1HOVA

Solution structure of a catalytic domain of mmp-2 complexed with sc-74020
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
163
structure length
163
Chain Sequence
MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and backbone dynamics of the catalytic domain of matrix metalloproteinase-2 complexed with a hydroxamic acid inhibitor
pubmed doi rcsb
molecule keywords MATRIX METALLOPROTEINASE-2
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 25
structure length 163
sequence length 163
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2000-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1hovA00
3HYGA 4PKRA 4R3VA 2OXWA 4AXQA 1HFSA 4G9LA 4FXYP 3CKIA 1JIWP 4WKIA 3G42A 4XM7A 4H1QA 1D8MA 1BUDA 2OW9A 2Z2DA 1PWPA 3V96B 5L7FA 1ZP5A 3EHYA 1CQRA 4GUYA 1ND1A 2EROA 3L0VA 2MLRA 2I47A 4H49A 2KRJA 1G4KA 3KRYA 4WKEA 4I03A 3UVCA 2O36A 1XFZA 3LUMA 1UMSA 1MNCA 1JK3A 1OS9A 1WNIA 3OHLA 1KUKA 5I0LA 4ILWD 5I43A 1I1IP 3G5CA 3KHIA 2W0DA 4JQGA 1BSWA 1Y93A 2SRTA 1L6JA 4JIJA 2JIHA 4GR8A 4WF6A 2X3CA 3RTSA 1KUIA 1XUCA 2PJTA 1UTTA 4A7BA 1I73A 3EHXA 4DF9A 1R54A 2N8RA 3F15A 1SATA 2K9CA 2YIGA 4JP4A 4PKWA 1FM1A 3Q2GA 1JJ9A 1YQYA 1HTDA 5BOTA 2USNA 1UEAA 3OHOA 1XUDA 3DWBA 1BQQM 3GBOA 1OMJA 1BIWA 1K7QA 2JT6A 4AIGA 1KBCA 3WV2A 3F19A 1R55A 2Y6DA 1MMPA 2OW2A 3L0TA 2OW0A 4FU4A 1DTHA 3ZVSA 3EWJA 1K7GA 3HBUP 3USNA 1QUAA 3HBVP 1IACA 3WV1A 1A86A 4GF1A 5I4OA 4FVLA 4WK7A 1AYKA 3P1VA 830CA 1CIZA 2OVXA 2W12A 4QKZA 1SRPA 4ZR5A 2D1NA 4PKUA 3LMCA 1BQOA 3LQBA 1HV5A 3K7NA 2OXZA 4H30A 2JT5A 2DW1A 5L79A 1GXDA 2E3XA 1O0QA 1GE6A 3HDAP 3TT4A 4L19A 1SLNA 3I7IA 1EAKA 3AYKA 2OW1A 1UTZA 1QIBA 4IJOA 3F17A 5BPAA 1GKDA 5D1TA 1GE7A 3LJZA 1EB6A 1PWQA 3DPEA 1ASTA 2DDFA 3Q2HA 1G49A 2ERPA 1OM6A 1EUBA 4Q1LA 1KUFA 2X3AA 3HDBA 3SHIA 3K7LA 1SU3A 1ZTQA 3LJGA 2JSDA 3VI1A 4FXQA 5D1SA 4EFSA 4GR3A 4AYKA 5I2ZA 5JMYA 1C3IA 3F1AA 2FV9A 1XFUA 3LEAA 4I35A 3TVCA 3LIRA 2OZRA 4HMAA 1XFWA 2MZEA 1XFYA 1OM8A 3MA2A 2TCLA 3LJTA 3HB2P 3BA0A 1BM6A 1FLSA 3B8ZA 1GKCA 4H82A 1OS2A 3DPFA 3LIKA 4J4MA 5H8XA 2X7MA 5B5PA 2O3EA 1USNA 