3EDGA

Crystal structure of bone morphogenetic protein 1 protease domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
201
structure length
195
Chain Sequence
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEKPPIGQRTRLSKGDIAQARKLYKCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein 1
publication title Structural basis for the substrate specificity of bone morphogenetic protein 1/tolloid-like metalloproteases
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 195
sequence length 201
ec nomenclature ec 3.4.24.19: Procollagen C-endopeptidase.
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3edgA00
1BKCI 3F19A 1PWUA 1UTZA 3ZXHA 2JSDA 2O3EA 2MLRA 2MLSA 2YB9A 3TVCA 1ATLA 3LQ0A 3TSKA 3K7NA 2ERQA 1DMTA 1USNA 3LGPA 2OZRA 3KWVC 4G9LA 3DPFA 1DTHA 4XM7A 1XUDA 3K7LA 1HFCA 3EDHA 2RJQA 2OW9A 1OMJA 4GR3A 4J4MA 2J0TA 2CLTA 2O36A 3F15A 3B92A 1H71P 4XCTA 1Y0VA 1R1HA 1B3DA 2DDFA 1ZXVA 3HBUP 2Y6CA 1JAOA 4XBHA 3HDBA 3RTTA 1K7GA 1YOUA 1BZSA 2DW1A 4GQLA 4ON1A 2N8RA 5B5PA 4A7BA 1BSWA 4I03A 1HTDA 1R1IA 3EHYA 2W13A 4GF1A 3B8ZA 966CA 1MMBA 4XM6A 1FLSA 1IACA 4GWMA 3ZVSA 3OHLA 1BKCA 3N2UA 1SLNA 4G0DA 3L0VA 1C3IA 4FVLA 1SMPA 1K7QA 2X3AA 1PWVA 4HMAA 4L63A 3LEAA 1JKYA 2W0DA 3LE9A 1KUFA 1YCMA 1R55A 1OM8A 3LMCA 1D5JA 2JT5A 3BA0A 1BQQM 1BKCE 1UMSA 1MMPA 3AYUA 2EROA 4FXYP 1GO8P 3EDZA 1C7KA 1OM6A 1XFWA 4JQGA 4WK7A 3LIKA 5I12A 1CIZA 3E8RA 2OY4A 1Y8JA 2K9CA 1G49A 3KHIA 3LJGA 4CTHA 2D1OA 1HFSA 1CGEA 1IADA 4GWNA 3F16A 1SU3A 2K2GA 3RTSA 1CGFA 1CAQA 4WF6A 1ZVXA 3F18A 5JMYA 3HY9A 1ZXCA 3ELMA 1QIAA 3KMEA 2WOAA 1UMTA 1GKCA 2FV9A 1EAKA 4JP4A 3WV2A 3HDAP 3LILA 4HX3A 2OXZA 1QJIA 1GXDA 4PKRA 3MA2A 1JK3A 2X7MA 3DWBA 3KMCA 3L0TA 1I73A 3LKAA 5D1TA 2CKIA 1OS9A 1D8FA 2OVZA 4AXQA 2W14A 1C8TA 3I7GA 5D1SA 2OXWA 5D1UA 1ZS0A 1CQRA 2TCLA 1SRPA 3UVCA 5I43A 4WZVA 1JIWP 1XFXA 4QKZA 1KUIA 2OY2A 1YP1A 5CZMA 4H2EA 456CA 2YIGA 1IAEA 3KEJA 4DV8A 1JAPA 1GKDA 4ZR5A 2ERPA 2J83A 2OI0A 2WO8A 1JH1A 4PKVA 1I76A 2DDYA 3B2ZA 1PWQA 1SLMA 4H1QA 1BQOA 2QPJA 4I35A 1GE7A 2X3BA 3KRYA 4AIGA 3LJZA 3LUMA 5BOYA 2WO9A 1JIZA 3U1RA 1KUHA 4GUYA 5BOTA 3F17A 3P1VA 2OXUA 2USNA 3HY7A 2OW0A 3F1AA 1G05A 3EDIA 3O2XA 2OW1A 2D1NA 1O0QA 1O0TA 3LQBA 3EHXA 1EUBA 3NX7A 4L19A 5D7WA 2JT6A 3Q2GA 3V96B 3TS4A 1K7IA 1HY7A 1AF0A 2W15A 4H49A 1I1IP 1B8YA 1XURA 5CUHA 3USNA 2RJPA 5BPAA 3KEKA 1G4KA 3TT4A 1D8MA 4FXQA 2DW2A 1RM8A 4EFSA 1CXVA 1XFUA 4WKEA 1XUCA 1GE6A 3DNGA 4DPEA 1JANA 4GR0A 1MMQA 3G42A 1CGLA 2Z2DA 1ZTQA 4PKQA 3EDGA 3CKIA 2POJA 3VI1A 4JIJA 2OW2A 3I7IA 1UTTA 2A8HA 1OO9A 3WV1A 2Y6DA 3KECA 5L79A 1XFVA 1XFZA 1QICA 1QIBA 2FV5A 1AKLA 1GO7P 1R54A 4XM8A 1OM7A 1HOVA 5B5OA 4Q1LA 2E3XA 5L7FA 1G12A 3P24A 830CA 4PKUA 3N2VA 4R3VA 1IABA 1YQYA 2MZHA 1Q3AA 4PKTA 1FBLA 3WV3A 4H84A 1Y93A 2OVXA 1KAPP 3DPEA 4JPAA 2E2DA 2AYKA 