW A;  3I7G A;  5L79 A;  2YIG A;  3B2Z A;  2OY2 A;  1HTD A;  5BOY A;  1ZP5 A;  4JQG A;  3N2U A;  1R1H A;  3HDB A;  3AIG A;  1O0T A;  2XS4 A;  1D8F A;  1JKY A;  2JSD A;  3K7L A;  2WO8 A;  1KUK A;  2I47 A;  2OXU A;  4R3V A;  4H3X A;  2N8R A;  3F16 A;  4FXY P;  5I4O A;  4XM6 A;  1JJ9 A;  5D1U A;  3ZXH A;  4DPE A;  1HOV A;  2FV9 A;  1BQQ M;  4ZR5 A;  4PKW A;  1ZTQ A;  4WKE A;  2OVZ A;  3V96 B;  1KBC A;  2Z2D A;  1BKC E;  1D5J A;  4GR8 A;  3WV3 A;  1XUR A;  1QIA A;  3LJG A;  1UMS A;  2KRJ A;  2QPJ A;  1SRP A;  2WOA A;  5CUH A;  2V4B A;  3HY7 A;  4GUY A;  3WV1 A;  4L6T A;  5BOT A;  2HU6 A;  2DDF A;  2YB9 A;  2D1O A;  830C A;  2X3B A;  966C A;  1G4K A;  2W0D A;  4IJO A;  2Y6D A;  5D7W A;  4WF6 A;  2E3X A;  3I7I A;  3L0T A;  1FBL A;  2K9C A;  3EWJ A;  3HBU P;  2ERO A;  2ERQ A;  2MZI A;  4H76 A;  3EDI A;  1IAC A;  5D1T A;  3TVC A;  1UTZ A;  1BIW A;  1ND1 A;  1CIZ A;  1Y8J A;  4FU4 A; 
#chains in the Genus database with same CATH topology
 1FLS A;  2MLS A;  1JAO A;  2OY4 A;  2E2D A;  1BM6 A;  1QJJ A;  4GF1 A;  2XS3 A;  1GE7 A;  2A8H A;  3KWV C;  1SLM A;  3L0V A;  4A3W A;  2OZR A;  3DSL A;  3VTG A;  4PKR A;  3KME A;  5BPA A;  1BUD A;  1JIZ A;  4XM7 A;  1IAA A;  1HY7 A;  1TVI A;  4GWN A;  4H82 A;  3B92 A;  2CLT A;  2RJP A;  4Q1L A;  1YQY A;  1MMQ A;  2D1N A;  4WKI A;  5I43 A;  4DD8 A;  1IAB A;  2OW2 A;  1XFW A;  3P1V A;  4JP4 A;  3DL1 A;  1BUV M;  2W14 A;  1J7N A;  3K7N A;  1MMP A;  1R55 A;  1L6J A;  3GBO A;  1AST A;  1CGE A;  3EDG A;  4H30 A;  4JPA A;  4WK7 A;  2JNP A;  2DW1 A;  4PKU A;  4HX3 A;  1DMT A;  1QJI A;  1G05 A;  1CGF A;  2JT5 A;  3VI1 A;  1DTH A;  3TSK A;  1OM7 A;  3BA0 A;  3F1A A;  3E8R A;  1UTT A;  3B8Z A;  1FM1 A;  1YCM A;  1OO9 A;  1Y0V A;  1BKC I;  2W15 A;  3LIR A;  3O2X A;  2OW9 A;  2USN A;  1MNC A;  5D1S A;  5I3M A;  1K7Q A;  1WNI A;  2DDY A;  1K7I A;  1GE5 A;  2AIG P;  4H49 A;  456C A;  2SRT A;  3Q2G A;  4HMA A;  1OS9 A;  1CAQ A;  4I35 A;  4AIG A;  4DF9 A;  4EFS A;  1GO7 P;  1CK7 A;  3KRY A;  1Z3J A;  1XFY A;  5CXA A;  1XM5 A;  5D2B A;  5LAB A;  2POJ A;  3EHX A;  3F15 A;  2OW0 A;  1XFX A;  5B5O A;  1ZVX A;  3OHL A;  4FXQ A;  1JAN A;  1KUF A;  3WV2 A;  1PWP A;  1PWQ A;  1EAK A;  3LKA A;  3DTI A;  3F19 A;  1SMP A;  4A7B A;  2TCL A;  3SHI A;  1AF0 A;  3HDA P;  3LE9 A;  3UVC A;  4JIJ A;  1BZS A;  3Q2H A;  2Y6C A;  3ZVS A;  3DTK A;  1G49 A;  1I73 A;  2DW2 A;  4I03 A;  2OI0 