1AYKA

Inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, 30 structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
169
structure length
169
Chain Sequence
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution solution structure of the inhibitor-free catalytic fragment of human fibroblast collagenase determined by multidimensional NMR.
pubmed doi rcsb
molecule keywords COLLAGENASE
molecule tags Metalloprotease
source organism Homo sapiens
total genus 27
structure length 169
sequence length 169
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1aykA00
1B3DA 2OW1A 1HFSA 1MMQA 1BIWA 2W14A 2OW0A 3LIRA 3EDHA 5CZMA 1XFZA 1BSWA 1G4KA 1XFWA 1PWUA 4DD8A 1HFCA 3HBVP 1JK3A 4H82A 3Q2HA 1I76A 1BKCE 3DWBA 3DPEA 5I3MA 1OM8A 5D7WA 4IJOA 1ZXVA 3EHXA 1JH1A 2MZIA 4AIGA 2HU6A 4XM6A 3TSKA 1OO9A 1GO8P 5D2BA 3K7LA 1PWPA 3KECA 1ROSA 4CTHA 2JSDA 3ZUKA 2X3CA 5JMYA 1C7KA 4L19A 4H76A 3BA0A 2CLTA 2OXWA 3P1VA 4GQLA 3LKAA 3UVCA 4PKVA 2E2DA 3V96B 3EWJA 4IN9A 3HDBA 3LUMA 3G5CA 4WZVA 1BKCA 3WV3A 3LJGA 3AYKA 5BPAA 3LJTA 2I47A 1D8MA 5BOYA 5I2ZA 3HYGA 1YOUA 1GKCA 1XFXA 1JAPA 1OMJA 5D1TA 2OI0A 1BQQM 3LEAA 2DW0A 3ZVSA 1G9KA 4XBHA 4HX3A 2OVXA 1XUDA 1MMBA 2E3XA 4WKIA 4H2EA 3GBOA 1UMSA 2KRJA 2POJA 1O0QA 3N2UA 1CGFA 1KBCA 1JKYA 2MZEA 4JIJA 1QJIA 4ON1A 4A3WA 2YB9A 4HMAA 1IADA 2JNPA 4G9LA 1IAAA 1HV5A 1R55A 4AYKA 2ERQA 2L0RA 3LQBA 1XFVA 3EDIA 1KUKA 1ZP5A 3VI1A 4GUYA 4JP4A 1IAGA 1CXVA 5D3CA 1MMPA 2V4BA 1XUCA 2WOAA 3RTTA 2FV5A 1SLNA 4H30A 1Q3AA 2X3AA 1UTTA 4XCTA 2OW2A 2O3EA 1KUIA 2W15A 3F1AA 3F18A 1KUFA 1R1HA 3HBUP 2SRTA 2OXUA 2W13A 1I1IP 4FVLA 2J83A 2OVZA 2JT5A 1R54A 1S4BP 1J7NA 1CGEA 3HB2P 3KWVC 1XFUA 1ZS0A 1AKLA 1OS9A 3E8RA 1IABA 1YP1A 1G05A 1D5JA 3HDAP 4L6TA 3DPFA 1JAQA 1GE5A 1GXDA 4AUOA 1K7QA 1A85A 5B5OA 4FU4A 4PKWA 1R1JA 3EDZA 3K7NA 2XS4A 4ILWD 3DNGA 4DPEA 1FBLA 3HY7A 2OY4A 2D1OA 1IACA 2A8HA 2DDFA 1O0TA 4JQGA 2W12A 1CGLA 2O36A 1K7GA 4L63A 3LE9A 1KUHA 4JPAA 2W0DA 1IAEA 1BUVM 2OXZA 1MNCA 2ERPA 1GKDA 4H84A 4PKSA 2D1NA 1DTHA 1QJJA 4R3VA 1QICA 4JA1A 2AIGP 1OM7A 1YCMA 1Y93A 1EB6A 2JT6A 1AYKA 3OHLA 3O64A 1PWVA 1ND1A 3KHIA 1D7XA 4DV8A 2J0TA 4WKEA 3I7IA 3ELMA 3WV2A 3N2VA 2XS3A 1HOVA 5CXAA 3L0VA 1R1IA 3LMCA 5LABA 3NX7A 3TVCA 3SHIA 1C8TA 3KEJA 4WK7A 1HY7A 3B8ZA 1QUAA 3TT4A 2RJPA 4G0DA 3VTGA 3KMCA 2RJQA 456CA 1D8FA 3B2ZA 3DL1A 966CA 2DDYA 4EFSA 2TCLA 2WO9A 1RM8A 2OY2A 1ASTA 1SU3A 1USNA 4H49A 1XURA 3F19A 1SATA 1BM6A 1ZXCA 1YQYA 2USNA 3O2XA 1HTDA 1FM1A 4PKQA 1UMTA 3F15A 2Y6DA 1PWQA 1FLSA 1ZTQA 1BQOA 3LILA 4GWMA 1CK7A 3AYUA 2OZRA 4FXQA 2K9CA 1JANA 3F17A 1BUDA 3CKIA 3HY9A 3LK8A 3MA2A 3TS4A 1SLMA 1G12A 2MZHA 4GR3A 4H1QA 1G49A 4I03A 5D1UA 2X7MA 5H8XA 1CAQA 1SMPA 1EUBA 1JAOA 4XM8A 1JJ9A 3Q2GA 4DF9A 5BOTA 1B8YA 3WV1A 2QPJA 3LGPA 5I12A 3OHOA 2DW1A 1RMZA 4H3XA 