2Y6CA

The discovery of mmp7 inhibitors exploiting a novel selectivity trigger
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
161
Chain Sequence
b'GYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYPQNFKLSQDDIKGIQKLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRILYSIN
publication title The Discovery of Mmp7 Inhibitors Exploiting a Novel Selectivity Trigger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 161
sequence length 165
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2011-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2y6cA00
1KUIA 2FV9A 3KEKA 1KUGA 3I7IA 3ELMA 4EFSA 3TS4A 4IJOA 3P1VA 3LIKA 1G49A 3LILA 2D1OA 1DMTA 2EROA 1UMTA 3UVCA 4H2EA 4H1QA 1QUAA 1IAGA 3DWBA 1CGEA 1L6JA 1CGFA 3DNGA 1PWWA 2XS4A 4WK7A 2K9CA 4GR0A 1JANA 1Z3JA 2X3BA 4JQGA 1MMQA 1OS9A 4GUYA 1H71P 1D8MA 3N2VA 5CUHA 3EHXA 2CLTA 3AYKA 5D1UA 3SHIA 4XCTA 1R55A 5I43A 2N8RA 3OHOA 1Y8JA 1AF0A 1C3IA 1KUHA 1C8TA 2X3CA 1XFWA 2I47A 1KAPP 3Q2HA 2O36A 2AIGP 1SATA 4AXQA 1SLNA 3KWVC 2W12A 4PKTA 1EB6A 2O3EA 1I76A 4L6TA 2OW1A 456CA 1IACA 1JK3A 2OVXA 2JNPA 1GE6A 2J83A 1OS2A 1XFUA 3KECA 4PKRA 1ZS0A 2W14A 1ZXCA 1KBCA 3LEAA 2JIHA 3VTGA 1EUBA 3AYUA 2Y6DA 2MLRA 2PJTA 1K7QA 2Z2DA 2OY4A 3NX7A 4XM8A 1K7IA 5BPAA 4H82A 5B5OA 4J4MA 1D5JA 1B3DA 1QJJA 1XUCA 1USNA 2OY2A 2W0DA 5I4OA 1CIZA 3OHLA 2OXZA 4JP4A 4L19A 1RMZA 1BIWA 1MNCA 3LQ0A 3USNA 2WOAA 3LMCA 1G4KA 1ZXVA 1CAQA 3B92A 1BQQM 1XFYA 4I35A 3DPEA 3O64A 4DV8A 1O0QA 3GBOA 1OM8A 3LJTA 1ZVXA 1YOUA 1DTHA 1FLSA 2Y6CA 5JMYA 3DL1A 1C7KA 1A85A 3HBVP 3DPFA 3F19A 1SU3A 2RJQA 4I03A 3L0TA 1HFSA 3EDIA 1BKCI 1G05A 3WV2A 2JT6A 1BUDA 4GF1A 1K7GA 3O2XA 1OM6A 3P24A 1XFZA 3E8RA 3K7NA 4FU4A 4GWNA 4XM7A 4A7BA 1JAOA 5D1TA 1KUFA 2OZRA 4A3WA 2JT5A 4ON1A 1Y93A 2RJPA 5I0LA 3RTTA 1R1IA 1HOVA 2OI0A 3EDZA 2OW9A 2WO9A 4GR8A 1HV5A 4FXQA 4H76A 1Q3AA 1JAQA 2ERQA 5B5PA 1GKDA 3B8ZA 3EHYA 4PKUA 1J7NA 1QJIA 1XFXA 5D1SA 1KUKA 3CKIA 4ZR5A 1IAAA 2FV5A 5L7FA 1BKCA 1WNIA 5D3CA 1MMRA 3B2ZA 1D8FA 2AYKA 3LJGA 4XBHA 5D7WA 2DW2A 5I3MA 2MZEA 5CXAA 3G42A 3HY9A 3K7LA 2QPJA 5LABA 3F15A 4IUWA 1A86A 3LJZA 1EAKA 4WKEA 1XUDA 2W13A 3Q2GA 3VI1A 4AYKA 2DDYA 5BOTA 2DW0A 2HU6A 1SRPA 1G9KA 1RM8A 1FBLA 3TT4A 3DSLA 1PWPA 1ASTA 3I7GA 2CKIA 1IADA 2OXUA 3F1AA 3LE9A 1JIWP 5I2ZA 1YCMA 3KHIA 1IABA 1YP1A 3HDAP 3EDGA 1AYKA 2WO8A 1HY7A 830CA 3LK8A 1I1IP 1JJ9A 4AIGA 4QKZA 4WF6A 3HYGA 4AUOA 1JKYA 1BQOA 4G9LA 1OMJA 1ZP5A 4PKVA 3WV3A 2J0TA 3ZVSA 4PKQA 4FXYP 1GE5A 1ROSA 3LUMA 1BM6A 1Y0VA 1PWVA 1R1HA 4H49A 2OVZA 1G12A 1OM7A 1XURA 2DDFA 1BUVM 2POJA 4GQLA 4Q1LA 3RTSA 1CGLA 3KMCA 2OW0A 4HMAA 3TSKA 2MLSA 3N2UA 2D1NA 1GE7A 3V96B 1R54A 1QICA 1JH1A 1SMPA 3KMEA 2MZHA 1QIBA 3HB2P 5BOYA 1ATLA 5L79A 4L63A 4H84A 4PKWA 1JIZA 4JIJA 2OXWA 4WKIA 3EWJA 1JAPA 4PKSA 4DPEA 2TCLA 3TVCA 