A;  3DPE A;  3NX7 A;  2OW1 A;  3AYK A;  2J83 A;  1EB6 A;  4J4M A;  3EDZ A;  4L63 A;  1O0Q A;  3EDH A;  1JK3 A;  3DNG A;  1B8Y A;  1A86 A;  1SU3 A;  3LUM A;  5D3C A;  4DV8 A;  3LMC A;  3OHO A;  4XM8 A;  3N2V A;  2L0R A;  4ILW D;  5H8X A;  2YUF A;  3KMC A;  1BQO A;  1R1J A;  4H2E A;  4G0D A;  4QKZ A;  2X3C A;  3LUN A;  3LJT A;  1ROS A;  2JT6 A;  1SLN A;  5L7F A;  3G5C A;  2K2G A;  1YP1 A;  3MA2 A;  2DW0 A;  1EUB A;  1XUD A;  3P24 A;  2X7M A;  3LGP A;  1XUC A;  3EHY A;  4GQL A;  1G12 A;  1JAP A;  3ELM A;  3LQ0 A;  3HBV P;  1IAE A;  2FV5 A;  2MZH A;  4H84 A;  3RTS A;  5I12 A;  2CKI A;  3TT4 A;  1KUI A;  2WO9 A;  1QIC A;  2OXW A;  1OMJ A;  3HB2 P;  4IN9 A;  3DWB A;  1JH1 A;  2PJT A;  4PKQ A;  3HYG A;  4JA1 A;  5I2Z A;  2O3E A;  4G9L A;  3KEJ A;  4ON1 A;  1JAQ A;  1JIW P;  1K7G A;  1C7K A;  1HV5 A;  1OM8 A;  1KUH A;  3ZUK A;  1XFU A;  5JMY A;  4XBH A;  1MMB A;  4XCT A;  3USN A;  4AYK A;  1XFZ A;  1ZXC A;  2AYK A;  1CQR A;  5CZM A;  1R1I A;  4WZV A;  3F17 A;  4L7A A;  2O36 A;  4CTH A;  1A85 A;  2MLR A;  3KEK A;  1C8T A;  1KAP P;  1Y93 A;  1AYK A;  2RJQ A;  4GR3 A;  4AXQ A;  1PWV A;  1UEA A;  1CGL A;  1MMR A;  1PWW A;  2W12 A;  3G42 A;  1D7X A;  4GR0 A;  1OS2 A;  1ZS0 A;  4L19 A;  1YOU A;  1C3I A;  1S4B P;  3KHI A;  3CKI A;  1Q3A A;  1H71 P;  4AUO A;  1PWU A;  1QIB A;  4IUW A;  3LIL A;  1CXV A;  1OZ9 A;  1ZXV A;  1I76 A;  3TS4 A;  4PKS A;  3LK8 A;  1GKD A;  2JIH A;  3LIK A;  3LQB A;  2MZE A;  1GXD A;  4PKT A;  2W13 A;  1AKL A;  1OM6 A;  1G9K A;  1B3D A;  2OXZ A;  2J0T A;  4PKV A;  1BKC A;  1R54 A;  3AYU A;  5I0L A;  1IAD A;  1IAG A;  5B5P A;  3LEA A;  1GO8 P;  3HY9 A;  3O64 A;  1RMZ A;  3RTT A;  1XAX A;  1HFC A;  1HFS A;  1SAT A;  1D8M A;  2OVX A;  1GE6 A;  1QUA A;  1GKC A;  1I1I P;  4FVL A;  1KUG A;  1USN A;  3LJZ A;  2X3A A;  3DPF A;  3KEC A;  4GWM A;  4H1Q A;  3U1R A;  3F18 A;  1ATL A;  1XFV A;  2ERP A;  1UMT A;  1RM8 A;  1BSW A;  3I7G A;  5L79 A;  2YIG A;  3B2Z A;  2OY2 A;  1HTD A;  5BOY A;  1ZP5 A;  4JQG A;  3N2U A;  1R1H A;  3HDB A;  3AIG A;  1O0T A;  2XS4 A;  1D8F A;  1JKY A;  2JSD A;  3K7L A;  2WO8 A;  1KUK A;  2I47 A;  2OXU A;  4R3V A;  4H3X A;  2N8R A;  3F16 A;  4FXY P;  5I4O A;  4XM6 A;  1JJ9 A;  5D1U A;  3ZXH A;  4DPE A;  1HOV A;  2FV9 A;  1BQQ M;  4ZR5 A;  4PKW A;  1ZTQ A;  4WKE A;  2OVZ A;  3V96 B;  1KBC A;  2Z2D A;  1BKC E;  1D5J A;  4GR8 A;  3WV3 A;  1XUR A;  1QIA