1BKCI 2PJTA 3KMEA 5D1SA 4GR0A 1OS2A 1K7IA 1ZVXA 2Y6CA 5I43A 1CQRA 1UTZA 1JIWP 4AXQA 1QIBA 3P24A 2MLSA 4A7BA 2JIHA 1JIZA 1XFYA 1PWWA 5I4OA 3LIKA 1EAKA 1L6JA 5I0LA 1Z3JA 5L7FA 4PKUA 3AIGA 1H71P 1CIZA 4GR8A 1Y8JA 1UEAA 830CA 1SRPA 3KRYA 2N8RA 3U1RA 4IUWA 4PKTA 3B92A 4ZR5A 4I35A 3I7GA 1DMTA 3ZXHA 2FV9A 1KAPP 3L0TA 3DSLA 3G42A 3LQ0A 1KUGA 1QIAA 4GF1A 4GWNA 1BZSA 3KEKA 4PKRA 1AF0A 2AYKA 2DW2A 1GE6A 1WNIA 2CKIA 3EHYA 2MLRA 1MMRA 2X3BA 1GO7P 2Z2DA 3EDGA 4J4MA 1ATLA 3LUNA 1A86A 1C3IA 2YIGA 5CUHA 5B5PA 2EROA 1OM6A 2K2GA 4WF6A 1GE7A 2OW9A 4XM7A 1Y0VA 3F16A 1I73A 3USNA 5L79A 4Q1LA 4FXYP 4QKZA 3LJZA 3RTSA 2WO8A
chains in the Genus database with same CATH superfamily
1B3DA 2OW1A 1HFSA 1MMQA 1BIWA 2W14A 2OW0A 3LIRA 3EDHA 5CZMA 1XFZA 1BSWA 1G4KA 1XFWA 1PWUA 4DD8A 1HFCA 3HBVP 1JK3A 4H82A 3Q2HA 1I76A 1BKCE 3DWBA 3DPEA 5I3MA 1OM8A 5D7WA 4IJOA 1ZXVA 3EHXA 1JH1A 2MZIA 4AIGA 2HU6A 4XM6A 3TSKA 1OO9A 1GO8P 5D2BA 3K7LA 1PWPA 3KECA 1ROSA 4CTHA 2JSDA 3ZUKA 2X3CA 5JMYA 1C7KA 4L19A 4H76A 3BA0A 2CLTA 2OXWA 3P1VA 4GQLA 3LKAA 3UVCA 4PKVA 2E2DA 3V96B 3EWJA 4IN9A 3HDBA 3LUMA 3G5CA 1OZ9A 1BKCA 4WZVA 3WV3A 3LJGA 3AYKA 5BPAA 3LJTA 2I47A 1D8MA 5BOYA 5I2ZA 3HYGA 1YOUA 1GKCA 1XFXA 1JAPA 1OMJA 5D1TA 2OI0A 1BQQM 3LEAA 2DW0A 3ZVSA 1G9KA 4XBHA 4HX3A 2OVXA 1XUDA 1MMBA 2E3XA 4WKIA 4H2EA 3GBOA 1UMSA 2KRJA 2POJA 1O0QA 3N2UA 1CGFA 1KBCA 1JKYA 2MZEA 4JIJA 1QJIA 4ON1A 4A3WA 2YB9A 4HMAA 1IADA 2JNPA 4G9LA 1IAAA 1HV5A 1R55A 4AYKA 2ERQA 2L0RA 3LQBA 1XFVA 3EDIA 1KUKA 1ZP5A 3VI1A 4GUYA 4JP4A 1IAGA 1CXVA 5D3CA 1MMPA 2V4BA 1XUCA 2WOAA 3RTTA 2FV5A 1SLNA 4H30A 1Q3AA 2X3AA 1UTTA 3DTKA 4XCTA 2OW2A 2O3EA 1KUIA 2W15A 3F1AA 3F18A 1KUFA 1R1HA 3HBUP 2SRTA 2OXUA 2W13A 1I1IP 4FVLA 2J83A 2OVZA 2JT5A 1R54A 1S4BP 1J7NA 1CGEA 3HB2P 3KWVC 1XFUA 1ZS0A 1AKLA 1OS9A 3E8RA 1IABA 1YP1A 1G05A 1D5JA 3HDAP 4L6TA 3DPFA 1JAQA 1GE5A 1GXDA 4AUOA 1K7QA 1A85A 5B5OA 4FU4A 4PKWA 1R1JA 3EDZA 3K7NA 2XS4A 4ILWD 3DNGA 4DPEA 1FBLA 3HY7A 2OY4A 2D1OA 1IACA 2A8HA 2DDFA 1O0TA 4JQGA 2W12A 3DTEA 1CGLA 2O36A 1K7GA 4L63A 3LE9A 1KUHA 4JPAA 2W0DA 1IAEA 1BUVM 2OXZA 1MNCA 2ERPA 1GKDA 4H84A 4PKSA 2D1NA 1DTHA 1XM5A 1QJJA 4R3VA 1QICA 4JA1A 2AIGP 1OM7A 1YCMA 1Y93A 1EB6A 2JT6A 1AYKA 3OHLA 3O64A 1PWVA 1ND1A 3KHIA 1D7XA 4DV8A 2J0TA 4WKEA 3I7IA 3ELMA 3WV2A 3N2VA 2XS3A 1HOVA 5CXAA 3L0VA 1R1IA 3LMCA 5LABA 3NX7A 3TVCA 3SHIA 1C8TA 3KEJA 4WK7A 1HY7A 3B8ZA 1QUAA 3TT4A 2RJPA 4G0DA 3VTGA 3KMCA 2RJQA 456CA 2YUFA 1D8FA 3B2ZA 3DL1A 966CA 2DDYA 1XAXA 4EFSA 2TCLA 2WO9A 1RM8A 2OY2A 1ASTA 1SU3A 1USNA 4H49A 1XURA 3F19A 1SATA 1BM6A 1TVIA 1ZXCA 1YQYA 2USNA 3O2XA 1HTDA 1FM1A 4PKQA 1UMTA 3F15A 2Y6DA 1PWQA 1FLSA 1ZTQA 1BQOA 3LILA 4GWMA 1CK7A 3AYUA 2OZRA 4FXQA 2K9CA 1JANA 3F17A 1BUDA 3CKIA 3HY9A 3LK8A 3MA2A 3TS4A 1SLMA 1G12A 2MZHA 4GR3A 4H1QA 1G49A 