1CQRA 1YQYA 2K2GA 5D2BA 2YIGA 3ZUKA 3LIRA 1MMBA 3L0VA 4H30A 1CXVA 2L0RA 5CZMA 1IAEA 1BSWA 3HBUP 2V4BA 4GWMA 1AKLA 3AIGA 4R3VA 1HTDA 4DD8A 1GXDA 1FM1A 1ND1A 1I73A 1GKCA 1R1JA 1UTTA 1UEAA 4ILWD 4IN9A 3MA2A 4H3XA 2E2DA 1UTZA 1BKCE 2YB9A 3F17A 4CTHA 1ZTQA 4WZVA 1XFVA 2ERPA 3U1RA 2X7MA 2E3XA 2SRTA 1OO9A 3LUNA 2JSDA 1D7XA 1QIAA 3EDHA 2X3AA 3LGPA 4JPAA 1BZSA 966CA 3F16A 1UMSA 3WV1A 1PWUA 3F18A 1S4BP 1SLMA 1B8YA 3BA0A 4GR3A 4HX3A 1GO8P 2A8HA 2MZIA 3KRYA 2DW1A 1MMPA 1PWQA 1GO7P 1CK7A 3LKAA 5H8XA 2W15A 4DF9A 3G5CA 2USNA 2OW2A 3KEJA 4G0DA 4JA1A 1O0TA 3HDBA 3ZXHA 1HFCA 3HY7A 2XS3A 4XM6A 3LQBA 4FVLA 5I12A 2KRJA
chains in the Genus database with same CATH superfamily
1KUIA 2FV9A 3KEKA 1KUGA 3I7IA 3ELMA 4EFSA 3TS4A 4IJOA 3P1VA 3LIKA 1G49A 3LILA 2D1OA 1DMTA 2EROA 1UMTA 3UVCA 4H2EA 4H1QA 1QUAA 1IAGA 3DWBA 1CGEA 1L6JA 1CGFA 3DNGA 1PWWA 2XS4A 4WK7A 2K9CA 4GR0A 1JANA 1Z3JA 2X3BA 4JQGA 1MMQA 1OS9A 4GUYA 1H71P 1D8MA 3N2VA 5CUHA 3EHXA 2CLTA 3AYKA 5D1UA 3SHIA 4XCTA 1R55A 5I43A 2N8RA 3OHOA 1Y8JA 1AF0A 1C3IA 1KUHA 1C8TA 2X3CA 1XFWA 2I47A 1KAPP 3Q2HA 2O36A 2AIGP 1SATA 4AXQA 1SLNA 3KWVC 2W12A 4PKTA 1EB6A 2O3EA 1I76A 4L6TA 2OW1A 456CA 1IACA 1JK3A 2OVXA 2JNPA 1GE6A 2J83A 1OS2A 1XFUA 3KECA 4PKRA 1ZS0A 2W14A 1ZXCA 1KBCA 3LEAA 2JIHA 3VTGA 1EUBA 3AYUA 2Y6DA 2MLRA 2PJTA 1K7QA 2Z2DA 2OY4A 3NX7A 4XM8A 1K7IA 5BPAA 4H82A 5B5OA 4J4MA 1D5JA 1B3DA 1QJJA 1XUCA 1USNA 2OY2A 2W0DA 5I4OA 1CIZA 3OHLA 2OXZA 4JP4A 4L19A 1RMZA 1BIWA 1TVIA 1MNCA 3LQ0A 3USNA 2WOAA 3LMCA 1G4KA 1ZXVA 1CAQA 3B92A 1BQQM 1XFYA 4I35A 3DPEA 3O64A 4DV8A 1O0QA 3GBOA 1OM8A 3LJTA 1ZVXA 1YOUA 1DTHA 1FLSA 2Y6CA 5JMYA 3DL1A 1C7KA 1A85A 3HBVP 3DPFA 3F19A 1SU3A 2RJQA 4I03A 3L0TA 1HFSA 3EDIA 1BKCI 1G05A 3WV2A 2JT6A 1BUDA 4GF1A 1K7GA 3O2XA 1OM6A 3P24A 1XFZA 3E8RA 3K7NA 4FU4A 4GWNA 4XM7A 4A7BA 1JAOA 5D1TA 1KUFA 2OZRA 4A3WA 2JT5A 4ON1A 1Y93A 2RJPA 5I0LA 3RTTA 1R1IA 1HOVA 2OI0A 3DTEA 3EDZA 2OW9A 2WO9A 4GR8A 1HV5A 4FXQA 4H76A 1Q3AA 1JAQA 2ERQA 5B5PA 1GKDA 3B8ZA 3EHYA 4PKUA 1J7NA 1QJIA 1XFXA 5D1SA 1KUKA 3CKIA 4ZR5A 1IAAA 2FV5A 5L7FA 1BKCA 1WNIA 5D3CA 1MMRA 3B2ZA 1D8FA 2AYKA 3LJGA 4XBHA 5D7WA 2DW2A 5I3MA 2MZEA 5CXAA 3DTIA 3G42A 3HY9A 3K7LA 2QPJA 3DTKA 5LABA 3F15A 4IUWA 1A86A 2YUFA 3LJZA 1EAKA 4WKEA 1XUDA 2W13A 3Q2GA 3VI1A 4AYKA 2DDYA 5BOTA 2DW0A 2HU6A 1SRPA 1G9KA 1RM8A 1FBLA 3TT4A 3DSLA 1PWPA 1ASTA 3I7GA 4L7AA 2CKIA 1IADA 2OXUA 3F1AA 3LE9A 1JIWP 5I2ZA 1YCMA 3KHIA 1IABA 1YP1A 3HDAP 3EDGA 1AYKA 2WO8A 1HY7A 830CA 3LK8A 1I1IP 1XAXA 1JJ9A 4AIGA 4QKZA 4WF6A 3HYGA 4AUOA 1JKYA 1BQOA 4G9LA 1OMJA 1ZP5A 4PKVA 3WV3A 2J0TA 3ZVSA 4PKQA 4FXYP 1GE5A 1ROSA 3LUMA 1BM6A 1Y0VA 1PWVA 1R1HA 4H49A 2OVZA 1G12A 1OM7A 1XURA 2DDFA 1BUVM 2POJA 4GQLA 4Q1LA 3RTSA 1CGLA 3KMCA 2OW0A 4HMAA 3TSKA 2MLSA 3N2UA 2D1NA 1GE7A 3V96B 1R54A 1QICA 1JH1A 