5CZMA 4CTHA 2WOAA 2A8HA 1OO9A 1YOUA 3LGPA 1PWVA 3ZUKA 1IAEA 3P24A 4DD8A 2RJQA 1D8FA 1GO7P 1BKCA 1BKCE 2K2GA 1G05A 4AUOA 4GWNA 1YCMA 3U1RA 4G0DA 4PKQA 1UMTA 3EDZA 1XURA 1JANA 1D5JA 3LE9A 1GO8P 1BZSA 2OVZA 2MZIA 1JKYA 2HU6A 5LABA 3LKAA 1DMTA 3N2VA 1G12A 3EDHA 1SMPA 1MMQA 2RJPA 4HX3A 1HFCA 4IN9A 1Y0VA 2E2DA 2J83A 1JH1A 1CGLA 1XFVA 1AF0A 1KAPP 3LILA 2X3BA 2W13A 2MLSA 1R1IA 966CA 2Y6CA 1PWUA 1IADA 1KUGA 1QJIA 1D7XA 4H84A 4XM8A 1CK7A 4WZVA 4JPAA 3B92A 1JAPA 2XS4A 5B5OA 1CGFA 2W15A 2CKIA 2V4BA 3I7GA 3F16A 1BUVM 3B2ZA 1ZS0A 1RMZA 3KWVC 456CA 1MMBA 1GE5A 4XM6A 3HY9A 1J7NA 1IABA 2DW2A 5D3CA 4ON1A 1FBLA 1IAAA 1RM8A 1CXVA 1H71P 1QJJA 4XBHA 1OM7A 1C8TA 1ZVXA 2XS3A 1C7KA 2YB9A 3KEJA 5D2BA 2L0RA 4XCTA 1R1JA 4PKVA 3DNGA 1HY7A 1CGEA 3N2UA 1ZXCA 3AIGA 3ZXHA 1IAGA 5I3MA 3WV3A 3EDIA 1B3DA 1R1HA 5D1UA 1MMRA 3F18A 1QIAA 3KMCA 4PKTA 3TSKA 3RTTA 4L6TA 1A85A 1ATLA 2DW0A 2FV5A 3LK8A 4GWMA 4H2EA 1O0TA 1AKLA 2WO8A 3O64A 1CAQA 2MZHA 1BKCI 4H3XA 4DV8A 2OXUA 1Y8JA 3E8RA 4DPEA 1ZXVA 1JIZA 2WO9A 5D7WA 1KUHA 4H76A 3KEKA 4L63A 2AIGP 4JA1A 1B8YA 2JNPA 2OI0A 2D1OA 4A3WA 3TS4A 2ERQA 1G9KA 3ELMA 3LQ0A 1QICA 1S4BP 5CUHA 2DDYA 2AYKA 1JAOA 1Z3JA 2OY4A 1SLMA 4PKSA 1ROSA 3DL1A 3DSLA 3AYUA 2POJA 3KMEA 2J0TA 2QPJA 1I76A 3VTGA 5I12A 5BOYA 1K7IA 4IUWA 5CXAA 3EDGA 4GQLA 2OY2A 1JAQA 3LUNA 3O2XA 3HY7A 1YP1A 2W14A 3KECA 1HOVA 4GR0A 1PWWA 2CLTA 3NX7A 1Q3AA 1XFXA
chains in the Genus database with same CATH superfamily
3HYGA 4PKRA 4R3VA 2OXWA 4AXQA 1HFSA 4G9LA 4FXYP 3CKIA 1JIWP 4WKIA 3G42A 4XM7A 4H1QA 1D8MA 1BUDA 2OW9A 2Z2DA 1PWPA 3V96B 5L7FA 1ZP5A 3EHYA 1CQRA 4GUYA 1ND1A 2EROA 3L0VA 2YUFA 2MLRA 2I47A 4H49A 2KRJA 1G4KA 3KRYA 4WKEA 4I03A 3UVCA 2O36A 1XFZA 3LUMA 1UMSA 1MNCA 1JK3A 1OS9A 1WNIA 4L7AA 3OHLA 1KUKA 5I0LA 4ILWD 5I43A 1I1IP 3G5CA 3KHIA 2W0DA 4JQGA 1BSWA 1Y93A 2SRTA 1L6JA 4JIJA 2JIHA 4GR8A 4WF6A 2X3CA 3RTSA 1KUIA 1XUCA 2PJTA 1UTTA 4A7BA 1I73A 3EHXA 1OZ9A 4DF9A 1R54A 2N8RA 3F15A 1SATA 2K9CA 2YIGA 4JP4A 4PKWA 1FM1A 3Q2GA 1JJ9A 1YQYA 1HTDA 5BOTA 2USNA 1UEAA 3OHOA 1XUDA 3DWBA 1BQQM 3GBOA 1OMJA 1BIWA 