1HV5A 2PJTA 2MZIA 4WKIA 5CXAA 1S4BP 1MMRA 1UEAA 1JJ9A 4AYKA 1QUAA 1KBCA 1SATA 3DL1A 5H8XA 1CK7A 2V4BA 3Q2HA 1WNIA 4L6TA 3SHIA 2JIHA 1IAAA 1L6JA 4IJOA 3HB2P 1IAGA 4DF9A 2MZEA 4DD8A 2I47A 2X3CA 4A3WA 1FM1A 5I4OA 1G9KA 3LK8A 4PKWA 4IN9A 2JNPA 1KUKA 1OS2A 4AUOA 4H82A 3GBOA 1PWPA 4H3XA 1BM6A 1J7NA 2KRJA 3O64A 1JAQA 1ND1A 3LUNA 1ASTA 1PWWA 1GE5A 3AYKA 1R1JA 4FU4A 5D3CA 3VTGA 3DSLA 3G5CA 3EWJA 4H30A 3AIGA 1A86A 1KUGA 1BUDA 1QJJA 2W12A 4ILWD 1D7XA 2HU6A 1MNCA 3OHOA 2L0RA 1BIWA 5LABA 1Z3JA 1XFYA 4JA1A 2DW0A 2XS3A 3HYGA 1EB6A 1ZP5A 1BUVM 3LIRA 3HBVP 4H76A 3LJTA 4IUWA 3ZUKA 2SRTA 5I3MA 1RMZA 2XS4A 5D2BA 4PKSA 5I0LA 4GR8A 1AYKA 5I2ZA 2AIGP 1A85A 1ROSA
chains in the Genus database with same CATH superfamily
1BKCI 3F19A 1PWUA 1UTZA 3ZXHA 2JSDA 2O3EA 2MLRA 2MLSA 2YB9A 3TVCA 1ATLA 3LQ0A 3TSKA 3K7NA 2ERQA 1DMTA 1USNA 3LGPA 2OZRA 3KWVC 4G9LA 3DPFA 1DTHA 4XM7A 1XUDA 3K7LA 1HFCA 3EDHA 2RJQA 2OW9A 1OMJA 4GR3A 4J4MA 2J0TA 2CLTA 2O36A 3F15A 3B92A 1H71P 4XCTA 1Y0VA 1R1HA 1B3DA 2DDFA 1ZXVA 3HBUP 2Y6CA 1JAOA 4XBHA 3HDBA 3RTTA 1K7GA 1YOUA 1BZSA 2DW1A 4GQLA 4ON1A 2N8RA 5B5PA 4A7BA 1BSWA 4I03A 1HTDA 1R1IA 3EHYA 2W13A 4GF1A 3B8ZA 966CA 1XAXA 1MMBA 4XM6A 1FLSA 1IACA 4GWMA 3ZVSA 3OHLA 1BKCA 3N2UA 1SLNA 4G0DA 3L0VA 1C3IA 4FVLA 1SMPA 1K7QA 2X3AA 1PWVA 4HMAA 4L63A 3LEAA 1JKYA 2W0DA 3LE9A 1KUFA 1YCMA 1R55A 1OM8A 3LMCA 1D5JA 2JT5A 3BA0A 1BQQM 1BKCE 1UMSA 1MMPA 3AYUA 2EROA 4FXYP 1GO8P 3EDZA 1C7KA 1OM6A 1XFWA 4JQGA 4WK7A 3LIKA 5I12A 1CIZA 3E8RA 2OY4A 1Y8JA 2K9CA 1G49A 3KHIA 3LJGA 4CTHA 2D1OA 1HFSA 1CGEA 1IADA 4GWNA 3F16A 1SU3A 2K2GA 3RTSA 1CGFA 1CAQA 4WF6A 1ZVXA 3F18A 5JMYA 3HY9A 1ZXCA 3ELMA 1QIAA 3KMEA 2WOAA 1UMTA 1GKCA 2FV9A 1EAKA 4JP4A 3WV2A 3HDAP 3LILA 4HX3A 2OXZA 1QJIA 1GXDA 4PKRA 3MA2A 1JK3A 2X7MA 3DWBA 3KMCA 3L0TA 1I73A 3LKAA 5D1TA 2CKIA 1OS9A 1D8FA 2OVZA 4AXQA 2W14A 1C8TA 3I7GA 5D1SA 2OXWA 5D1UA 1ZS0A 1CQRA 2TCLA 1SRPA 3UVCA 5I43A 4WZVA 1JIWP 1XFXA 4QKZA 1KUIA 2OY2A 1YP1A 5CZMA 4H2EA 456CA 2YIGA 1IAEA 3KEJA 4DV8A 1JAPA 1GKDA 4ZR5A 2ERPA 2J83A 2OI0A 2WO8A 1JH1A 4PKVA 1I76A 2DDYA 3B2ZA 1PWQA 1SLMA 4H1QA 1BQOA 2QPJA 4I35A 1GE7A 2X3BA 3KRYA 4AIGA 3LJZA 3LUMA 5BOYA 2WO9A 1JIZA 3U1RA 1KUHA 4GUYA 5BOTA 3F17A 3P1VA 2OXUA 2USNA 3HY7A 2OW0A 3F1AA 1G05A 3EDIA 3O2XA 2OW1A 2D1NA 1O0QA 1O0TA 3LQBA 3EHXA 1EUBA 3NX7A 4L19A 5D7WA 2JT6A 3Q2GA 3V96B 3TS4A 1K7IA 1HY7A 1AF0A 2W15A 4H49A 1I1IP 1B8YA 1XURA 5CUHA 3USNA 2RJPA 5BPAA 3KEKA 1G4KA 3TT4A 1D8MA 4FXQA 2DW2A 1RM8A 4EFSA 1CXVA 1XFUA 4WKEA 1XUCA 1GE6A 3DNGA 4DPEA 1JANA 4GR0A 1MMQA 3G42A 1CGLA 2Z2DA 1ZTQA 4PKQA 3EDGA 1XM5A 3CKIA 2POJA 3VI1A 3DTEA 4JIJA 2OW2A 3I7IA 1UTTA 2A8HA 4L7AA 1OO9A 3WV1A 2Y6DA 3KECA 5L79A 1XFVA 1XFZA 1QICA 1QIBA 2FV5A 1AKLA 1GO7P 1R54A 3DTKA 4XM8A 1OM7A 1HOVA 5B5OA 4Q1LA 2E3XA 1TVIA 5L7FA 1G12A 