1OZ9A 1SMPA 3KMEA 2MZHA 1QIBA 3HB2P 5BOYA 1ATLA 5L79A 4L63A 4H84A 4PKWA 1JIZA 4JIJA 2OXWA 4WKIA 3EWJA 1JAPA 4PKSA 4DPEA 2TCLA 3TVCA 1CQRA 1YQYA 2K2GA 5D2BA 2YIGA 3ZUKA 3LIRA 1MMBA 3L0VA 4H30A 1CXVA 2L0RA 5CZMA 1IAEA 1BSWA 3HBUP 2V4BA 4GWMA 1AKLA 3AIGA 4R3VA 1HTDA 4DD8A 1GXDA 1FM1A 1ND1A 1I73A 1GKCA 1R1JA 1UTTA 1UEAA 4ILWD 4IN9A 3MA2A 4H3XA 2E2DA 1UTZA 1BKCE 2YB9A 3F17A 4CTHA 1ZTQA 4WZVA 1XFVA 2ERPA 3U1RA 2X7MA 2E3XA 2SRTA 1OO9A 3LUNA 2JSDA 1D7XA 1QIAA 3EDHA 2X3AA 3LGPA 4JPAA 1BZSA 966CA 3F16A 1UMSA 3WV1A 1PWUA 3F18A 1S4BP 1SLMA 1B8YA 3BA0A 4GR3A 4HX3A 1GO8P 2A8HA 2MZIA 3KRYA 2DW1A 1MMPA 1PWQA 1GO7P 1CK7A 3LKAA 5H8XA 2W15A 4DF9A 3G5CA 1XM5A 2USNA 2OW2A 3KEJA 4G0DA 4JA1A 1O0TA 3HDBA 3ZXHA 1HFCA 3HY7A 2XS3A 4XM6A 3LQBA 4FVLA 5I12A 2KRJA
chains in the Genus database with same CATH topology
1KUIA 2FV9A 3KEKA 1KUGA 3I7IA 3ELMA 4EFSA 3TS4A 4IJOA 3P1VA 3LIKA 1G49A 3LILA 2D1OA 1DMTA 2EROA 1UMTA 3UVCA 4H2EA 4H1QA 1QUAA 1IAGA 3DWBA 1CGEA 1L6JA 1CGFA 3DNGA 1PWWA 2XS4A 4WK7A 2K9CA 4GR0A 1JANA 1Z3JA 2X3BA 4JQGA 1MMQA 1OS9A 4GUYA 1H71P 1D8MA 3N2VA 5CUHA 3EHXA 2CLTA 3AYKA 5D1UA 3SHIA 4XCTA 1R55A 5I43A 2N8RA 3OHOA 1Y8JA 1AF0A 1C3IA 1KUHA 1C8TA 2X3CA 1XFWA 2I47A 1KAPP 3Q2HA 2O36A 2AIGP 1SATA 4AXQA 1SLNA 3KWVC 2W12A 4PKTA 1EB6A 2O3EA 1I76A 4L6TA 2OW1A 456CA 1IACA 1JK3A 2OVXA 2JNPA 1GE6A 2J83A 1OS2A 1XFUA 3KECA 4PKRA 1ZS0A 2W14A 1ZXCA 1KBCA 3LEAA 2JIHA 3VTGA 1EUBA 3AYUA 2Y6DA 2MLRA 2PJTA 1K7QA 2Z2DA 2OY4A 3NX7A 4XM8A 1K7IA 5BPAA 4H82A 5B5OA 4J4MA 1D5JA 1B3DA 1QJJA 1XUCA 1USNA 2OY2A 2W0DA 5I4OA 1CIZA 3OHLA 2OXZA 4JP4A 4L19A 1RMZA 1BIWA 1MNCA 3LQ0A 3USNA 2WOAA 3LMCA 1G4KA 1ZXVA 1CAQA 3B92A 1BQQM 1XFYA 4I35A 3DPEA 3O64A 4DV8A 1O0QA 3GBOA 1OM8A 3LJTA 1ZVXA 1YOUA 1DTHA 1FLSA 2Y6CA 5JMYA 3DL1A 1C7KA 1A85A 3HBVP 3DPFA 3F19A 1SU3A 2RJQA 4I03A 3L0TA 1HFSA 3EDIA 1BKCI 1G05A 3WV2A 2JT6A 1BUDA 4GF1A 1K7GA 3O2XA 1OM6A 3P24A 1XFZA 3E8RA 3K7NA 4FU4A 4GWNA 4XM7A 4A7BA 1JAOA 5D1TA 1KUFA 2OZRA 4A3WA 2JT5A 4ON1A 1Y93A 2RJPA 5I0LA 3RTTA 1R1IA 1HOVA 2OI0A 3DTEA 3EDZA 2OW9A 2WO9A 4GR8A 1HV5A 4FXQA 4H76A 1Q3AA 1JAQA 2ERQA 5B5PA 1GKDA 3B8ZA 3EHYA 4PKUA 1J7NA 1QJIA 1XFXA 5D1SA 1KUKA 3CKIA 4ZR5A 1IAAA 2FV5A 5L7FA 1BKCA 1WNIA 5D3CA 1MMRA 3B2ZA 1D8FA 2AYKA 3LJGA 4XBHA 5D7WA 2DW2A 5I3MA 2MZEA 5CXAA 3DTIA 3G42A 3HY9A 3K7LA 2QPJA 3DTKA 5LABA 3F15A 4IUWA 1A86A 2YUFA 3LJZA 1EAKA 4WKEA 1XUDA 2W13A 3Q2GA 3VI1A 4AYKA 2DDYA 5BOTA 2DW0A 2HU6A 1SRPA 1G9KA 1RM8A 1FBLA 3TT4A 3DSLA 1PWPA 1ASTA 3I7GA 4L7AA 2CKIA 1IADA 2OXUA 3F1AA 3LE9A 1JIWP 5I2ZA 1YCMA 3KHIA 1IABA 1YP1A 3HDAP 3EDGA 1AYKA 2WO8A 1HY7A 830CA 3LK8A 1I1IP 1JJ9A 4AIGA 4QKZA 4WF6A 3HYGA 4AUOA 1JKYA 1BQOA 4G9LA 1OMJA 1ZP5A 4PKVA 3WV3A 2J0TA 3ZVSA 4PKQA 4FXYP 1GE5A 1ROSA 3LUMA 1BM6A 1Y0VA 1PWVA 1R1HA 4H49A 2OVZA 1G12A 