4I03A 5D1UA 2X7MA 5H8XA 1CAQA 1SMPA 1EUBA 1JAOA 3DTIA 4XM8A 1JJ9A 3Q2GA 4DF9A 5BOTA 1B8YA 3WV1A 2QPJA 3LGPA 5I12A 3OHOA 2DW1A 1RMZA 4H3XA 1BKCI 2PJTA 3KMEA 5D1SA 4GR0A 1OS2A 1K7IA 1ZVXA 2Y6CA 5I43A 1CQRA 1UTZA 1JIWP 4AXQA 1QIBA 3P24A 2MLSA 4A7BA 2JIHA 1JIZA 1XFYA 1PWWA 5I4OA 3LIKA 1EAKA 1L6JA 5I0LA 1Z3JA 5L7FA 4PKUA 3AIGA 1H71P 1CIZA 4GR8A 1Y8JA 1UEAA 830CA 4L7AA 1SRPA 3KRYA 2N8RA 3U1RA 4IUWA 4PKTA 3B92A 4ZR5A 4I35A 3I7GA 1DMTA 3ZXHA 2FV9A 1KAPP 3L0TA 3DSLA 3G42A 3LQ0A 1KUGA 1QIAA 4GF1A 4GWNA 1BZSA 3KEKA 4PKRA 1AF0A 2AYKA 2DW2A 1GE6A 1WNIA 2CKIA 3EHYA 2MLRA 1MMRA 2X3BA 1GO7P 2Z2DA 3EDGA 4J4MA 1ATLA 3LUNA 1A86A 1C3IA 2YIGA 5CUHA 5B5PA 2EROA 1OM6A 2K2GA 4WF6A 1GE7A 2OW9A 4XM7A 1Y0VA 3F16A 1I73A 3USNA 5L79A 4Q1LA 4FXYP 4QKZA 3LJZA 3RTSA 2WO8A
chains in the Genus database with same CATH topology
1B3DA 2OW1A 1HFSA 1MMQA 1BIWA 2W14A 2OW0A 3LIRA 3EDHA 5CZMA 1XFZA 1BSWA 1G4KA 1XFWA 1PWUA 4DD8A 1HFCA 3HBVP 1JK3A 4H82A 3Q2HA 1I76A 1BKCE 3DWBA 3DPEA 5I3MA 1OM8A 5D7WA 4IJOA 1ZXVA 3EHXA 1JH1A 2MZIA 4AIGA 2HU6A 4XM6A 3TSKA 1OO9A 1GO8P 5D2BA 3K7LA 1PWPA 3KECA 1ROSA 4CTHA 2JSDA 3ZUKA 2X3CA 5JMYA 1C7KA 4L19A 4H76A 3BA0A 2CLTA 2OXWA 3P1VA 4GQLA 3LKAA 3UVCA 4PKVA 2E2DA 3V96B 3EWJA 4IN9A 3HDBA 3LUMA 3G5CA 4WZVA 1BKCA 3WV3A 3LJGA 3AYKA 5BPAA 3LJTA 2I47A 1D8MA 5BOYA 5I2ZA 3HYGA 1YOUA 1GKCA 1XFXA 1JAPA 1OMJA 5D1TA 2OI0A 1BQQM 3LEAA 2DW0A 3ZVSA 1G9KA 4XBHA 4HX3A 2OVXA 1XUDA 1MMBA 2E3XA 4WKIA 4H2EA 3GBOA 1UMSA 2KRJA 2POJA 1O0QA 3N2UA 1CGFA 1KBCA 1JKYA 2MZEA 4JIJA 1QJIA 4ON1A 4A3WA 2YB9A 4HMAA 1IADA 2JNPA 4G9LA 1IAAA 1HV5A 1R55A 4AYKA 2ERQA 2L0RA 3LQBA 1XFVA 3EDIA 1KUKA 1ZP5A 3VI1A 4GUYA 4JP4A 1IAGA 1CXVA 5D3CA 1MMPA 2V4BA 1XUCA 2WOAA 3RTTA 2FV5A 1SLNA 4H30A 1Q3AA 2X3AA 1UTTA 3DTKA 4XCTA 2OW2A 2O3EA 1KUIA 2W15A 3F1AA 3F18A 1KUFA 1R1HA 3HBUP 2SRTA 2OXUA 2W13A 1I1IP 4FVLA 2J83A 2OVZA 2JT5A 1R54A 1S4BP 1J7NA 1CGEA 3HB2P 3KWVC 1XFUA 1ZS0A 1AKLA 1OS9A 3E8RA 1IABA 1YP1A 1G05A 1D5JA 3HDAP 4L6TA 3DPFA 1JAQA 1GE5A 1GXDA 4AUOA 1K7QA 1A85A 5B5OA 4FU4A 4PKWA 1R1JA 3EDZA 3K7NA 2XS4A 4ILWD 3DNGA 4DPEA 1FBLA 3HY7A 2OY4A 2D1OA 1IACA 2A8HA 2DDFA 1O0TA 4JQGA 2W12A 3DTEA 1CGLA 2O36A 1K7GA 4L63A 3LE9A 1KUHA 4JPAA 2W0DA 1IAEA 1BUVM 2OXZA 1MNCA 2ERPA 1GKDA 4H84A 4PKSA 2D1NA 1DTHA 1QJJA 4R3VA 1QICA 4JA1A 2AIGP 1OM7A 1YCMA 1Y93A 1EB6A 2JT6A 1AYKA 3OHLA 3O64A 1PWVA 1ND1A 3KHIA 1D7XA 4DV8A 2J0TA 4WKEA 3I7IA 3ELMA 3WV2A 3N2VA 2XS3A 1HOVA 5CXAA 3L0VA 1R1IA 3LMCA 5LABA 3NX7A 3TVCA 3SHIA 1C8TA 3KEJA 4WK7A 1HY7A 3B8ZA 1QUAA 3TT4A 2RJPA 4G0DA 3VTGA 3KMCA 2RJQA 456CA 2YUFA 1D8FA 3B2ZA 3DL1A 966CA 2DDYA 4EFSA 2TCLA 2WO9A 1RM8A 2OY2A 1ASTA 1SU3A 1USNA 4H49A 1XURA 3F19A 1SATA 1BM6A 1ZXCA 1YQYA 2USNA 3O2XA 1HTDA 1FM1A 4PKQA 1UMTA 3F15A 2Y6DA 1PWQA 1FLSA 1ZTQA 1BQOA 3LILA 4GWMA 1CK7A 