3P24A 830CA 4PKUA 3N2VA 4R3VA 1IABA 1YQYA 2MZHA 1Q3AA 4PKTA 3DTIA 1FBLA 3WV3A 4H84A 1Y93A 2OVXA 1KAPP 3DPEA 4JPAA 2E2DA 2AYKA 1HV5A 2PJTA 2MZIA 4WKIA 5CXAA 1S4BP 1MMRA 1UEAA 1JJ9A 4AYKA 1QUAA 1KBCA 1SATA 3DL1A 5H8XA 1CK7A 2V4BA 3Q2HA 2YUFA 1WNIA 4L6TA 3SHIA 2JIHA 1IAAA 1L6JA 4IJOA 3HB2P 1IAGA 4DF9A 2MZEA 4DD8A 2I47A 2X3CA 4A3WA 1FM1A 5I4OA 1G9KA 3LK8A 4PKWA 4IN9A 2JNPA 1KUKA 1OS2A 4AUOA 4H82A 3GBOA 1PWPA 4H3XA 1BM6A 1J7NA 2KRJA 3O64A 1JAQA 1ND1A 3LUNA 1ASTA 1PWWA 1GE5A 3AYKA 1R1JA 4FU4A 5D3CA 3VTGA 3DSLA 3G5CA 3EWJA 4H30A 3AIGA 1A86A 1KUGA 1BUDA 1QJJA 2W12A 4ILWD 1D7XA 2HU6A 1MNCA 3OHOA 2L0RA 1BIWA 5LABA 1Z3JA 1XFYA 4JA1A 2DW0A 2XS3A 3HYGA 1EB6A 1ZP5A 1BUVM 3LIRA 3HBVP 4H76A 3LJTA 4IUWA 3ZUKA 2SRTA 5I3MA 1RMZA 2XS4A 5D2BA 4PKSA 5I0LA 4GR8A 1AYKA 5I2ZA 1OZ9A 2AIGP 1A85A 1ROSA
chains in the Genus database with same CATH topology
1BKCI 3F19A 1PWUA 1UTZA 3ZXHA 2JSDA 2O3EA 2MLRA 2MLSA 2YB9A 3TVCA 1ATLA 3LQ0A 3TSKA 3K7NA 2ERQA 1DMTA 1USNA 3LGPA 2OZRA 3KWVC 4G9LA 3DPFA 1DTHA 4XM7A 1XUDA 3K7LA 1HFCA 3EDHA 2RJQA 2OW9A 1OMJA 4GR3A 4J4MA 2J0TA 2CLTA 2O36A 3F15A 3B92A 1H71P 4XCTA 1Y0VA 1R1HA 1B3DA 2DDFA 1ZXVA 3HBUP 2Y6CA 1JAOA 4XBHA 3HDBA 3RTTA 1K7GA 1YOUA 1BZSA 2DW1A 4GQLA 4ON1A 2N8RA 5B5PA 4A7BA 1BSWA 4I03A 1HTDA 1R1IA 3EHYA 2W13A 4GF1A 3B8ZA 966CA 1MMBA 4XM6A 1FLSA 1IACA 4GWMA 3ZVSA 3OHLA 1BKCA 3N2UA 1SLNA 4G0DA 3L0VA 1C3IA 4FVLA 1SMPA 1K7QA 2X3AA 1PWVA 4HMAA 4L63A 3LEAA 1JKYA 2W0DA 3LE9A 1KUFA 1YCMA 1R55A 1OM8A 3LMCA 1D5JA 2JT5A 3BA0A 1BQQM 1BKCE 1UMSA 1MMPA 3AYUA 2EROA 4FXYP 1GO8P 3EDZA 1C7KA 1OM6A 1XFWA 4JQGA 4WK7A 3LIKA 5I12A 1CIZA 3E8RA 2OY4A 1Y8JA 2K9CA 1G49A 3KHIA 3LJGA 4CTHA 2D1OA 1HFSA 1CGEA 1IADA 4GWNA 3F16A 1SU3A 2K2GA 3RTSA 1CGFA 1CAQA 4WF6A 1ZVXA 3F18A 5JMYA 3HY9A 1ZXCA 3ELMA 1QIAA 3KMEA 2WOAA 1UMTA 1GKCA 2FV9A 1EAKA 4JP4A 3WV2A 3HDAP 3LILA 4HX3A 2OXZA 1QJIA 1GXDA 4PKRA 3MA2A 1JK3A 2X7MA 3DWBA 3KMCA 3L0TA 1I73A 3LKAA 5D1TA 2CKIA 1OS9A 1D8FA 2OVZA 4AXQA 2W14A 1C8TA 3I7GA 5D1SA 2OXWA 5D1UA 1ZS0A 1CQRA 2TCLA 1SRPA 3UVCA 5I43A 4WZVA 1JIWP 1XFXA 4QKZA 1KUIA 2OY2A 1YP1A 5CZMA 4H2EA 456CA 2YIGA 1IAEA 3KEJA 4DV8A 1JAPA 1GKDA 4ZR5A 2ERPA 2J83A 2OI0A 2WO8A 1JH1A 4PKVA 1I76A 2DDYA 3B2ZA 1PWQA 1SLMA 4H1QA 1BQOA 2QPJA 4I35A 1GE7A 2X3BA 3KRYA 4AIGA 3LJZA 3LUMA 5BOYA 2WO9A 1JIZA 3U1RA 1KUHA 4GUYA 5BOTA 3F17A 3P1VA 2OXUA 2USNA 3HY7A 2OW0A 3F1AA 1G05A 3EDIA 3O2XA 2OW1A 2D1NA 1O0QA 1O0TA 3LQBA 3EHXA 1EUBA 3NX7A 4L19A 5D7WA 2JT6A 3Q2GA 3V96B 3TS4A 1K7IA 1HY7A 1AF0A 2W15A 4H49A 1I1IP 1B8YA 1XURA 5CUHA 3USNA 2RJPA 5BPAA 3KEKA 1G4KA 3TT4A 1D8MA 4FXQA 2DW2A 1RM8A 4EFSA 1CXVA 1XFUA 4WKEA 1XUCA 1GE6A 3DNGA 4DPEA 1JANA 4GR0A 1MMQA 3G42A 1CGLA 2Z2DA 1ZTQA 4PKQA 3EDGA 3CKIA 2POJA 3VI1A 3DTEA 4JIJA 2OW2A 3I7IA 1UTTA 2A8HA 4L7AA 1OO9A 3WV1A 2Y6DA 3KECA 