1OM7A 1XURA 2DDFA 1BUVM 2POJA 4GQLA 4Q1LA 3RTSA 1CGLA 3KMCA 2OW0A 4HMAA 3TSKA 2MLSA 3N2UA 2D1NA 1GE7A 3V96B 1R54A 1QICA 1JH1A 1SMPA 3KMEA 2MZHA 1QIBA 3HB2P 5BOYA 1ATLA 5L79A 4L63A 4H84A 4PKWA 1JIZA 4JIJA 2OXWA 4WKIA 3EWJA 1JAPA 4PKSA 4DPEA 2TCLA 3TVCA 1CQRA 1YQYA 2K2GA 5D2BA 2YIGA 3ZUKA 3LIRA 1MMBA 3L0VA 4H30A 1CXVA 2L0RA 5CZMA 1IAEA 1BSWA 3HBUP 2V4BA 4GWMA 1AKLA 3AIGA 4R3VA 1HTDA 4DD8A 1GXDA 1FM1A 1ND1A 1I73A 1GKCA 1R1JA 1UTTA 1UEAA 4ILWD 4IN9A 3MA2A 4H3XA 2E2DA 1UTZA 1BKCE 2YB9A 3F17A 4CTHA 1ZTQA 4WZVA 1XFVA 2ERPA 3U1RA 2X7MA 2E3XA 2SRTA 1OO9A 3LUNA 2JSDA 1D7XA 1QIAA 3EDHA 2X3AA 3LGPA 4JPAA 1BZSA 966CA 3F16A 1UMSA 3WV1A 1PWUA 3F18A 1S4BP 1SLMA 1B8YA 3BA0A 4GR3A 4HX3A 1GO8P 2A8HA 2MZIA 3KRYA 2DW1A 1MMPA 1PWQA 1GO7P 1CK7A 3LKAA 5H8XA 2W15A 4DF9A 3G5CA 2USNA 2OW2A 3KEJA 4G0DA 4JA1A 1O0TA 3HDBA 3ZXHA 1HFCA 3HY7A 2XS3A 4XM6A 3LQBA 4FVLA 5I12A 2KRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUI A;  2FV9 A;  3KEK A;  1KUG A;  3I7I A;  3ELM A;  4EFS A;  3TS4 A;  4IJO A;  3P1V A;  3LIK A;  1G49 A;  3LIL A;  2D1O A;  1DMT A;  2ERO A;  1UMT A;  3UVC A;  4H2E A;  4H1Q A;  1QUA A;  1IAG A;  3DWB A;  1CGE A;  1L6J A;  1CGF A;  3DNG A;  1PWW A;  2XS4 A;  4WK7 A;  2K9C A;  4GR0 A;  1JAN A;  1Z3J A;  2X3B A;  4JQG A;  1MMQ A;  1OS9 A;  4GUY A;  1H71 P;  1D8M A;  3N2V A;  5CUH A;  3EHX A;  2CLT A;  3AYK A;  5D1U A;  3SHI A;  4XCT A;  1R55 A;  5I43 A;  2N8R A;  3OHO A;  1Y8J A;  1AF0 A;  1C3I A;  1KUH A;  1C8T A;  2X3C A;  1XFW A;  2I47 A;  1KAP P;  3Q2H A;  2O36 A;  2AIG P;  1SAT A;  4AXQ A;  1SLN A;  3KWV C;  2W12 A;  4PKT A;  1EB6 A;  2O3E A;  1I76 A;  4L6T A;  2OW1 A;  456C A;  1IAC A;  1JK3 A;  2OVX A;  2JNP A;  1GE6 A;  2J83 A;  1OS2 A;  1XFU A;  3KEC A;  4PKR A;  1ZS0 A;  2W14 A;  1ZXC A;  1KBC A;  3LEA A;  2JIH A;  3VTG A;  1EUB A;  3AYU A;  2Y6D A;  2MLR A;  2PJT A;  1K7Q A;  2Z2D A;  2OY4 A;  3NX7 A;  4XM8 A;  1K7I A;  5BPA A;  4H82 A;  5B5O A;  4J4M A;  1D5J A;  1B3D A;  1QJJ A;  1XUC A;  1USN A;  2OY2 A;  2W0D A;  5I4O A;  1CIZ A;  3OHL A;  2OXZ A;  4JP4 A;  4L19 A;  1RMZ A;  1BIW A;  1MNC A;  3LQ0 A;  3USN A;  2WOA A;  3LMC A;  1G4K A;  1ZXV A;  1CAQ A;  3B92 A;  1BQQ M;  1XFY A;  4I35 A;  3DPE A;  3O64 A;  4DV8 A;  1O0Q A;  3GBO A;  1OM8 A;  3LJT A;  1ZVX A;  1YOU A;  1DTH A;  1FLS A;  2Y6C A;  5JMY A;  3DL1 A;  1C7K A;  1A85 A;  3HBV P;  3DPF A;  3F19 A;  1SU3 A;  2RJQ A;  4I03 A;  3L0T A;  1HFS A;  3EDI A;  1BKC I;  1G05 A;  3WV2 A;  2JT6 A;  1BUD A;  4GF1 A;  1K7G A;  3O2X A;  1OM6 A;  3P24 A;  1XFZ A;  3E8R A;  3K7N A;  4FU4 A;  4GWN A;  4XM7 A;  4A7B A;  1JAO A;  5D1T A;  1KUF A;  2OZR A;  4A3W A;  2JT5 A;  4ON1 A;  1Y93 A;  2RJP A;  5I0L A;  3RTT A;  1R1I A;  1HOV A;  2OI0 A;  3EDZ A;  2OW9 A;  2WO9 A;  