3AYUA 2OZRA 4FXQA 2K9CA 1JANA 3F17A 1BUDA 3CKIA 3HY9A 3LK8A 3MA2A 3TS4A 1SLMA 1G12A 2MZHA 4GR3A 4H1QA 1G49A 4I03A 5D1UA 2X7MA 5H8XA 1CAQA 1SMPA 1EUBA 1JAOA 3DTIA 4XM8A 1JJ9A 3Q2GA 4DF9A 5BOTA 1B8YA 3WV1A 2QPJA 3LGPA 5I12A 3OHOA 2DW1A 1RMZA 4H3XA 1BKCI 2PJTA 3KMEA 5D1SA 4GR0A 1OS2A 1K7IA 1ZVXA 2Y6CA 5I43A 1CQRA 1UTZA 1JIWP 4AXQA 1QIBA 3P24A 2MLSA 4A7BA 2JIHA 1JIZA 1XFYA 1PWWA 5I4OA 3LIKA 1EAKA 1L6JA 5I0LA 1Z3JA 5L7FA 4PKUA 3AIGA 1H71P 1CIZA 4GR8A 1Y8JA 1UEAA 830CA 4L7AA 1SRPA 3KRYA 2N8RA 3U1RA 4IUWA 4PKTA 3B92A 4ZR5A 4I35A 3I7GA 1DMTA 3ZXHA 2FV9A 1KAPP 3L0TA 3DSLA 3G42A 3LQ0A 1KUGA 1QIAA 4GF1A 4GWNA 1BZSA 3KEKA 4PKRA 1AF0A 2AYKA 2DW2A 1GE6A 1WNIA 2CKIA 3EHYA 2MLRA 1MMRA 2X3BA 1GO7P 2Z2DA 3EDGA 4J4MA 1ATLA 3LUNA 1A86A 1C3IA 2YIGA 5CUHA 5B5PA 2EROA 1OM6A 2K2GA 4WF6A 1GE7A 2OW9A 4XM7A 1Y0VA 3F16A 1I73A 3USNA 5L79A 4Q1LA 4FXYP 4QKZA 3LJZA 3RTSA 2WO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3D A;  2OW1 A;  1HFS A;  1MMQ A;  1BIW A;  2W14 A;  2OW0 A;  3LIR A;  3EDH A;  5CZM A;  1XFZ A;  1BSW A;  1G4K A;  1XFW A;  1PWU A;  4DD8 A;  1HFC A;  3HBV P;  1JK3 A;  4H82 A;  3Q2H A;  1I76 A;  1BKC E;  3DWB A;  3DPE A;  5I3M A;  1OM8 A;  5D7W A;  4IJO A;  1ZXV A;  3EHX A;  1JH1 A;  2MZI A;  4AIG A;  2HU6 A;  4XM6 A;  3TSK A;  1OO9 A;  1GO8 P;  5D2B A;  3K7L A;  1PWP A;  3KEC A;  1ROS A;  4CTH A;  2JSD A;  3ZUK A;  2X3C A;  5JMY A;  1C7K A;  4L19 A;  4H76 A;  3BA0 A;  2CLT A;  2OXW A;  3P1V A;  4GQL A;  3LKA A;  3UVC A;  4PKV A;  2E2D A;  3V96 B;  3EWJ A;  4IN9 A;  3HDB A;  3LUM A;  3G5C A;  4WZV A;  1BKC A;  3WV3 A;  3LJG A;  3AYK A;  5BPA A;  3LJT A;  2I47 A;  1D8M A;  5BOY A;  5I2Z A;  3HYG A;  1YOU A;  1GKC A;  1XFX A;  1JAP A;  1OMJ A;  5D1T A;  2OI0 A;  1BQQ M;  3LEA A;  2DW0 A;  3ZVS A;  1G9K A;  4XBH A;  4HX3 A;  2OVX A;  1XUD A;  1MMB A;  2E3X A;  4WKI A;  4H2E A;  3GBO A;  1UMS A;  2KRJ A;  2POJ A;  1O0Q A;  3N2U A;  1CGF A;  1KBC A;  1JKY A;  2MZE A;  4JIJ A;  1QJI A;  4ON1 A;  4A3W A;  2YB9 A;  4HMA A;  1IAD A;  2JNP A;  4G9L A;  1IAA A;  1HV5 A;  1R55 A;  4AYK A;  2ERQ A;  2L0R A;  3LQB A;  1XFV A;  3EDI A;  1KUK A;  1ZP5 A;  3VI1 A;  4GUY A;  4JP4 A;  1IAG A;  1CXV A;  5D3C A;  1MMP A;  2V4B A;  1XUC A;  2WOA A;  3RTT A;  2FV5 A;  1SLN A;  4H30 A;  1Q3A A;  2X3A A;  1UTT A;  4XCT A;  2OW2 A;  2O3E A;  1KUI A;  2W15 A;  3F1A A;  3F18 A;  1KUF A;  1R1H A;  3HBU P;  2SRT A;  2OXU A;  2W13 A;  1I1I P;  4FVL A;  2J83 A;  2OVZ A;  2JT5 A;  1R54 A;  1S4B P;  1J7N A;  1CGE A;  3HB2 P;  3KWV C;  1XFU A;  1ZS0 A;  1AKL A;  1OS9 A;  3E8R A;  1IAB A;  1YP1 A;  1G05 A;  1D5J A;  3HDA P;  4L6T A;  3DPF A;  1JAQ A;  1GE5 A;  1GXD A;  4AUO A;  1K7Q A;  1A85 A;  5B5O A;  4FU4 A;  4PKW A;  1R1J A;  3EDZ A;  3K7N A;  2XS4 A;  