1K7QA 2JT6A 4AIGA 1KBCA 3WV2A 3F19A 1R55A 2Y6DA 1MMPA 2OW2A 3L0TA 2OW0A 4FU4A 1DTHA 3ZVSA 3EWJA 1K7GA 3HBUP 3USNA 1QUAA 3HBVP 1IACA 3WV1A 1A86A 4GF1A 5I4OA 4FVLA 4WK7A 1AYKA 3P1VA 830CA 1CIZA 2OVXA 2W12A 4QKZA 1SRPA 4ZR5A 2D1NA 4PKUA 3LMCA 1BQOA 3LQBA 1HV5A 3K7NA 2OXZA 4H30A 2JT5A 2DW1A 5L79A 1GXDA 2E3XA 1O0QA 1GE6A 3HDAP 3TT4A 4L19A 1SLNA 3I7IA 1EAKA 3AYKA 2OW1A 1UTZA 1QIBA 4IJOA 3F17A 5BPAA 1GKDA 5D1TA 1GE7A 3LJZA 1EB6A 1PWQA 3DPEA 1ASTA 2DDFA 3Q2HA 1G49A 2ERPA 1OM6A 1EUBA 4Q1LA 1KUFA 2X3AA 3HDBA 3SHIA 3K7LA 1SU3A 1ZTQA 3LJGA 2JSDA 3VI1A 4FXQA 5D1SA 4EFSA 4GR3A 4AYKA 5I2ZA 5JMYA 1C3IA 3F1AA 2FV9A 1XFUA 3LEAA 4I35A 3TVCA 3LIRA 2OZRA 4HMAA 1XFWA 2MZEA 1XFYA 1OM8A 3MA2A 2TCLA 3LJTA 3HB2P 3BA0A 1BM6A 1FLSA 3B8ZA 1GKCA 4H82A 1OS2A 3DPFA 3LIKA 4J4MA 5H8XA 2X7MA 5B5PA 2O3EA 1USNA 5CZMA 4CTHA 2WOAA 2A8HA 1OO9A 1YOUA 3LGPA 1PWVA 3ZUKA 3DTEA 1IAEA 3P24A 4DD8A 2RJQA 1D8FA 1GO7P 1BKCA 1BKCE 2K2GA 1G05A 4AUOA 4GWNA 1YCMA 3U1RA 4G0DA 4PKQA 1UMTA 3EDZA 1XURA 1JANA 1D5JA 3LE9A 1GO8P 1BZSA 2OVZA 2MZIA 1JKYA 2HU6A 5LABA 3LKAA 1DMTA 3N2VA 1G12A 3EDHA 1SMPA 1MMQA 2RJPA 4HX3A 1HFCA 4IN9A 1Y0VA 2E2DA 2J83A 1JH1A 1CGLA 1XFVA 1AF0A 1KAPP 3LILA 2X3BA 2W13A 2MLSA 1R1IA 966CA 2Y6CA 1PWUA 1IADA 1KUGA 1QJIA 1D7XA 4H84A 4XM8A 1CK7A 4WZVA 1TVIA 4JPAA 3B92A 1JAPA 2XS4A 5B5OA 1CGFA 2W15A 2CKIA 2V4BA 3I7GA 3F16A 1BUVM 3B2ZA 1ZS0A 1RMZA 3KWVC 456CA 1MMBA 1GE5A 4XM6A 3HY9A 1J7NA 1IABA 2DW2A 5D3CA 4ON1A 1FBLA 1IAAA 1RM8A 1CXVA 1H71P 1QJJA 4XBHA 1OM7A 1C8TA 1ZVXA 2XS3A 1C7KA 2YB9A 3KEJA 5D2BA 2L0RA 4XCTA 1R1JA 4PKVA 3DNGA 1HY7A 1CGEA 3N2UA 1ZXCA 3AIGA 3ZXHA 1IAGA 5I3MA 3DTIA 3WV3A 3EDIA 1B3DA 1R1HA 5D1UA 1MMRA 3F18A 1QIAA 3KMCA 4PKTA 3TSKA 3RTTA 4L6TA 1A85A 1ATLA 2DW0A 2FV5A 3LK8A 4GWMA 4H2EA 1O0TA 1AKLA 2WO8A 3O64A 1CAQA 2MZHA 1BKCI 4H3XA 4DV8A 2OXUA 1Y8JA 3E8RA 4DPEA 1ZXVA 1JIZA 2WO9A 5D7WA 1KUHA 4H76A 3KEKA 4L63A 2AIGP 4JA1A 1XM5A 1B8YA 2JNPA 2OI0A 2D1OA 4A3WA 3TS4A 2ERQA 1G9KA 3ELMA 3LQ0A 1QICA 1S4BP 3DTKA 5CUHA 2DDYA 2AYKA 1JAOA 1Z3JA 2OY4A 1XAXA 1SLMA 4PKSA 1ROSA 3DL1A 3DSLA 3AYUA 2POJA 3KMEA 2J0TA 2QPJA 1I76A 3VTGA 5I12A 5BOYA 1K7IA 4IUWA 5CXAA 3EDGA 4GQLA 2OY2A 1JAQA 3LUNA 3O2XA 3HY7A 1YP1A 2W14A 3KECA 1HOVA 4GR0A 1PWWA 2CLTA 3NX7A 1Q3AA 1XFXA