4GR8 A;  1HV5 A;  4FXQ A;  4H76 A;  1Q3A A;  1JAQ A;  2ERQ A;  5B5P A;  1GKD A;  3B8Z A;  3EHY A;  4PKU A;  1J7N A;  1QJI A;  1XFX A;  5D1S A;  1KUK A;  3CKI A;  4ZR5 A;  1IAA A;  2FV5 A;  5L7F A;  1BKC A;  1WNI A;  5D3C A;  1MMR A;  3B2Z A;  1D8F A;  2AYK A;  3LJG A;  4XBH A;  5D7W A;  2DW2 A;  5I3M A;  2MZE A;  5CXA A;  3G42 A;  3HY9 A;  3K7L A;  2QPJ A;  5LAB A;  3F15 A;  4IUW A;  1A86 A;  3LJZ A;  1EAK A;  4WKE A;  1XUD A;  2W13 A;  3Q2G A;  3VI1 A;  4AYK A;  2DDY A;  5BOT A;  2DW0 A;  2HU6 A;  1SRP A;  1G9K A;  1RM8 A;  1FBL A;  3TT4 A;  3DSL A;  1PWP A;  1AST A;  3I7G A;  2CKI A;  1IAD A;  2OXU A;  3F1A A;  3LE9 A;  1JIW P;  5I2Z A;  1YCM A;  3KHI A;  1IAB A;  1YP1 A;  3HDA P;  3EDG A;  1AYK A;  2WO8 A;  1HY7 A;  830C A;  3LK8 A;  1I1I P;  1JJ9 A;  4AIG A;  4QKZ A;  4WF6 A;  3HYG A;  4AUO A;  1JKY A;  1BQO A;  4G9L A;  1OMJ A;  1ZP5 A;  4PKV A;  3WV3 A;  2J0T A;  3ZVS A;  4PKQ A;  4FXY P;  1GE5 A;  1ROS A;  3LUM A;  1BM6 A;  1Y0V A;  1PWV A;  1R1H A;  4H49 A;  2OVZ A;  1G12 A;  1OM7 A;  1XUR A;  2DDF A;  1BUV M;  2POJ A;  4GQL A;  4Q1L A;  3RTS A;  1CGL A;  3KMC A;  2OW0 A;  4HMA A;  3TSK A;  2MLS A;  3N2U A;  2D1N A;  1GE7 A;  3V96 B;  1R54 A;  1QIC A;  1JH1 A;  1SMP A;  3KME A;  2MZH A;  1QIB A;  3HB2 P;  5BOY A;  1ATL A;  5L79 A;  4L63 A;  4H84 A;  4PKW A;  1JIZ A;  4JIJ A;  2OXW A;  4WKI A;  3EWJ A;  1JAP A;  4PKS A;  4DPE A;  2TCL A;  3TVC A;  1CQR A;  1YQY A;  2K2G A;  5D2B A;  2YIG A;  3ZUK A;  3LIR A;  1MMB A;  3L0V A;  4H30 A;  1CXV A;  2L0R A;  5CZM A;  1IAE A;  1BSW A;  3HBU P;  2V4B A;  4GWM A;  1AKL A;  3AIG A;  4R3V A;  1HTD A;  4DD8 A;  1GXD A;  1FM1 A;  1ND1 A;  1I73 A;  1GKC A;  1R1J A;  1UTT A;  1UEA A;  4ILW D;  4IN9 A;  3MA2 A;  4H3X A;  2E2D A;  1UTZ A;  1BKC E;  2YB9 A;  3F17 A;  4CTH A;  1ZTQ A;  4WZV A;  1XFV A;  2ERP A;  3U1R A;  2X7M A;  2E3X A;  2SRT A;  1OO9 A;  3LUN A;  2JSD A;  1D7X A;  1QIA A;  3EDH A;  2X3A A;  3LGP A;  4JPA A;  1BZS A;  966C A;  3F16 A;  1UMS A;  3WV1 A;  1PWU A;  3F18 A;  1S4B P;  1SLM A;  1B8Y A;  3BA0 A;  4GR3 A;  4HX3 A;  1GO8 P;  2A8H A;  2MZI A;  3KRY A;  2DW1 A;  1MMP A;  1PWQ A;  1GO7 P;  1CK7 A;  3LKA A;  5H8X A;  2W15 A;  4DF9 A;  3G5C A;  2USN A;  2OW2 A;  3KEJ A;  4G0D A;  4JA1 A;  1O0T A;  3HDB A;  3ZXH A;  1HFC A;  3HY7 A;  2XS3 A;  4XM6 A;  3LQB A;  4FVL A;  5I12 A;  2KRJ A; 
#chains in the Genus database with same CATH topology