5L79A 1XFVA 1XFZA 1QICA 1QIBA 2FV5A 1AKLA 1GO7P 1R54A 3DTKA 4XM8A 1OM7A 1HOVA 5B5OA 4Q1LA 2E3XA 5L7FA 1G12A 3P24A 830CA 4PKUA 3N2VA 4R3VA 1IABA 1YQYA 2MZHA 1Q3AA 4PKTA 3DTIA 1FBLA 3WV3A 4H84A 1Y93A 2OVXA 1KAPP 3DPEA 4JPAA 2E2DA 2AYKA 1HV5A 2PJTA 2MZIA 4WKIA 5CXAA 1S4BP 1MMRA 1UEAA 1JJ9A 4AYKA 1QUAA 1KBCA 1SATA 3DL1A 5H8XA 1CK7A 2V4BA 3Q2HA 2YUFA 1WNIA 4L6TA 3SHIA 2JIHA 1IAAA 1L6JA 4IJOA 3HB2P 1IAGA 4DF9A 2MZEA 4DD8A 2I47A 2X3CA 4A3WA 1FM1A 5I4OA 1G9KA 3LK8A 4PKWA 4IN9A 2JNPA 1KUKA 1OS2A 4AUOA 4H82A 3GBOA 1PWPA 4H3XA 1BM6A 1J7NA 2KRJA 3O64A 1JAQA 1ND1A 3LUNA 1ASTA 1PWWA 1GE5A 3AYKA 1R1JA 4FU4A 5D3CA 3VTGA 3DSLA 3G5CA 3EWJA 4H30A 3AIGA 1A86A 1KUGA 1BUDA 1QJJA 2W12A 4ILWD 1D7XA 2HU6A 1MNCA 3OHOA 2L0RA 1BIWA 5LABA 1Z3JA 1XFYA 4JA1A 2DW0A 2XS3A 3HYGA 1EB6A 1ZP5A 1BUVM 3LIRA 3HBVP 4H76A 3LJTA 4IUWA 3ZUKA 2SRTA 5I3MA 1RMZA 2XS4A 5D2BA 4PKSA 5I0LA 4GR8A 1AYKA 5I2ZA 2AIGP 1A85A 1ROSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKC I;  3F19 A;  1PWU A;  1UTZ A;  3ZXH A;  2JSD A;  2O3E A;  2MLR A;  2MLS A;  2YB9 A;  3TVC A;  1ATL A;  3LQ0 A;  3TSK A;  3K7N A;  2ERQ A;  1DMT A;  1USN A;  3LGP A;  2OZR A;  3KWV C;  4G9L A;  3DPF A;  1DTH A;  4XM7 A;  1XUD A;  3K7L A;  1HFC A;  3EDH A;  2RJQ A;  2OW9 A;  1OMJ A;  4GR3 A;  4J4M A;  2J0T A;  2CLT A;  2O36 A;  3F15 A;  3B92 A;  1H71 P;  4XCT A;  1Y0V A;  1R1H A;  1B3D A;  2DDF A;  1ZXV A;  3HBU P;  2Y6C A;  1JAO A;  4XBH A;  3HDB A;  3RTT A;  1K7G A;  1YOU A;  1BZS A;  2DW1 A;  4GQL A;  4ON1 A;  2N8R A;  5B5P A;  4A7B A;  1BSW A;  4I03 A;  1HTD A;  1R1I A;  3EHY A;  2W13 A;  4GF1 A;  3B8Z A;  966C A;  1MMB A;  4XM6 A;  1FLS A;  1IAC A;  4GWM A;  3ZVS A;  3OHL A;  1BKC A;  3N2U A;  1SLN A;  4G0D A;  3L0V A;  1C3I A;  4FVL A;  1SMP A;  1K7Q A;  2X3A A;  1PWV A;  4HMA A;  4L63 A;  3LEA A;  1JKY A;  2W0D A;  3LE9 A;  1KUF A;  1YCM A;  1R55 A;  1OM8 A;  3LMC A;  1D5J A;  2JT5 A;  3BA0 A;  1BQQ M;  1BKC E;  1UMS A;  1MMP A;  3AYU A;  2ERO A;  4FXY P;  1GO8 P;  3EDZ A;  1C7K A;  1OM6 A;  1XFW A;  4JQG A;  4WK7 A;  3LIK A;  5I12 A;  1CIZ A;  3E8R A;  2OY4 A;  1Y8J A;  2K9C A;  1G49 A;  3KHI A;  3LJG A;  4CTH A;  2D1O A;  1HFS A;  1CGE A;  1IAD A;  4GWN A;  3F16 A;  1SU3 A;  2K2G A;  3RTS A;  1CGF A;  1CAQ A;  4WF6 A;  1ZVX A;  3F18 A;  5JMY A;  3HY9 A;  1ZXC A;  3ELM A;  1QIA A;  3KME A;  2WOA A;  1UMT A;  1GKC A;  2FV9 A;  1EAK A;  4JP4 A;  3WV2 A;  3HDA P;  3LIL A;  4HX3 A;  2OXZ A;  1QJI A;  1GXD A;  4PKR A;  3MA2 A;  1JK3 A;  2X7M A;  3DWB A;  3KMC A;  3L0T A;  1I73 A;  3LKA A;  5D1T A;  2CKI A;  1OS9 A;  1D8F A;  2OVZ A;  4AXQ A;  2W14 A;  1C8T A;  3I7G A;  5D1S A;  2OXW A;  5D1U A;  1ZS0 A;  1CQR A;  2TCL A;  1SRP A;  3UVC A;  5I43 A;  4WZV A;  1JIW P;  1XFX A;  4QKZ A;  1KUI A;  