chains in the Genus database with same CATH topology
3HYGA 4PKRA 4R3VA 2OXWA 4AXQA 1HFSA 4G9LA 4FXYP 3CKIA 1JIWP 4WKIA 3G42A 4XM7A 4H1QA 1D8MA 1BUDA 2OW9A 2Z2DA 1PWPA 3V96B 5L7FA 1ZP5A 3EHYA 1CQRA 4GUYA 1ND1A 2EROA 3L0VA 2YUFA 2MLRA 2I47A 4H49A 2KRJA 1G4KA 3KRYA 4WKEA 4I03A 3UVCA 2O36A 1XFZA 3LUMA 1UMSA 1MNCA 1JK3A 1OS9A 1WNIA 4L7AA 3OHLA 1KUKA 5I0LA 4ILWD 5I43A 1I1IP 3G5CA 3KHIA 2W0DA 4JQGA 1BSWA 1Y93A 2SRTA 1L6JA 4JIJA 2JIHA 4GR8A 4WF6A 2X3CA 3RTSA 1KUIA 1XUCA 2PJTA 1UTTA 4A7BA 1I73A 3EHXA 4DF9A 1R54A 2N8RA 3F15A 1SATA 2K9CA 2YIGA 4JP4A 4PKWA 1FM1A 3Q2GA 1JJ9A 1YQYA 1HTDA 5BOTA 2USNA 1UEAA 3OHOA 1XUDA 3DWBA 1BQQM 3GBOA 1OMJA 1BIWA 1K7QA 2JT6A 4AIGA 1KBCA 3WV2A 3F19A 1R55A 2Y6DA 1MMPA 2OW2A 3L0TA 2OW0A 4FU4A 1DTHA 3ZVSA 3EWJA 1K7GA 3HBUP 3USNA 1QUAA 3HBVP 1IACA 3WV1A 1A86A 4GF1A 5I4OA 4FVLA 4WK7A 1AYKA 3P1VA 830CA 1CIZA 2OVXA 2W12A 4QKZA 1SRPA 4ZR5A 2D1NA 4PKUA 3LMCA 1BQOA 3LQBA 1HV5A 3K7NA 2OXZA 4H30A 2JT5A 2DW1A 5L79A 1GXDA 2E3XA 1O0QA 1GE6A 3HDAP 3TT4A 4L19A 1SLNA 3I7IA 1EAKA 3AYKA 2OW1A 1UTZA 1QIBA 4IJOA 3F17A 5BPAA 1GKDA 5D1TA 1GE7A 3LJZA 1EB6A 1PWQA 3DPEA 1ASTA 2DDFA 3Q2HA 1G49A 2ERPA 1OM6A 1EUBA 4Q1LA 1KUFA 2X3AA 3HDBA 3SHIA 3K7LA 1SU3A 1ZTQA 3LJGA 2JSDA 3VI1A 4FXQA 5D1SA 4EFSA 4GR3A 4AYKA 5I2ZA 5JMYA 1C3IA 3F1AA 2FV9A 1XFUA 3LEAA 4I35A 3TVCA 3LIRA 2OZRA 4HMAA 1XFWA 2MZEA 1XFYA 1OM8A 3MA2A 2TCLA 3LJTA 3HB2P 3BA0A 1BM6A 1FLSA 3B8ZA 1GKCA 4H82A 1OS2A 3DPFA 3LIKA 4J4MA 5H8XA 2X7MA 5B5PA 2O3EA 1USNA 5CZMA 4CTHA 2WOAA 2A8HA 1OO9A 1YOUA 3LGPA 1PWVA 3ZUKA 3DTEA 1IAEA 3P24A 4DD8A 2RJQA 1D8FA 1GO7P 1BKCA 1BKCE 2K2GA 1G05A 4AUOA 4GWNA 1YCMA 3U1RA 4G0DA 4PKQA 1UMTA 3EDZA 1XURA 1JANA 1D5JA 3LE9A 1GO8P 1BZSA 2OVZA 2MZIA 1JKYA 2HU6A 5LABA 3LKAA 1DMTA 3N2VA 1G12A 3EDHA 1SMPA 1MMQA 2RJPA 4HX3A 1HFCA 4IN9A 1Y0VA 2E2DA 2J83A 1JH1A 1CGLA 1XFVA 1AF0A 1KAPP 3LILA 2X3BA 2W13A 2MLSA 1R1IA 966CA 2Y6CA 1PWUA 