 1KUI A;  2FV9 A;  3KEK A;  1KUG A;  3I7I A;  3ELM A;  4EFS A;  3TS4 A;  4IJO A;  3P1V A;  3LIK A;  1G49 A;  3LIL A;  2D1O A;  1DMT A;  2ERO A;  1UMT A;  3UVC A;  4H2E A;  4H1Q A;  1QUA A;  1IAG A;  3DWB A;  1CGE A;  1L6J A;  1CGF A;  3DNG A;  1PWW A;  2XS4 A;  4WK7 A;  2K9C A;  4GR0 A;  1JAN A;  1Z3J A;  2X3B A;  4JQG A;  1MMQ A;  1OS9 A;  4GUY A;  1H71 P;  1D8M A;  3N2V A;  5CUH A;  3EHX A;  2CLT A;  3AYK A;  5D1U A;  3SHI A;  4XCT A;  1R55 A;  5I43 A;  2N8R A;  3OHO A;  1Y8J A;  1AF0 A;  1C3I A;  1KUH A;  1C8T A;  2X3C A;  1XFW A;  2I47 A;  1KAP P;  3Q2H A;  2O36 A;  2AIG P;  1SAT A;  4AXQ A;  1SLN A;  3KWV C;  2W12 A;  4PKT A;  1EB6 A;  2O3E A;  1I76 A;  4L6T A;  2OW1 A;  456C A;  1IAC A;  1JK3 A;  2OVX A;  2JNP A;  1GE6 A;  2J83 A;  1OS2 A;  1XFU A;  3KEC A;  4PKR A;  1ZS0 A;  2W14 A;  1ZXC A;  1KBC A;  3LEA A;  2JIH A;  3VTG A;  1EUB A;  3AYU A;  2Y6D A;  2MLR A;  2PJT A;  1K7Q A;  2Z2D A;  2OY4 A;  3NX7 A;  4XM8 A;  1K7I A;  5BPA A;  4H82 A;  5B5O A;  4J4M A;  1D5J A;  1B3D A;  1QJJ A;  1XUC A;  1USN A;  2OY2 A;  2W0D A;  5I4O A;  1CIZ A;  3OHL A;  2OXZ A;  4JP4 A;  4L19 A;  1RMZ A;  1BIW A;  1TVI A;  1MNC A;  3LQ0 A;  3USN A;  2WOA A;  3LMC A;  1G4K A;  1ZXV A;  1CAQ A;  3B92 A;  1BQQ M;  1XFY A;  4I35 A;  3DPE A;  3O64 A;  4DV8 A;  1O0Q A;  3GBO A;  1OM8 A;  3LJT A;  1ZVX A;  1YOU A;  1DTH A;  1FLS A;  2Y6C A;  5JMY A;  3DL1 A;  1C7K A;  1A85 A;  3HBV P;  3DPF A;  3F19 A;  1SU3 A;  2RJQ A;  4I03 A;  3L0T A;  1HFS A;  3EDI A;  1BKC I;  1G05 A;  3WV2 A;  2JT6 A;  1BUD A;  4GF1 A;  1K7G A;  3O2X A;  1OM6 A;  3P24 A;  1XFZ A;  3E8R A;  3K7N A;  4FU4 A;  4GWN A;  4XM7 A;  4A7B A;  1JAO A;  5D1T A;  1KUF A;  2OZR A;  4A3W A;  2JT5 A;  4ON1 A;  1Y93 A;  2RJP A;  5I0L A;  3RTT A;  1R1I A;  1HOV A;  2OI0 A;  3DTE A;  3EDZ A;  2OW9 A;  2WO9 A;  4GR8 A;  1HV5 A;  4FXQ A;  4H76 A;  1Q3A A;  1JAQ A;  2ERQ A;  5B5P A;  1GKD A;  3B8Z A;  3EHY A;  4PKU A;  1J7N A;  1QJI A;  1XFX A;  5D1S A;  1KUK A;  3CKI A;  4ZR5 A;  1IAA A;  2FV5 A;  5L7F A;  1BKC A;  1WNI A;  5D3C A;  1MMR A;  3B2Z A;  1D8F A;  2AYK A;  3LJG A;  4XBH A;  5D7W A;  2DW2 A;  5I3M A;  2MZE A;  5CXA A;  3DTI A;  3G42 A;  3HY9 A;  3K7L A;  2QPJ A;  3DTK A;  5LAB A;  3F15 A;  4IUW A;  1A86 A;  2YUF A;  3LJZ A;  1EAK A;  4WKE A;  1XUD A;  2W13 A;  3Q2G A;  3VI1 A;  4AYK A;  2DDY A;  5BOT A;  2DW0 A;  2HU6 A;  1SRP A;  1G9K A;  1RM8 A;  1FBL A;  3TT4 A;  3DSL A;  1PWP A;  1AST A;  3I7G A;  4L7A A;  2CKI A;  1IAD A;  2OXU A;  3F1A A;  3LE9 A;  1JIW P;  5I2Z A;  1YCM A;  3KHI A;  1IAB A;  1YP1 A;  3HDA P;  3EDG A;  1AYK A;  2WO8 A;  1HY7 A;  830C A;  3LK8 A;  1I1I P;  1XAX A;  1JJ9 A;  4AIG A;  4QKZ A;  4WF6 A;  3HYG A;  4AUO A;  1JKY A;  1BQO A;  4G9L A;  1OMJ A;  1ZP5 A;  4PKV A;  3WV3 A;  2J0T A;  3ZVS A;  4PKQ A;  4FXY P;  1GE5 A;  1ROS A;  3LUM A;  1BM6 A;  1Y0V A;  1PWV A;  1R1H A;  4H49 A;  2OVZ A;  1G12 A;  1OM7 A;  1XUR A;  2DDF A;  1BUV M;  2POJ A;  4GQL A;  4Q1L A;  3RTS A;  1CGL A;  3KMC A;  2OW0 A;  4HMA A;  3TSK A;  2MLS A;  3N2U A;  2D1N A;  1GE7 A;  3V96 B;  1R54 A;  