2OY2 A;  1YP1 A;  5CZM A;  4H2E A;  456C A;  2YIG A;  1IAE A;  3KEJ A;  4DV8 A;  1JAP A;  1GKD A;  4ZR5 A;  2ERP A;  2J83 A;  2OI0 A;  2WO8 A;  1JH1 A;  4PKV A;  1I76 A;  2DDY A;  3B2Z A;  1PWQ A;  1SLM A;  4H1Q A;  1BQO A;  2QPJ A;  4I35 A;  1GE7 A;  2X3B A;  3KRY A;  4AIG A;  3LJZ A;  3LUM A;  5BOY A;  2WO9 A;  1JIZ A;  3U1R A;  1KUH A;  4GUY A;  5BOT A;  3F17 A;  3P1V A;  2OXU A;  2USN A;  3HY7 A;  2OW0 A;  3F1A A;  1G05 A;  3EDI A;  3O2X A;  2OW1 A;  2D1N A;  1O0Q A;  1O0T A;  3LQB A;  3EHX A;  1EUB A;  3NX7 A;  4L19 A;  5D7W A;  2JT6 A;  3Q2G A;  3V96 B;  3TS4 A;  1K7I A;  1HY7 A;  1AF0 A;  2W15 A;  4H49 A;  1I1I P;  1B8Y A;  1XUR A;  5CUH A;  3USN A;  2RJP A;  5BPA A;  3KEK A;  1G4K A;  3TT4 A;  1D8M A;  4FXQ A;  2DW2 A;  1RM8 A;  4EFS A;  1CXV A;  1XFU A;  4WKE A;  1XUC A;  1GE6 A;  3DNG A;  4DPE A;  1JAN A;  4GR0 A;  1MMQ A;  3G42 A;  1CGL A;  2Z2D A;  1ZTQ A;  4PKQ A;  3EDG A;  3CKI A;  2POJ A;  3VI1 A;  4JIJ A;  2OW2 A;  3I7I A;  1UTT A;  2A8H A;  1OO9 A;  3WV1 A;  2Y6D A;  3KEC A;  5L79 A;  1XFV A;  1XFZ A;  1QIC A;  1QIB A;  2FV5 A;  1AKL A;  1GO7 P;  1R54 A;  4XM8 A;  1OM7 A;  1HOV A;  5B5O A;  4Q1L A;  2E3X A;  5L7F A;  1G12 A;  3P24 A;  830C A;  4PKU A;  3N2V A;  4R3V A;  1IAB A;  1YQY A;  2MZH A;  1Q3A A;  4PKT A;  1FBL A;  3WV3 A;  4H84 A;  1Y93 A;  2OVX A;  1KAP P;  3DPE A;  4JPA A;  2E2D A;  2AYK A;  1HV5 A;  2PJT A;  2MZI A;  4WKI A;  5CXA A;  1S4B P;  1MMR A;  1UEA A;  1JJ9 A;  4AYK A;  1QUA A;  1KBC A;  1SAT A;  3DL1 A;  5H8X A;  1CK7 A;  2V4B A;  3Q2H A;  1WNI A;  4L6T A;  3SHI A;  2JIH A;  1IAA A;  1L6J A;  4IJO A;  3HB2 P;  1IAG A;  4DF9 A;  2MZE A;  4DD8 A;  2I47 A;  2X3C A;  4A3W A;  1FM1 A;  5I4O A;  1G9K A;  3LK8 A;  4PKW A;  4IN9 A;  2JNP A;  1KUK A;  1OS2 A;  4AUO A;  4H82 A;  3GBO A;  1PWP A;  4H3X A;  1BM6 A;  1J7N A;  2KRJ A;  3O64 A;  1JAQ A;  1ND1 A;  3LUN A;  1AST A;  1PWW A;  1GE5 A;  3AYK A;  1R1J A;  4FU4 A;  5D3C A;  3VTG A;  3DSL A;  3G5C A;  3EWJ A;  4H30 A;  3AIG A;  1A86 A;  1KUG A;  1BUD A;  1QJJ A;  2W12 A;  4ILW D;  1D7X A;  2HU6 A;  1MNC A;  3OHO A;  2L0R A;  1BIW A;  5LAB A;  1Z3J A;  1XFY A;  4JA1 A;  2DW0 A;  2XS3 A;  3HYG A;  1EB6 A;  1ZP5 A;  1BUV M;  3LIR A;  3HBV P;  4H76 A;  3LJT A;  4IUW A;  3ZUK A;  2SRT A;  5I3M A;  1RMZ A;  2XS4 A;  5D2B A;  4PKS A;  5I0L A;  4GR8 A;  1AYK A;  5I2Z A;  2AIG P;  1A85 A;  1ROS A; 
#chains in the Genus database with same CATH topology
 1BKC I;  3F19 A;  1PWU A;  1UTZ A;  3ZXH A;  2JSD A;  2O3E A;  2MLR A;  2MLS A;  2YB9 A;  3TVC A;  1ATL A;  3LQ0 A;  3TSK A;  3K7N A;  2ERQ A;  1DMT A;  1USN A;  3LGP A;  2OZR A;  3KWV C;  4G9L A;  3DPF A;  1DTH A;  4XM7 A;  1XUD A;  3K7L A;  1HFC A;  3EDH A;  2RJQ A;  2OW9 A;  1OMJ A;  4GR3 A;  4J4M A;  2J0T A;  2CLT A;  2O36 A;  3F15 A;  3B92 A;  1H71 P;  4XCT A;  1Y0V A;  1R1H A;  1B3D A;  2DDF A;  1ZXV A;  3HBU P;  2Y6C A;  1JAO A;  4XBH A;  3HDB A;  3RTT A;  1K7G A;  1YOU A;  1BZS A;  2DW1 A;  4GQL A;  4ON1 A;  2N8R A;  5B5P A;  4A7B A;  1BSW A;  4I03 A;  1HTD A;  1R1I A;  3EHY A;  2W13 A;  4GF1 A;  3B8Z A;  966C A;  1XAX A;  1MMB A;  4XM6 A;  1FLS A;  1IAC A;  4GWM A;  3ZVS A;  3OHL A;  1BKC A;  3N2U A;  1SLN A;  4G0D A;  3L0V A;  1C3I A;  4FVL A;  1SMP A;  1K7Q A;  2X3A A;  1PWV A;  4HMA A;  4L63 A;  3LEA A;  1JKY A;  2W0D A;  3LE9 A;  1KUF A;  1YCM A;  1R55 A;  1OM8 A;  3LMC A;  1D5J A;  2JT5 A;  3BA0 A;  1BQQ M;  1BKC E;  1UMS A;  1MMP A;  3AYU A;  2ERO A;  4FXY P;  1GO8 P;  3EDZ A;  1C7K A;  1OM6 A;  1XFW A;  4JQG A;  4WK7 A;  3LIK A;  5I12 A;  1CIZ A;  3E8R A;  2OY4 A;  1Y8J A;  2K9C A;  1G49 A;  3KHI A;  3LJG A;  4CTH A;  2D1O A;  1HFS A;  1CGE A;  1IAD A;  4GWN A;  3F16 A;  1SU3 A;  2K2G A;  3RTS A;  1CGF A;  1CAQ A;  4WF6 A;  1ZVX A;  3F18 A;  5JMY A;  3HY9 A;  1ZXC A;  3ELM A;  1QIA A;  3KME A;  2WOA A;  1UMT A;  1GKC A;  2FV9 A;  1EAK A;  4JP4 A;  3WV2 A;  3HDA P;  3LIL A;  4HX3 A;  2OXZ A;  1QJI A;  1GXD A;  4PKR A;  3MA2 A;  1JK3 A;  2X7M A;  3DWB A;  3KMC A;  3L0T A;  1I73 A;  3LKA A;  5D1T A;  2CKI A;  1OS9 A;  1D8F A;  2OVZ A;  4AXQ A;  2W14 A;  1C8T A;  3I7G A;  5D1S A;  2OXW A;  5D1U A;  1ZS0 A;  1CQR A;  2TCL A;  1SRP A;  3UVC A;  5I43 A;  4WZV A;  1JIW P;  1XFX A;  4QKZ A;  1KUI A;  2OY2 A;  1YP1 A;  5CZM A;  4H2E A;  456C A;  2YIG A;  1IAE A;  3KEJ A;  4DV8 A;  1JAP A;  1GKD A;  4ZR5 A;  2ERP A;  2J83 A;  2OI0 A;  2WO8 A;  1JH1 A;  4PKV A;  1I76 A;  2DDY A;  3B2Z A;  1PWQ A;  1SLM A;  4H1Q A;  1BQO A;  2QPJ A;  4I35 A;  1GE7 A;  2X3B A;  3KRY A;  4AIG A;  3LJZ A;  3LUM A;  5BOY A;  2WO9 A;  1JIZ A;  3U1R A;  1KUH A;  4GUY A;  5BOT A;  3F17 A;  3P1V A;  2OXU A;  2USN A;  3HY7 A;  2OW0 A;  3F1A A;  1G05 A;  3EDI A;  3O2X A;  2OW1 A;  2D1N A;  1O0Q A;  1O0T A;  3LQB A;  3EHX A;  1EUB A;  3NX7 A;  4L19 A;  5D7W A;  2JT6 A;  3Q2G A;  3V96 B;  3TS4 A;  1K7I A;  1HY7 A;  1AF0 A;  2W15 A;  4H49 A;  1I1I P;  1B8Y A;  1XUR A;  5CUH A;  3USN A;  2RJP A;  5BPA A;  3KEK A;  1G4K A;  3TT4 A;  1D8M A;  4FXQ A;  2DW2 A;  1RM8 A;  4EFS A;  1CXV A;  1XFU A;  4WKE A;  1XUC A;  1GE6 A;  3DNG A;  4DPE A;  1JAN A;  4GR0 A;  1MMQ A;  3G42 A;  1CGL A;  2Z2D A;  1ZTQ A;  4PKQ A;  3EDG A;  1XM5 A;  3CKI A;  2POJ A;  3VI1 A;  3DTE A;  4JIJ A;  2OW2 A;  3I7I A;  1UTT A;  2A8H A;  4L7A A;  1OO9 A;  3WV1 A;  2Y6D A;  3KEC A;  5L79 A;  1XFV A;  1XFZ A;  1QIC A;  1QIB A;  2FV5 A;  1AKL A;  1GO7 P;  1R54 A;  3DTK A;  4XM8 A;  1OM7 A;  1HOV A;  5B5O A;  4Q1L A;  2E3X A;  1TVI A;  5L7F A;  1G12 A;  3P24 A;  830C A;  4PKU A;  3N2V A;  4R3V A;  1IAB A;  1YQY A;  2MZH A;  1Q3A A;  4PKT A;  3DTI A;  1FBL A;  3WV3 A;  4H84 A;  1Y93 A;  2OVX A;  1KAP P;  3DPE A;  4JPA A;  2E2D A;  2AYK A;  1HV5 A;  2PJT A;  2MZI A;  4WKI A;  5CXA A;  1S4B P;  1MMR A;  1UEA A;  1JJ9 A;  4AYK A;  1QUA A;  1KBC A;  1SAT A;  3DL1 A;  5H8X A;  1CK7 A;  2V4B A;  3Q2H A;  2YUF A;  1WNI A;  4L6T A;  3SHI A;  2JIH A;  1IAA A;  1L6J A;  4IJO A;  3HB2 P;  1IAG A;  4DF9 A;  2MZE A;  4DD8 A;  2I47 A;  2X3C A;  4A3W A;  1FM1 A;  5I4O A;  1G9K A;  3LK8 A;  4PKW A;  4IN9 A;  2JNP A;  1KUK A;  1OS2 A;  4AUO A;  4H82 A;  3GBO A;  1PWP A;  4H3X A;  1BM6 A;  1J7N A;  2KRJ A;  3O64 A;  1JAQ A;  1ND1 A;  3LUN A;  1AST A;  1PWW A;  1GE5 A;  3AYK A;  1R1J A;  4FU4 A;  5D3C A;  3VTG A;  3DSL A;  3G5C A;  3EWJ A;  4H30 A;  3AIG A;  1A86 A;  1KUG A;  1BUD A;  1QJJ A;  2W12 A;  4ILW D;  1D7X A;  2HU6 A;  1MNC A;  3OHO A;  2L0R A;  1BIW A;  5LAB A;  1Z3J A;  1XFY A;  4JA1 A;  2DW0 A;  2XS3 A;  3HYG A;  1EB6 A;  1ZP5 A;  1BUV M;  3LIR A;  3HBV P;  4H76 A;  3LJT A;  4IUW A;  3ZUK A;  2SRT A;  5I3M A;  1RMZ A;  2XS4 A;  5D2B A;  4PKS A;  5I0L A;  4GR8 A;  1AYK A;  5I2Z A;  1OZ9 A;  2AIG P;  1A85 A;  1ROS A; 
#chains in the Genus database with same CATH homology
 1BKC I;  3F19 A;  1PWU A;  1UTZ A;  3ZXH A;  2JSD A;  2O3E A;  2MLR A;  2MLS A;  2YB9 A;  3TVC A;  1ATL A;  3LQ0 A;  3TSK A;  3K7N A;  2ERQ A;  1DMT A;  1USN A;  3LGP A;  2OZR A;  3KWV C;  4G9L A;  3DPF A;  1DTH A;  4XM7 A;  1XUD A;  3K7L A;  1HFC A;  3EDH A;  2RJQ A;  2OW9 A;  1OMJ A;  4GR3 A;  4J4M A;  2J0T A;  2CLT A;  2O36 A;  3F15 A;  3B92 A;  1H71 P;  4XCT A;  1Y0V A;  1R1H A;  1B3D A;  2DDF A;  1ZXV A;  3HBU P;  2Y6C A;  1JAO A;  4XBH A;  3HDB A;  3RTT A;  1K7G A;  1YOU A;  1BZS A;  2DW1 A;  4GQL A;  4ON1 A;  2N8R A;  5B5P A;  4A7B A;  1BSW A;  4I03 A;  1HTD A;  1R1I A;  3EHY A;  2W13 A;  4GF1 A;  3B8Z A;  966C A;  1MMB A;  4XM6 A;  1FLS A;  1IAC A;  4GWM A;  3ZVS A;  3OHL A;  1BKC A;  3N2U A;  1SLN A;  4G0D A;  3L0V A;  1C3I A;  4FVL A;  1SMP A;  1K7Q A;  2X3A A;  1PWV A;  4HMA A;  4L63 A;  3LEA A;  1JKY A;  2W0D A;  3LE9 A;  1KUF A;  1YCM A;  1R55 A;  1OM8 A;  3LMC A;  1D5J A;  2JT5 A;  3BA0 A;  1BQQ M;  1BKC E;  1UMS A;  1MMP A;  3AYU A;  2ERO A;  4FXY P;  1GO8 P;  3EDZ A;  1C7K A;  1OM6 A;  1XFW A;  4JQG A;  4WK7 A;  3LIK A;  5I12 A;  1CIZ A;  3E8R A;  2OY4 A;  1Y8J A;  2K9C A;  1G49 A;  3KHI A;  3LJG A;  4CTH A;  2D1O A;  1HFS A;  1CGE A;  1IAD A;  4GWN A;  3F16 A;  1SU3 A;  2K2G A;  3RTS A;  1CGF A;  1CAQ A;  4WF6 A;  1ZVX A;  3F18 A;  5JMY A;  3HY9 A;  1ZXC A;  3ELM A;  1QIA A;  3KME A;  2WOA A;  1UMT A;  1GKC A;  2FV9 A;  1EAK A;  4JP4 A;  3WV2 A;  3HDA P;  3LIL A;  4HX3 A;  2OXZ A;  1QJI A;  1GXD A;  4PKR A;  3MA2 A;  1JK3 A;  