1IADA 1KUGA 1QJIA 1D7XA 4H84A 4XM8A 1CK7A 4WZVA 4JPAA 3B92A 1JAPA 2XS4A 5B5OA 1CGFA 2W15A 2CKIA 2V4BA 3I7GA 3F16A 1BUVM 3B2ZA 1ZS0A 1RMZA 3KWVC 456CA 1MMBA 1GE5A 4XM6A 3HY9A 1J7NA 1IABA 2DW2A 5D3CA 4ON1A 1FBLA 1IAAA 1RM8A 1CXVA 1H71P 1QJJA 4XBHA 1OM7A 1C8TA 1ZVXA 2XS3A 1C7KA 2YB9A 3KEJA 5D2BA 2L0RA 4XCTA 1R1JA 4PKVA 3DNGA 1HY7A 1CGEA 3N2UA 1ZXCA 3AIGA 3ZXHA 1IAGA 5I3MA 3DTIA 3WV3A 3EDIA 1B3DA 1R1HA 5D1UA 1MMRA 3F18A 1QIAA 3KMCA 4PKTA 3TSKA 3RTTA 4L6TA 1A85A 1ATLA 2DW0A 2FV5A 3LK8A 4GWMA 4H2EA 1O0TA 1AKLA 2WO8A 3O64A 1CAQA 2MZHA 1BKCI 4H3XA 4DV8A 2OXUA 1Y8JA 3E8RA 4DPEA 1ZXVA 1JIZA 2WO9A 5D7WA 1KUHA 4H76A 3KEKA 4L63A 2AIGP 4JA1A 1B8YA 2JNPA 2OI0A 2D1OA 4A3WA 3TS4A 2ERQA 1G9KA 3ELMA 3LQ0A 1QICA 1S4BP 3DTKA 5CUHA 2DDYA 2AYKA 1JAOA 1Z3JA 2OY4A 1SLMA 4PKSA 1ROSA 3DL1A 3DSLA 3AYUA 2POJA 3KMEA 2J0TA 2QPJA 1I76A 3VTGA 5I12A 5BOYA 1K7IA 4IUWA 5CXAA 3EDGA 4GQLA 2OY2A 1JAQA 3LUNA 3O2XA 3HY7A 1YP1A 2W14A 3KECA 1HOVA 4GR0A 1PWWA 2CLTA 3NX7A 1Q3AA 1XFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYG A;  4PKR A;  4R3V A;  2OXW A;  4AXQ A;  1HFS A;  4G9L A;  4FXY P;  3CKI A;  1JIW P;  4WKI A;  3G42 A;  4XM7 A;  4H1Q A;  1D8M A;  1BUD A;  2OW9 A;  2Z2D A;  1PWP A;  3V96 B;  5L7F A;  1ZP5 A;  3EHY A;  1CQR A;  4GUY A;  1ND1 A;  2ERO A;  3L0V A;  2MLR A;  2I47 A;  4H49 A;  2KRJ A;  1G4K A;  3KRY A;  4WKE A;  4I03 A;  3UVC A;  2O36 A;  1XFZ A;  3LUM A;  1UMS A;  1MNC A;  1JK3 A;  1OS9 A;  1WNI A;  3OHL A;  1KUK A;  5I0L A;  4ILW D;  5I43 A;  1I1I P;  3G5C A;  3KHI A;  2W0D A;  4JQG A;  1BSW A;  1Y93 A;  2SRT A;  1L6J A;  4JIJ A;  2JIH A;  4GR8 A;  4WF6 A;  2X3C A;  3RTS A;  1KUI A;  1XUC A;  2PJT A;  1UTT A;  4A7B A;  1I73 A;  3EHX A;  4DF9 A;  1R54 A;  2N8R A;  3F15 A;  1SAT A;  2K9C A;  2YIG A;  4JP4 A;  4PKW A;  1FM1 A;  3Q2G A;  1JJ9 A;  1YQY A;  1HTD A;  5BOT A;  2USN A;  1UEA A;  3OHO A;  1XUD A;  3DWB A;  1BQQ M;  3GBO A;  1OMJ A;  1BIW A;  1K7Q A;  2JT6 A;  4AIG A;  1KBC A;  3WV2 A;  3F19 A;  1R55 A;  2Y6D A;  1MMP A;  2OW2 A;  3L0T A;  2OW0 A;  4FU4 A;  