1QIC A;  1JH1 A;  1OZ9 A;  1SMP A;  3KME A;  2MZH A;  1QIB A;  3HB2 P;  5BOY A;  1ATL A;  5L79 A;  4L63 A;  4H84 A;  4PKW A;  1JIZ A;  4JIJ A;  2OXW A;  4WKI A;  3EWJ A;  1JAP A;  4PKS A;  4DPE A;  2TCL A;  3TVC A;  1CQR A;  1YQY A;  2K2G A;  5D2B A;  2YIG A;  3ZUK A;  3LIR A;  1MMB A;  3L0V A;  4H30 A;  1CXV A;  2L0R A;  5CZM A;  1IAE A;  1BSW A;  3HBU P;  2V4B A;  4GWM A;  1AKL A;  3AIG A;  4R3V A;  1HTD A;  4DD8 A;  1GXD A;  1FM1 A;  1ND1 A;  1I73 A;  1GKC A;  1R1J A;  1UTT A;  1UEA A;  4ILW D;  4IN9 A;  3MA2 A;  4H3X A;  2E2D A;  1UTZ A;  1BKC E;  2YB9 A;  3F17 A;  4CTH A;  1ZTQ A;  4WZV A;  1XFV A;  2ERP A;  3U1R A;  2X7M A;  2E3X A;  2SRT A;  1OO9 A;  3LUN A;  2JSD A;  1D7X A;  1QIA A;  3EDH A;  2X3A A;  3LGP A;  4JPA A;  1BZS A;  966C A;  3F16 A;  1UMS A;  3WV1 A;  1PWU A;  3F18 A;  1S4B P;  1SLM A;  1B8Y A;  3BA0 A;  4GR3 A;  4HX3 A;  1GO8 P;  2A8H A;  2MZI A;  3KRY A;  2DW1 A;  1MMP A;  1PWQ A;  1GO7 P;  1CK7 A;  3LKA A;  5H8X A;  2W15 A;  4DF9 A;  3G5C A;  1XM5 A;  2USN A;  2OW2 A;  3KEJ A;  4G0D A;  4JA1 A;  1O0T A;  3HDB A;  3ZXH A;  1HFC A;  3HY7 A;  2XS3 A;  4XM6 A;  3LQB A;  4FVL A;  5I12 A;  2KRJ A; 
#chains in the Genus database with same CATH homology
 1KUI A;  2FV9 A;  3KEK A;  1KUG A;  3I7I A;  3ELM A;  4EFS A;  3TS4 A;  4IJO A;  3P1V A;  3LIK A;  1G49 A;  3LIL A;  2D1O A;  1DMT A;  2ERO A;  1UMT A;  3UVC A;  4H2E A;  4H1Q A;  1QUA A;  1IAG A;  3DWB A;  1CGE A;  1L6J A;  1CGF A;  3DNG A;  1PWW A;  2XS4 A;  4WK7 A;  2K9C A;  4GR0 A;  1JAN A;  1Z3J A;  2X3B A;  4JQG A;  1MMQ A;  1OS9 A;  4GUY A;  1H71 P;  1D8M A;  3N2V A;  5CUH A;  3EHX A;  2CLT A;  3AYK A;  5D1U A;  3SHI A;  4XCT A;  1R55 A;  5I43 A;  2N8R A;  3OHO A;  1Y8J A;  1AF0 A;  1C3I A;  1KUH A;  1C8T A;  2X3C A;  1XFW A;  2I47 A;  1KAP P;  3Q2H A;  2O36 A;  2AIG P;  1SAT A;  4AXQ A;  1SLN A;  3KWV C;  2W12 A;  4PKT A;  1EB6 A;  2O3E A;  1I76 A;  4L6T A;  2OW1 A;  456C A;  1IAC A;  1JK3 A;  2OVX A;  2JNP A;  1GE6 A;  2J83 A;  1OS2 A;  1XFU A;  3KEC A;  4PKR A;  1ZS0 A;  2W14 A;  1ZXC A;  1KBC A;  3LEA A;  2JIH A;  3VTG A;  1EUB A;  3AYU A;  2Y6D A;  2MLR A;  2PJT A;  1K7Q A;  2Z2D A;  2OY4 A;  3NX7 A;  4XM8 A;  1K7I A;  5BPA A;  4H82 A;  5B5O A;  4J4M A;  1D5J A;  1B3D A;  1QJJ A;  1XUC A;  1USN A;  2OY2 A;  2W0D A;  5I4O A;  1CIZ A;  3OHL A;  2OXZ A;  4JP4 A;  4L19 A;  1RMZ A;  1BIW A;  1MNC A;  3LQ0 A;  3USN A;  2WOA A;  3LMC A;  1G4K A;  1ZXV A;  1CAQ A;  3B92 A;  1BQQ M;  1XFY A;  4I35 A;  3DPE A;  3O64 A;  4DV8 A;  1O0Q A;  3GBO A;  1OM8 A;  3LJT A;  1ZVX A;  1YOU A;  1DTH A;  1FLS A;  2Y6C A;  5JMY A;  3DL1 A;  1C7K A;  1A85 A;  3HBV P;  3DPF A;  3F19 A;  1SU3 A;  2RJQ A;  4I03 A;  3L0T A;  1HFS A;  3EDI A;  1BKC I;  1G05 A;  3WV2 