A;  3LJG A;  1UMS A;  2KRJ A;  2QPJ A;  1SRP A;  2WOA A;  5CUH A;  2V4B A;  3HY7 A;  4GUY A;  3WV1 A;  4L6T A;  5BOT A;  2HU6 A;  2DDF A;  2YB9 A;  2D1O A;  830C A;  2X3B A;  966C A;  1G4K A;  2W0D A;  4IJO A;  2Y6D A;  5D7W A;  4WF6 A;  2E3X A;  3I7I A;  3L0T A;  1FBL A;  2K9C A;  3EWJ A;  3HBU P;  2ERO A;  2ERQ A;  2MZI A;  4H76 A;  3EDI A;  1IAC A;  5D1T A;  3DTE A;  3TVC A;  1UTZ A;  1BIW A;  1ND1 A;  1CIZ A;  1Y8J A;  4FU4 A; 
#chains in the Genus database with same CATH homology
 1FLS A;  2MLS A;  1JAO A;  2OY4 A;  2E2D A;  1BM6 A;  1QJJ A;  4GF1 A;  2XS3 A;  1GE7 A;  2A8H A;  3KWV C;  1SLM A;  3L0V A;  4A3W A;  2OZR A;  3DSL A;  3VTG A;  4PKR A;  3KME A;  5BPA A;  1BUD A;  1JIZ A;  4XM7 A;  1IAA A;  1HY7 A;  4GWN A;  4H82 A;  3B92 A;  2CLT A;  2RJP A;  4Q1L A;  1YQY A;  1MMQ A;  2D1N A;  4WKI A;  5I43 A;  4DD8 A;  1IAB A;  2OW2 A;  1XFW A;  3P1V A;  4JP4 A;  3DL1 A;  1BUV M;  2W14 A;  1J7N A;  3K7N A;  1MMP A;  1R55 A;  1L6J A;  3GBO A;  1AST A;  1CGE A;  3EDG A;  4H30 A;  4JPA A;  4WK7 A;  2JNP A;  2DW1 A;  4PKU A;  4HX3 A;  1DMT A;  1QJI A;  1G05 A;  1CGF A;  2JT5 A;  3VI1 A;  1DTH A;  3TSK A;  1OM7 A;  3BA0 A;  3F1A A;  3E8R A;  1UTT A;  3B8Z A;  1FM1 A;  1YCM A;  1OO9 A;  1Y0V A;  1BKC I;  2W15 A;  3LIR A;  3O2X A;  2OW9 A;  2USN A;  1MNC A;  5D1S A;  5I3M A;  1K7Q A;  1WNI A;  2DDY A;  1K7I A;  1GE5 A;  2AIG P;  4H49 A;  456C A;  2SRT A;  3Q2G A;  4HMA A;  1OS9 A;  1CAQ A;  4I35 A;  4AIG A;  4DF9 A;  4EFS A;  1GO7 P;  1CK7 A;  3KRY A;  1Z3J A;  1XFY A;  5CXA A;  5D2B A;  5LAB A;  2POJ A;  3EHX A;  3F15 A;  2OW0 A;  1XFX A;  5B5O A;  1ZVX A;  3OHL A;  4FXQ A;  1JAN A;  1KUF A;  3WV2 A;  1PWP A;  1PWQ A;  1EAK A;  3LKA A;  3DTI A;  3F19 A;  1SMP A;  4A7B A;  2TCL A;  3SHI A;  1AF0 A;  3HDA P;  3LE9 A;  3UVC A;  4JIJ A;  1BZS A;  3Q2H A;  2Y6C A;  3ZVS A;  3DTK A;  1G49 A;  1I73 A;  2DW2 A;  4I03 A;  2OI0 A;  3DPE A;  3NX7 A;  2OW1 A;  3AYK A;  2J83 A;  1EB6 A;  4J4M A;  3EDZ A;  4L63 A;  1O0Q A;  3EDH A;  1JK3 A;  3DNG A;  1B8Y A;  1A86 A;  1SU3 A;  3LUM A;  5D3C A;  4DV8 A;  3LMC A;  3OHO A;  4XM8 A;  3N2V A;  2L0R A;  4ILW D;  5H8X A;  2YUF A;  3KMC A;  1BQO A;  1R1J A;  4H2E A;  4G0D A;  4QKZ A;  2X3C A;  3LUN A;  3LJT A;  1ROS A;  2JT6 A;  1SLN A;  5L7F A;  3G5C A;  2K2G A;  1YP1 A;  3MA2 A;  2DW0 A;  1EUB A;  1XUD A;  3P24 A;  2X7M A;  3LGP A;  1XUC A;  3EHY