1DTH A;  3ZVS A;  3EWJ A;  1K7G A;  3HBU P;  3USN A;  1QUA A;  3HBV P;  1IAC A;  3WV1 A;  1A86 A;  4GF1 A;  5I4O A;  4FVL A;  4WK7 A;  1AYK A;  3P1V A;  830C A;  1CIZ A;  2OVX A;  2W12 A;  4QKZ A;  1SRP A;  4ZR5 A;  2D1N A;  4PKU A;  3LMC A;  1BQO A;  3LQB A;  1HV5 A;  3K7N A;  2OXZ A;  4H30 A;  2JT5 A;  2DW1 A;  5L79 A;  1GXD A;  2E3X A;  1O0Q A;  1GE6 A;  3HDA P;  3TT4 A;  4L19 A;  1SLN A;  3I7I A;  1EAK A;  3AYK A;  2OW1 A;  1UTZ A;  1QIB A;  4IJO A;  3F17 A;  5BPA A;  1GKD A;  5D1T A;  1GE7 A;  3LJZ A;  1EB6 A;  1PWQ A;  3DPE A;  1AST A;  2DDF A;  3Q2H A;  1G49 A;  2ERP A;  1OM6 A;  1EUB A;  4Q1L A;  1KUF A;  2X3A A;  3HDB A;  3SHI A;  3K7L A;  1SU3 A;  1ZTQ A;  3LJG A;  2JSD A;  3VI1 A;  4FXQ A;  5D1S A;  4EFS A;  4GR3 A;  4AYK A;  5I2Z A;  5JMY A;  1C3I A;  3F1A A;  2FV9 A;  1XFU A;  3LEA A;  4I35 A;  3TVC A;  3LIR A;  2OZR A;  4HMA A;  1XFW A;  2MZE A;  1XFY A;  1OM8 A;  3MA2 A;  2TCL A;  3LJT A;  3HB2 P;  3BA0 A;  1BM6 A;  1FLS A;  3B8Z A;  1GKC A;  4H82 A;  1OS2 A;  3DPF A;  3LIK A;  4J4M A;  5H8X A;  2X7M A;  5B5P A;  2O3E A;  1USN A;  5CZM A;  4CTH A;  2WOA A;  2A8H A;  1OO9 A;  1YOU A;  3LGP A;  1PWV A;  3ZUK A;  1IAE A;  3P24 A;  4DD8 A;  2RJQ A;  1D8F A;  1GO7 P;  1BKC A;  1BKC E;  2K2G A;  1G05 A;  4AUO A;  4GWN A;  1YCM A;  3U1R A;  4G0D A;  4PKQ A;  1UMT A;  3EDZ A;  1XUR A;  1JAN A;  1D5J A;  3LE9 A;  1GO8 P;  1BZS A;  2OVZ A;  2MZI A;  1JKY A;  2HU6 A;  5LAB A;  3LKA A;  1DMT A;  3N2V A;  1G12 A;  3EDH A;  1SMP A;  1MMQ A;  2RJP A;  4HX3 A;  1HFC A;  4IN9 A;  1Y0V A;  2E2D A;  2J83 A;  1JH1 A;  1CGL A;  1XFV A;  1AF0 A;  1KAP P;  3LIL A;  2X3B A;  2W13 A;  2MLS A;  1R1I A;  966C A;  2Y6C A;  1PWU A;  1IAD A;  1KUG A;  1QJI A;  1D7X A;  4H84 A;  4XM8 A;  1CK7 A;  4WZV A;  4JPA A;  3B92 A;  1JAP A;  2XS4 A;  5B5O A;  1CGF A;  2W15 A;  2CKI A;  2V4B A;  3I7G A;  3F16 A;  1BUV M;  3B2Z A;  1ZS0 A;  1RMZ A;  3KWV C;  456C A;  1MMB A;  1GE5 A;  4XM6 A;  3HY9 A;  1J7N A;  1IAB A;  2DW2 A;  5D3C A;  4ON1 A;  1FBL A;  1IAA A;  1RM8 A;  1CXV A;  