4ILW D;  3DNG A;  4DPE A;  1FBL A;  3HY7 A;  2OY4 A;  2D1O A;  1IAC A;  2A8H A;  2DDF A;  1O0T A;  4JQG A;  2W12 A;  1CGL A;  2O36 A;  1K7G A;  4L63 A;  3LE9 A;  1KUH A;  4JPA A;  2W0D A;  1IAE A;  1BUV M;  2OXZ A;  1MNC A;  2ERP A;  1GKD A;  4H84 A;  4PKS A;  2D1N A;  1DTH A;  1QJJ A;  4R3V A;  1QIC A;  4JA1 A;  2AIG P;  1OM7 A;  1YCM A;  1Y93 A;  1EB6 A;  2JT6 A;  1AYK A;  3OHL A;  3O64 A;  1PWV A;  1ND1 A;  3KHI A;  1D7X A;  4DV8 A;  2J0T A;  4WKE A;  3I7I A;  3ELM A;  3WV2 A;  3N2V A;  2XS3 A;  1HOV A;  5CXA A;  3L0V A;  1R1I A;  3LMC A;  5LAB A;  3NX7 A;  3TVC A;  3SHI A;  1C8T A;  3KEJ A;  4WK7 A;  1HY7 A;  3B8Z A;  1QUA A;  3TT4 A;  2RJP A;  4G0D A;  3VTG A;  3KMC A;  2RJQ A;  456C A;  1D8F A;  3B2Z A;  3DL1 A;  966C A;  2DDY A;  4EFS A;  2TCL A;  2WO9 A;  1RM8 A;  2OY2 A;  1AST A;  1SU3 A;  1USN A;  4H49 A;  1XUR A;  3F19 A;  1SAT A;  1BM6 A;  1ZXC A;  1YQY A;  2USN A;  3O2X A;  1HTD A;  1FM1 A;  4PKQ A;  1UMT A;  3F15 A;  2Y6D A;  1PWQ A;  1FLS A;  1ZTQ A;  1BQO A;  3LIL A;  4GWM A;  1CK7 A;  3AYU A;  2OZR A;  4FXQ A;  2K9C A;  1JAN A;  3F17 A;  1BUD A;  3CKI A;  3HY9 A;  3LK8 A;  3MA2 A;  3TS4 A;  1SLM A;  1G12 A;  2MZH A;  4GR3 A;  4H1Q A;  1G49 A;  4I03 A;  5D1U A;  2X7M A;  5H8X A;  1CAQ A;  1SMP A;  1EUB A;  1JAO A;  4XM8 A;  1JJ9 A;  3Q2G A;  4DF9 A;  5BOT A;  1B8Y A;  3WV1 A;  2QPJ A;  3LGP A;  5I12 A;  3OHO A;  2DW1 A;  1RMZ A;  4H3X A;  1BKC I;  2PJT A;  3KME A;  5D1S A;  4GR0 A;  1OS2 A;  1K7I A;  1ZVX A;  2Y6C A;  5I43 A;  1CQR A;  1UTZ A;  1JIW P;  4AXQ A;  1QIB A;  3P24 A;  2MLS A;  4A7B A;  2JIH A;  1JIZ A;  1XFY A;  1PWW A;  5I4O A;  3LIK A;  1EAK A;  1L6J A;  5I0L A;  1Z3J A;  5L7F A;  4PKU A;  3AIG A;  1H71 P;  1CIZ A;  4GR8 A;  1Y8J A;  1UEA A;  830C A;  1SRP A;  3KRY A;  2N8R A;  3U1R A;  4IUW A;  4PKT A;  3B92 A;  4ZR5 A;  4I35 A;  3I7G A;  1DMT A;  3ZXH A;  2FV9 A;  1KAP P;  3L0T A;  3DSL A;  3G42 A;  3LQ0 A;  1KUG A;  1QIA A;  4GF1 A;  4GWN A;  1BZS A;  3KEK A;  4PKR A;  1AF0 A;  2AYK A;  2DW2 A;  1GE6 A;  1WNI A;  2CKI A;  3EHY A;  2MLR A;  1MMR A;  2X3B A;  1GO7 P;  2Z2D A;  3EDG A;  4J4M A;  1ATL A;  3LUN A;  1A86 A;  1C3I A;  2YIG A;  5CUH A;  5B5P A;  2ERO A;  1OM6 A;  2K2G A;  4WF6 A;  1GE7 A;  2OW9 A;  4XM7 A;  1Y0V A;  3F16 A;  1I73 A;  3USN A;  5L79 A;  4Q1L A;  4FXY P;  4QKZ A;  3LJZ A;  3RTS A;  2WO8 A; 
#chains in the Genus database with same CATH topology