A;  4GQL A;  1G12 A;  1JAP A;  3ELM A;  3LQ0 A;  3HBV P;  1IAE A;  2FV5 A;  2MZH A;  4H84 A;  3RTS A;  5I12 A;  2CKI A;  3TT4 A;  1KUI A;  2WO9 A;  1QIC A;  2OXW A;  1OMJ A;  3HB2 P;  4IN9 A;  3DWB A;  1JH1 A;  2PJT A;  4PKQ A;  3HYG A;  4JA1 A;  5I2Z A;  2O3E A;  4G9L A;  3KEJ A;  4ON1 A;  1JAQ A;  1JIW P;  1K7G A;  1C7K A;  1HV5 A;  1OM8 A;  1KUH A;  3ZUK A;  1XFU A;  5JMY A;  4XBH A;  1MMB A;  4XCT A;  3USN A;  4AYK A;  1XFZ A;  1ZXC A;  2AYK A;  1CQR A;  5CZM A;  1R1I A;  4WZV A;  3F17 A;  4L7A A;  2O36 A;  4CTH A;  1A85 A;  2MLR A;  3KEK A;  1C8T A;  1KAP P;  1Y93 A;  1AYK A;  2RJQ A;  4GR3 A;  4AXQ A;  1PWV A;  1UEA A;  1CGL A;  1MMR A;  1PWW A;  2W12 A;  3G42 A;  1D7X A;  4GR0 A;  1OS2 A;  1ZS0 A;  4L19 A;  1YOU A;  1C3I A;  1S4B P;  3KHI A;  3CKI A;  1Q3A A;  1H71 P;  4AUO A;  1PWU A;  1QIB A;  4IUW A;  3LIL A;  1CXV A;  1ZXV A;  1I76 A;  3TS4 A;  4PKS A;  3LK8 A;  1GKD A;  2JIH A;  3LIK A;  3LQB A;  2MZE A;  1GXD A;  4PKT A;  2W13 A;  1AKL A;  1OM6 A;  1G9K A;  1B3D A;  2OXZ A;  2J0T A;  4PKV A;  1BKC A;  1R54 A;  3AYU A;  5I0L A;  1IAD A;  1IAG A;  5B5P A;  3LEA A;  1GO8 P;  3HY9 A;  3O64 A;  1RMZ A;  3RTT A;  1HFC A;  1HFS A;  1SAT A;  1D8M A;  2OVX A;  1GE6 A;  1QUA A;  1GKC A;  1I1I P;  4FVL A;  1KUG A;  1USN A;  3LJZ A;  2X3A A;  3DPF A;  3KEC A;  4GWM A;  4H1Q A;  3U1R A;  3F18 A;  1ATL A;  1XFV A;  2ERP A;  1UMT A;  1RM8 A;  1BSW A;  3I7G A;  5L79 A;  2YIG A;  3B2Z A;  2OY2 A;  1HTD A;  5BOY A;  1ZP5 A;  4JQG A;  3N2U A;  1R1H A;  3HDB A;  3AIG A;  1O0T A;  2XS4 A;  1D8F A;  1JKY A;  2JSD A;  3K7L A;  2WO8 A;  1KUK A;  2I47 A;  2OXU A;  4R3V A;  4H3X A;  2N8R A;  3F16 A;  4FXY P;  5I4O A;  4XM6 A;  1JJ9 A;  5D1U A;  3ZXH A;  4DPE A;  1HOV A;  2FV9 A;  1BQQ M;  4ZR5 A;  4PKW A;  1ZTQ A;  4WKE A;  2OVZ A;  3V96 B;  1KBC A;  2Z2D A;  1BKC E;  1D5J A;  4GR8 A;  3WV3 A;  1XUR A;  1QIA A;  3LJG A;  1UMS A;  2KRJ A;  2QPJ A;  1SRP A;  2WOA A;  5CUH A;  2V4B A;  3HY7 A;  4GUY A;  3WV1 A;  4L6T A;  5BOT A;  2HU6 A;  2DDF A;  2YB9 A;  2D1O A;  830C A;  2X3B A;  966C A;  1G4K A;  2W0D A;  4IJO A;  2Y6D A;  5D7W A;  4WF6 A;  2E3X A;  3I7I A;  3L0T A;  1FBL A;  2K9C A;  3EWJ A;  3HBU P;  2ERO A;  2ERQ A;  2MZI A;  4H76 A;  3EDI A;  1IAC A;  5D1T A;  3DTE A;  3TVC A;  1UTZ A;  1BIW A;  1ND1 A;  1CIZ A;  1Y8J A;  4FU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...