A;  2JT6 A;  1BUD A;  4GF1 A;  1K7G A;  3O2X A;  1OM6 A;  3P24 A;  1XFZ A;  3E8R A;  3K7N A;  4FU4 A;  4GWN A;  4XM7 A;  4A7B A;  1JAO A;  5D1T A;  1KUF A;  2OZR A;  4A3W A;  2JT5 A;  4ON1 A;  1Y93 A;  2RJP A;  5I0L A;  3RTT A;  1R1I A;  1HOV A;  2OI0 A;  3DTE A;  3EDZ A;  2OW9 A;  2WO9 A;  4GR8 A;  1HV5 A;  4FXQ A;  4H76 A;  1Q3A A;  1JAQ A;  2ERQ A;  5B5P A;  1GKD A;  3B8Z A;  3EHY A;  4PKU A;  1J7N A;  1QJI A;  1XFX A;  5D1S A;  1KUK A;  3CKI A;  4ZR5 A;  1IAA A;  2FV5 A;  5L7F A;  1BKC A;  1WNI A;  5D3C A;  1MMR A;  3B2Z A;  1D8F A;  2AYK A;  3LJG A;  4XBH A;  5D7W A;  2DW2 A;  5I3M A;  2MZE A;  5CXA A;  3DTI A;  3G42 A;  3HY9 A;  3K7L A;  2QPJ A;  3DTK A;  5LAB A;  3F15 A;  4IUW A;  1A86 A;  2YUF A;  3LJZ A;  1EAK A;  4WKE A;  1XUD A;  2W13 A;  3Q2G A;  3VI1 A;  4AYK A;  2DDY A;  5BOT A;  2DW0 A;  2HU6 A;  1SRP A;  1G9K A;  1RM8 A;  1FBL A;  3TT4 A;  3DSL A;  1PWP A;  1AST A;  3I7G A;  4L7A A;  2CKI A;  1IAD A;  2OXU A;  3F1A A;  3LE9 A;  1JIW P;  5I2Z A;  1YCM A;  3KHI A;  1IAB A;  1YP1 A;  3HDA P;  3EDG A;  1AYK A;  2WO8 A;  1HY7 A;  830C A;  3LK8 A;  1I1I P;  1JJ9 A;  4AIG A;  4QKZ A;  4WF6 A;  3HYG A;  4AUO A;  1JKY A;  1BQO A;  4G9L A;  1OMJ A;  1ZP5 A;  4PKV A;  3WV3 A;  2J0T A;  3ZVS A;  4PKQ A;  4FXY P;  1GE5 A;  1ROS A;  3LUM A;  1BM6 A;  1Y0V A;  1PWV A;  1R1H A;  4H49 A;  2OVZ A;  1G12 A;  1OM7 A;  1XUR A;  2DDF A;  1BUV M;  2POJ A;  4GQL A;  4Q1L A;  3RTS A;  1CGL A;  3KMC A;  2OW0 A;  4HMA A;  3TSK A;  2MLS A;  3N2U A;  2D1N A;  1GE7 A;  3V96 B;  1R54 A;  1QIC A;  1JH1 A;  1SMP A;  3KME A;  2MZH A;  1QIB A;  3HB2 P;  5BOY A;  1ATL A;  5L79 A;  4L63 A;  4H84 A;  4PKW A;  1JIZ A;  4JIJ A;  2OXW A;  4WKI A;  3EWJ A;  1JAP A;  4PKS A;  4DPE A;  2TCL A;  3TVC A;  1CQR A;  1YQY A;  2K2G A;  5D2B A;  2YIG A;  3ZUK A;  3LIR A;  1MMB A;  3L0V A;  4H30 A;  1CXV A;  2L0R A;  5CZM A;  1IAE A;  1BSW A;  3HBU P;  2V4B A;  4GWM A;  1AKL A;  3AIG A;  4R3V A;  1HTD A;  4DD8 A;  1GXD A;  1FM1 A;  1ND1 A;  1I73 A;  1GKC A;  1R1J A;  1UTT A;  1UEA A;  4ILW D;  4IN9 A;  3MA2 A;  4H3X A;  2E2D A;  1UTZ A;  1BKC E;  2YB9 A;  3F17 A;  4CTH A;  1ZTQ A;  4WZV A;  1XFV A;  2ERP A;  3U1R A;  2X7M A;  2E3X A;  2SRT A;  1OO9 A;  3LUN A;  2JSD A;  1D7X A;  1QIA A;  3EDH A;  2X3A A;  3LGP A;  4JPA A;  1BZS A;  966C A;  3F16 A;  1UMS A;  3WV1 A;  1PWU A;  3F18 A;  1S4B P;  1SLM A;  1B8Y A;  3BA0 A;  4GR3 A;  4HX3 A;  1GO8 P;  2A8H A;  2MZI A;  3KRY A;  2DW1 A;  1MMP A;  1PWQ A;  1GO7 P;  1CK7 A;  3LKA A;  5H8X A;  2W15 A;  4DF9 A;  3G5C A;  2USN A;  2OW2 A;  3KEJ A;  4G0D A;  4JA1 A;  1O0T A;  3HDB A;  3ZXH A;  1HFC A;  3HY7 A;  2XS3 A;  4XM6 A;  3LQB A;  4FVL A;  5I12 A;  2KRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...