2X7M A;  3DWB A;  3KMC A;  3L0T A;  1I73 A;  3LKA A;  5D1T A;  2CKI A;  1OS9 A;  1D8F A;  2OVZ A;  4AXQ A;  2W14 A;  1C8T A;  3I7G A;  5D1S A;  2OXW A;  5D1U A;  1ZS0 A;  1CQR A;  2TCL A;  1SRP A;  3UVC A;  5I43 A;  4WZV A;  1JIW P;  1XFX A;  4QKZ A;  1KUI A;  2OY2 A;  1YP1 A;  5CZM A;  4H2E A;  456C A;  2YIG A;  1IAE A;  3KEJ A;  4DV8 A;  1JAP A;  1GKD A;  4ZR5 A;  2ERP A;  2J83 A;  2OI0 A;  2WO8 A;  1JH1 A;  4PKV A;  1I76 A;  2DDY A;  3B2Z A;  1PWQ A;  1SLM A;  4H1Q A;  1BQO A;  2QPJ A;  4I35 A;  1GE7 A;  2X3B A;  3KRY A;  4AIG A;  3LJZ A;  3LUM A;  5BOY A;  2WO9 A;  1JIZ A;  3U1R A;  1KUH A;  4GUY A;  5BOT A;  3F17 A;  3P1V A;  2OXU A;  2USN A;  3HY7 A;  2OW0 A;  3F1A A;  1G05 A;  3EDI A;  3O2X A;  2OW1 A;  2D1N A;  1O0Q A;  1O0T A;  3LQB A;  3EHX A;  1EUB A;  3NX7 A;  4L19 A;  5D7W A;  2JT6 A;  3Q2G A;  3V96 B;  3TS4 A;  1K7I A;  1HY7 A;  1AF0 A;  2W15 A;  4H49 A;  1I1I P;  1B8Y A;  1XUR A;  5CUH A;  3USN A;  2RJP A;  5BPA A;  3KEK A;  1G4K A;  3TT4 A;  1D8M A;  4FXQ A;  2DW2 A;  1RM8 A;  4EFS A;  1CXV A;  1XFU A;  4WKE A;  1XUC A;  1GE6 A;  3DNG A;  4DPE A;  1JAN A;  4GR0 A;  1MMQ A;  3G42 A;  1CGL A;  2Z2D A;  1ZTQ A;  4PKQ A;  3EDG A;  3CKI A;  2POJ A;  3VI1 A;  3DTE A;  4JIJ A;  2OW2 A;  3I7I A;  1UTT A;  2A8H A;  4L7A A;  1OO9 A;  3WV1 A;  2Y6D A;  3KEC A;  5L79 A;  1XFV A;  1XFZ A;  1QIC A;  1QIB A;  2FV5 A;  1AKL A;  1GO7 P;  1R54 A;  3DTK A;  4XM8 A;  1OM7 A;  1HOV A;  5B5O A;  4Q1L A;  2E3X A;  5L7F A;  1G12 A;  3P24 A;  830C A;  4PKU A;  3N2V A;  4R3V A;  1IAB A;  1YQY A;  2MZH A;  1Q3A A;  4PKT A;  3DTI A;  1FBL A;  3WV3 A;  4H84 A;  1Y93 A;  2OVX A;  1KAP P;  3DPE A;  4JPA A;  2E2D A;  2AYK A;  1HV5 A;  2PJT A;  2MZI A;  4WKI A;  5CXA A;  1S4B P;  1MMR A;  1UEA A;  1JJ9 A;  4AYK A;  1QUA A;  1KBC A;  1SAT A;  3DL1 A;  5H8X A;  1CK7 A;  2V4B A;  3Q2H A;  2YUF A;  1WNI A;  4L6T A;  3SHI A;  2JIH A;  1IAA A;  1L6J A;  4IJO A;  3HB2 P;  1IAG A;  4DF9 A;  2MZE A;  4DD8 A;  2I47 A;  2X3C A;  4A3W A;  1FM1 A;  5I4O A;  1G9K A;  3LK8 A;  4PKW A;  4IN9 A;  2JNP A;  1KUK A;  1OS2 A;  4AUO A;  4H82 A;  3GBO A;  1PWP A;  4H3X A;  1BM6 A;  1J7N A;  2KRJ A;  3O64 A;  1JAQ A;  1ND1 A;  3LUN A;  1AST A;  1PWW A;  1GE5 A;  3AYK A;  1R1J A;  4FU4 A;  5D3C A;  3VTG A;  3DSL A;  3G5C A;  3EWJ A;  4H30 A;  3AIG A;  1A86 A;  1KUG A;  1BUD A;  1QJJ A;  2W12 A;  4ILW D;  1D7X A;  2HU6 A;  1MNC A;  3OHO A;  2L0R A;  1BIW A;  5LAB A;  1Z3J A;  1XFY A;  4JA1 A;  2DW0 A;  2XS3 A;  3HYG A;  1EB6 A;  1ZP5 A;  1BUV M;  3LIR A;  3HBV P;  4H76 A;  3LJT A;  4IUW A;  3ZUK A;  2SRT A;  5I3M A;  1RMZ A;  2XS4 A;  5D2B A;  4PKS A;  5I0L A;  4GR8 A;  1AYK A;  5I2Z A;  2AIG P;  1A85 A;  1ROS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...