 1B3D A;  2OW1 A;  1HFS A;  1MMQ A;  1BIW A;  2W14 A;  2OW0 A;  3LIR A;  3EDH A;  5CZM A;  1XFZ A;  1BSW A;  1G4K A;  1XFW A;  1PWU A;  4DD8 A;  1HFC A;  3HBV P;  1JK3 A;  4H82 A;  3Q2H A;  1I76 A;  1BKC E;  3DWB A;  3DPE A;  5I3M A;  1OM8 A;  5D7W A;  4IJO A;  1ZXV A;  3EHX A;  1JH1 A;  2MZI A;  4AIG A;  2HU6 A;  4XM6 A;  3TSK A;  1OO9 A;  1GO8 P;  5D2B A;  3K7L A;  1PWP A;  3KEC A;  1ROS A;  4CTH A;  2JSD A;  3ZUK A;  2X3C A;  5JMY A;  1C7K A;  4L19 A;  4H76 A;  3BA0 A;  2CLT A;  2OXW A;  3P1V A;  4GQL A;  3LKA A;  3UVC A;  4PKV A;  2E2D A;  3V96 B;  3EWJ A;  4IN9 A;  3HDB A;  3LUM A;  3G5C A;  1OZ9 A;  1BKC A;  4WZV A;  3WV3 A;  3LJG A;  3AYK A;  5BPA A;  3LJT A;  2I47 A;  1D8M A;  5BOY A;  5I2Z A;  3HYG A;  1YOU A;  1GKC A;  1XFX A;  1JAP A;  1OMJ A;  5D1T A;  2OI0 A;  1BQQ M;  3LEA A;  2DW0 A;  3ZVS A;  1G9K A;  4XBH A;  4HX3 A;  2OVX A;  1XUD A;  1MMB A;  2E3X A;  4WKI A;  4H2E A;  3GBO A;  1UMS A;  2KRJ A;  2POJ A;  1O0Q A;  3N2U A;  1CGF A;  1KBC A;  1JKY A;  2MZE A;  4JIJ A;  1QJI A;  4ON1 A;  4A3W A;  2YB9 A;  4HMA A;  1IAD A;  2JNP A;  4G9L A;  1IAA A;  1HV5 A;  1R55 A;  4AYK A;  2ERQ A;  2L0R A;  3LQB A;  1XFV A;  3EDI A;  1KUK A;  1ZP5 A;  3VI1 A;  4GUY A;  4JP4 A;  1IAG A;  1CXV A;  5D3C A;  1MMP A;  2V4B A;  1XUC A;  2WOA A;  3RTT A;  2FV5 A;  1SLN A;  4H30 A;  1Q3A A;  2X3A A;  1UTT A;  3DTK A;  4XCT A;  2OW2 A;  2O3E A;  1KUI A;  2W15 A;  3F1A A;  3F18 A;  1KUF A;  1R1H A;  3HBU P;  2SRT A;  2OXU A;  2W13 A;  1I1I P;  4FVL A;  2J83 A;  2OVZ A;  2JT5 A;  1R54 A;  1S4B P;  1J7N A;  1CGE A;  3HB2 P;  3KWV C;  1XFU A;  1ZS0 A;  1AKL A;  1OS9 A;  3E8R A;  1IAB A;  1YP1 A;  1G05 A;  1D5J A;  3HDA P;  4L6T A;  3DPF A;  1JAQ A;  1GE5 A;  1GXD A;  4AUO A;  1K7Q A;  1A85 A;  5B5O A;  4FU4 A;  4PKW A;  1R1J A;  3EDZ A;  3K7N A;  2XS4 A;  4ILW D;  3DNG A;  4DPE A;  1FBL A;  3HY7 A;  2OY4 A;  2D1O A;  1IAC A;  2A8H A;  2DDF A;  1O0T A;  4JQG A;  2W12 A;  3DTE A;  1CGL A;  2O36 A;  1K7G A;  4L63 A;  3LE9 A;  1KUH A;  4JPA A;  2W0D A;  1IAE A;  1BUV M;  2OXZ A;  1MNC A;  2ERP A;  1GKD A;  4H84 A;  4PKS A;  2D1N A;  1DTH A;  1XM5 A;  1QJJ A;  4R3V A;  1QIC A;  4JA1 A;  2AIG P;  1OM7 A;  1YCM A;  1Y93 A;  1EB6 A;  2JT6 A;  1AYK A;  3OHL A;  3O64 A;  1PWV A;  1ND1 A;  3KHI A;  1D7X A;  4DV8 A;  2J0T A;  4WKE A;  3I7I A;  3ELM A;  3WV2 A;  3N2V A;  2XS3 A;  1HOV A;  5CXA A;  3L0V A;  1R1I A;  3LMC A;  5LAB A;  3NX7 A;  3TVC A;  3SHI A;  1C8T A;  3KEJ A;  4WK7 A;  1HY7 A;  3B8Z A;  1QUA A;  3TT4 A;  2RJP A;  4G0D A;  3VTG A;  3KMC A;  2RJQ A;  456C A;  2YUF A;  1D8F A;  3B2Z A;  3DL1 A;  966C A;  2DDY A;  1XAX A;  4EFS A;  2TCL A;  2WO9 A;  1RM8 A;  2OY2 A;  1AST A;  1SU3 A;  1USN A;  4H49 A;  1XUR A;  3F19 A;  1SAT A;  1BM6 A;  1TVI A;  1ZXC A;  1YQY A;  2USN A;  3O2X A;  1HTD A;  1FM1 A;  4PKQ A;  1UMT A;  3F15 A;  2Y6D A;  1PWQ A;  1FLS A;  1ZTQ A;  1BQO A;  3LIL A;  4GWM A;  1CK7 A;  3AYU A;  2OZR A;  4FXQ A;  2K9C A;  1JAN A;  3F17 A;  1BUD A;  3CKI A;  3HY9 A;  3LK8 A;  3MA2 A;  3TS4 A;  1SLM A;  1G12 A;  2MZH A;  4GR3 A;  4H1Q A;  1G49 A;  4I03 A;  5D1U A;  2X7M A;  5H8X A;  1CAQ A;  1SMP A;  1EUB A;  1JAO A;  3DTI A;  4XM8 A;  1JJ9 A;  3Q2G A;  4DF9 A;  5BOT A;  1B8Y A;  3WV1 A;  2QPJ A;  3LGP A;  5I12 A;  3OHO A;  2DW1 A;  1RMZ A;  4H3X A;  1BKC I;  2PJT A;  3KME A;  5D1S A;  4GR0 A;  1OS2 A;  1K7I A;  1ZVX A;  2Y6C A;  5I43 A;  1CQR A;  1UTZ A;  1JIW P;  4AXQ A;  1QIB A;  3P24 A;  2MLS A;  4A7B A;  2JIH A;  1JIZ A;  1XFY A;  1PWW A;  5I4O A;  3LIK A;  1EAK A;  1L6J A;  5I0L A;  1Z3J A;  5L7F A;  4PKU A;  3AIG A;  1H71 P;  1CIZ A;  4GR8 A;  1Y8J A;  1UEA A;  830C A;  4L7A A;  1SRP A;  3KRY A;  2N8R A;  3U1R A;  4IUW A;  4PKT A;  3B92 A;  4ZR5 A;  4I35 A;  3I7G A;  1DMT A;  3ZXH A;  2FV9 A;  1KAP P;  3L0T A;  3DSL A;  3G42 A;  3LQ0 A;  1KUG A;  1QIA A;  4GF1 A;  4GWN A;  1BZS A;  3KEK A;  4PKR A;  1AF0 A;  2AYK A;  2DW2 A;  1GE6 A;  1WNI A;  2CKI A;  3EHY A;  2MLR A;  1MMR A;  2X3B A;  1GO7 P;  2Z2D A;  3EDG A;  4J4M A;  1ATL A;  3LUN A;  1A86 A;  1C3I A;  2YIG A;  5CUH A;  5B5P A;  2ERO A;  1OM6 A;  2K2G A;  4WF6 A;  1GE7 A;  2OW9 A;  4XM7 A;  1Y0V A;  3F16 A;  1I73 A;  3USN A;  5L79 A;  4Q1L A;  4FXY P;  4QKZ A;  3LJZ A;  3RTS A;  2WO8 A; 
#chains in the Genus database with same CATH homology
 1B3D A;  2OW1 A;  1HFS A;  1MMQ A;  1BIW A;  2W14 A;  2OW0 A;  3LIR A;  3EDH A;  5CZM A;  1XFZ A;  1BSW A;  1G4K A;  1XFW A;  1PWU A;  4DD8 A;  1HFC A;  3HBV P;  1JK3 A;  4H82 A;  3Q2H A;  1I76 A;  1BKC E;  3DWB A;  3DPE A;  5I3M A;  1OM8 A;  5D7W A;  4IJO A;  1ZXV A;  3EHX A;  1JH1 A;  2MZI A;  4AIG A;  2HU6 A;  4XM6 A;  3TSK A;  1OO9 A;  1GO8 P;  5D2B A;  3K7L A;  1PWP A;  3KEC A;  1ROS A;  4CTH A;  2JSD A;  3ZUK A;  2X3C A;  5JMY A;  1C7K A;  4L19 A;  4H76 A;  3BA0 A;  2CLT A;  2OXW A;  3P1V A;  4GQL A;  3LKA A;  3UVC A;  4PKV A;  2E2D A;  3V96 B;  3EWJ A;  4IN9 A;  3HDB A;  3LUM A;  3G5C A;  4WZV A;  1BKC A;  3WV3 A;  3LJG A;  3AYK A;  5BPA A;  3LJT A;  2I47 A;  1D8M A;  5BOY A;  5I2Z A;  3HYG A;  1YOU A;  1GKC A;  1XFX A;  1JAP A;  1OMJ A;  5D1T A;  2OI0 A;  1BQQ M;  3LEA A;  2DW0 A;  3ZVS A;  1G9K A;  4XBH A;  4HX3 A;  2OVX A;  1XUD A;  1MMB A;  2E3X A;  4WKI A;  4H2E A;  3GBO A;  1UMS A;  2KRJ A;  2POJ A;  1O0Q A;  3N2U A;  1CGF A;  1KBC A;  1JKY A;  2MZE A;  4JIJ A;  1QJI A;  4ON1 A;  4A3W A;  2YB9 A;  4HMA A;  1IAD A;  2JNP A;  4G9L A;  1IAA A;  1HV5 A;  1R55 A;  4AYK A;  2ERQ A;  2L0R A;  3LQB A;  1XFV A;  3EDI A;  1KUK A;  1ZP5 A;  3VI1 A;  4GUY A;  4JP4 A;  1IAG A;  1CXV A;  5D3C A;  1MMP A;  2V4B A;  1XUC A;  2WOA A;  3RTT A;  2FV5 A;  1SLN A;  4H30 A;  1Q3A A;  2X3A A;  1UTT A;  3DTK A;  4XCT A;  2OW2 A;  2O3E A;  1KUI A;  2W15 A;  3F1A A;  3F18 A;  1KUF A;  1R1H A;  3HBU P;  2SRT A;  2OXU A;  2W13 A;  1I1I P;  4FVL A;  2J83 A;  2OVZ A;  2JT5 A;  1R54 A;  1S4B P;  1J7N A;  1CGE A;  3HB2 P;  3KWV C;  1XFU A;  1ZS0 A;  1AKL A;  1OS9 A;  3E8R A;  1IAB A;  1YP1 A;  1G05 A;  1D5J A;  3HDA P;  4L6T A;  3DPF A;  1JAQ A;  1GE5 A;  1GXD A;  4AUO A;  1K7Q A;  1A85 A;  5B5O A;  4FU4 A;  4PKW A;  1R1J A;  3EDZ A;  3K7N A;  2XS4 A;  4ILW D;  3DNG A;  4DPE A;  1FBL A;  3HY7 A;  2OY4 A;  2D1O A;  1IAC A;  2A8H A;  2DDF A;  1O0T A;  4JQG A;  2W12 A;  3DTE A;  1CGL A;  2O36 A;  1K7G A;  4L63 A;  3LE9 A;  1KUH A;  4JPA A;  2W0D A;  1IAE A;  1BUV M;  2OXZ A;  1MNC A;  2ERP A;  1GKD A;  4H84 A;  4PKS A;  2D1N A;  1DTH A;  1QJJ A;  4R3V A;  1QIC A;  4JA1 A;  2AIG P;  1OM7 A;  1YCM A;  1Y93 A;  1EB6 A;  2JT6 A;  1AYK A;  3OHL A;  3O64 A;  1PWV A;  1ND1 A;  3KHI A;  1D7X A;  4DV8 A;  2J0T A;  4WKE A;  3I7I A;  3ELM A;  3WV2 A;  3N2V A;  2XS3 A;  1HOV A;  5CXA A;  3L0V A;  1R1I A;  3LMC A;  5LAB A;  3NX7 A;  3TVC A;  3SHI A;  1C8T A;  3KEJ A;  4WK7 A;  1HY7 A;  3B8Z A;  1QUA A;  3TT4 A;  2RJP A;  4G0D A;  3VTG A;  3KMC A;  2RJQ A;  456C A;  2YUF A;  1D8F A;  3B2Z A;  3DL1 A;  966C A;  2DDY A;  4EFS A;  2TCL A;  2WO9 A;  1RM8 A;  2OY2 A;  1AST A;  1SU3 A;  1USN A;  4H49 A;  1XUR A;  3F19 A;  1SAT A;  1BM6 A;  1ZXC A;  1YQY A;  2USN A;  3O2X A;  1HTD A;  1FM1 A;  4PKQ A;  1UMT A;  3F15 A;  2Y6D A;  1PWQ A;  1FLS A;  1ZTQ A;  1BQO A;  3LIL A;  4GWM A;  1CK7 A;  3AYU A;  2OZR A;  4FXQ A;  2K9C A;  1JAN A;  3F17 A;  1BUD A;  3CKI A;  3HY9 A;  3LK8 A;  3MA2 A;  3TS4 A;  1SLM A;  1G12 A;  2MZH A;  4GR3 A;  4H1Q A;  1G49 A;  4I03 A;  5D1U A;  2X7M A;  5H8X A;  1CAQ A;  1SMP A;  1EUB A;  1JAO A;  3DTI A;  4XM8 A;  1JJ9 A;  3Q2G A;  4DF9 A;  5BOT A;  1B8Y A;  3WV1 A;  2QPJ A;  3LGP A;  5I12 A;  3OHO A;  2DW1 A;  1RMZ A;  4H3X A;  1BKC I;  2PJT A;  3KME A;  5D1S A;  4GR0 A;  1OS2 A;  1K7I A;  1ZVX A;  2Y6C A;  5I43 A;  1CQR A;  1UTZ A;  1JIW P;  4AXQ A;  1QIB A;  3P24 A;  2MLS A;  4A7B A;  2JIH A;  1JIZ A;  1XFY A;  1PWW A;  5I4O A;  3LIK A;  1EAK A;  1L6J A;  5I0L A;  1Z3J A;  5L7F A;  4PKU A;  3AIG A;  1H71 P;  1CIZ A;  4GR8 A;  1Y8J A;  1UEA A;  830C A;  4L7A A;  1SRP A;  3KRY A;  2N8R A;  3U1R A;  4IUW A;  4PKT A;  3B92 A;  4ZR5 A;  4I35 A;  3I7G A;  1DMT A;  3ZXH A;  2FV9 A;  1KAP P;  3L0T A;  3DSL A;  3G42 A;  3LQ0 A;  1KUG A;  1QIA A;  4GF1 A;  4GWN A;  1BZS A;  3KEK A;  4PKR A;  1AF0 A;  2AYK A;  2DW2 A;  1GE6 A;  1WNI A;  2CKI A;  3EHY A;  2MLR A;  1MMR A;  2X3B A;  1GO7 P;  2Z2D A;  3EDG A;  4J4M A;  1ATL A;  3LUN A;  1A86 A;  1C3I A;  2YIG A;  5CUH A;  5B5P A;  2ERO A;  1OM6 A;  2K2G A;  4WF6 A;  1GE7 A;  2OW9 A;  4XM7 A;  1Y0V A;  3F16 A;  1I73 A;  3USN A;  5L79 A;  4Q1L A;  4FXY P;  4QKZ A;  3LJZ A;  3RTS A;  2WO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...