1H71 P;  1QJJ A;  4XBH A;  1OM7 A;  1C8T A;  1ZVX A;  2XS3 A;  1C7K A;  2YB9 A;  3KEJ A;  5D2B A;  2L0R A;  4XCT A;  1R1J A;  4PKV A;  3DNG A;  1HY7 A;  1CGE A;  3N2U A;  1ZXC A;  3AIG A;  3ZXH A;  1IAG A;  5I3M A;  3WV3 A;  3EDI A;  1B3D A;  1R1H A;  5D1U A;  1MMR A;  3F18 A;  1QIA A;  3KMC A;  4PKT A;  3TSK A;  3RTT A;  4L6T A;  1A85 A;  1ATL A;  2DW0 A;  2FV5 A;  3LK8 A;  4GWM A;  4H2E A;  1O0T A;  1AKL A;  2WO8 A;  3O64 A;  1CAQ A;  2MZH A;  1BKC I;  4H3X A;  4DV8 A;  2OXU A;  1Y8J A;  3E8R A;  4DPE A;  1ZXV A;  1JIZ A;  2WO9 A;  5D7W A;  1KUH A;  4H76 A;  3KEK A;  4L63 A;  2AIG P;  4JA1 A;  1B8Y A;  2JNP A;  2OI0 A;  2D1O A;  4A3W A;  3TS4 A;  2ERQ A;  1G9K A;  3ELM A;  3LQ0 A;  1QIC A;  1S4B P;  5CUH A;  2DDY A;  2AYK A;  1JAO A;  1Z3J A;  2OY4 A;  1SLM A;  4PKS A;  1ROS A;  3DL1 A;  3DSL A;  3AYU A;  2POJ A;  3KME A;  2J0T A;  2QPJ A;  1I76 A;  3VTG A;  5I12 A;  5BOY A;  1K7I A;  4IUW A;  5CXA A;  3EDG A;  4GQL A;  2OY2 A;  1JAQ A;  3LUN A;  3O2X A;  3HY7 A;  1YP1 A;  2W14 A;  3KEC A;  1HOV A;  4GR0 A;  1PWW A;  2CLT A;  3NX7 A;  1Q3A A;  1XFX A; 
#chains in the Genus database with same CATH topology
 3HYG A;  4PKR A;  4R3V A;  2OXW A;  4AXQ A;  1HFS A;  4G9L A;  4FXY P;  3CKI A;  1JIW P;  4WKI A;  3G42 A;  4XM7 A;  4H1Q A;  1D8M A;  1BUD A;  2OW9 A;  2Z2D A;  1PWP A;  3V96 B;  5L7F A;  1ZP5 A;  3EHY A;  1CQR A;  4GUY A;  1ND1 A;  2ERO A;  3L0V A;  2YUF A;  2MLR A;  2I47 A;  4H49 A;  2KRJ A;  1G4K A;  3KRY A;  4WKE A;  4I03 A;  3UVC A;  2O36 A;  1XFZ A;  3LUM A;  1UMS A;  1MNC A;  1JK3 A;  1OS9 A;  1WNI A;  4L7A A;  3OHL A;  1KUK A;  5I0L A;  4ILW D;  5I43 A;  1I1I P;  3G5C A;  3KHI A;  2W0D A;  4JQG A;  1BSW A;  1Y93 A;  2SRT A;  1L6J A;  4JIJ A;  2JIH A;  4GR8 A;  4WF6 A;  2X3C A;  3RTS A;  1KUI A;  1XUC A;  2PJT A;  1UTT A;  4A7B A;  1I73 A;  3EHX A;  1OZ9 A;  4DF9 A;  1R54 A;  2N8R A;  3F15 A;  1SAT A;  2K9C A;  2YIG A;  4JP4 A;  4PKW A;  1FM1 A;  3Q2G A;  1JJ9 A;  1YQY A;  1HTD A;  5BOT A;  2USN A;  1UEA A;  3OHO A;  1XUD A;  3DWB A;  1BQQ M;  3GBO A;  1OMJ A;  1BIW A;  1K7Q A;  2JT6 A;  4AIG A;  1KBC A;  3WV2 A;  3F19 A;  1R55 A;  2Y6D A;  1MMP A;  2OW2 A;  3L0T A;  2OW0 A;  4FU4 A;  1DTH A;  3ZVS A;  3EWJ A;  1K7G A;  3HBU P;  3USN A;  1QUA A;  3HBV P;  1IAC A;  3WV1 A;  1A86 A;  4GF1 A;  5I4O A;  4FVL A;  4WK7 A;  1AYK A;  3P1V A;  830C A;  1CIZ A;  2OVX A;  2W12 A;  4QKZ A;  1SRP A;  4ZR5 A;  2D1N A;  4PKU A;  3LMC A;  1BQO A;  3LQB A;  1HV5 A;  3K7N A;  2OXZ A;  4H30 A;  2JT5 A;  2DW1 A;  5L79 A;  1GXD A;  2E3X A;  1O0Q A;  1GE6 A;  3HDA P;  3TT4 A;  4L19 A;  1SLN A;  3I7I A;  1EAK A;  3AYK A;  2OW1 A;  1UTZ A;  1QIB A;  4IJO A;  3F17 A;  5BPA A;  1GKD A;  5D1T A;  1GE7 A;  3LJZ A;  1EB6 A;  1PWQ A;  3DPE A;  1AST A;  2DDF A;  3Q2H A;  1G49 A;  2ERP A;  1OM6 A;  1EUB A;  4Q1L A;  1KUF A;  2X3A A;  3HDB A;  3SHI A;  3K7L A;  1SU3 A;  1ZTQ A;  3LJG A;  2JSD A;  3VI1 A;  4FXQ A;  5D1S A;  4EFS A;  4GR3 A;  4AYK A;  5I2Z A;  5JMY A;  1C3I A;  3F1A A;  2FV9 A;  1XFU A;  3LEA A;  4I35 A;  3TVC A;  3LIR A;  2OZR A;  4HMA A;  1XFW A;  2MZE A;  1XFY A;  1OM8 A;  3MA2 A;  2TCL A;  3LJT A;  3HB2 P;  3BA0 A;  1BM6 A;  1FLS A;  3B8Z A;  1GKC A;  4H82 A;  1OS2 A;  3DPF A;  3LIK A;  4J4M A;  5H8X A;  2X7M A;  5B5P A;  2O3E A;  1USN A;  5CZM A;  4CTH A;  2WOA A;  2A8H A;  1OO9 A;  1YOU A;  3LGP A;  1PWV A;  3ZUK A;  3DTE A;  1IAE A;  3P24 A;  4DD8 A;  2RJQ A;  1D8F A;  1GO7 P;  1BKC A;  1BKC E;  2K2G A;  1G05 A;  4AUO A;  4GWN A;  1YCM A;  3U1R A;  4G0D A;  4PKQ A;  1UMT A;  3EDZ A;  1XUR A;  1JAN A;  1D5J A;  3LE9 A;  1GO8 P;  1BZS A;  2OVZ A;  2MZI A;  1JKY A;  2HU6 A;  5LAB A;  3LKA A;  1DMT A;  3N2V A;  1G12 A;  3EDH A;  1SMP A;  1MMQ A;  2RJP A;  4HX3 A;  1HFC A;  4IN9 A;  1Y0V A;  2E2D A;  2J83 A;  1JH1 A;  1CGL A;  1XFV A;  1AF0 A;  1KAP P;  3LIL A;  2X3B A;  2W13 A;  2MLS A;  1R1I A;  966C A;  2Y6C A;  1PWU A;  1IAD A;  1KUG A;  1QJI A;  1D7X A;  4H84 A;  4XM8 A;  1CK7 A;  4WZV A;  1TVI A;  4JPA A;  3B92 A;  1JAP A;  2XS4 A;  5B5O A;  1CGF A;  2W15 A;  2CKI A;  2V4B A;  3I7G A;  3F16 A;  1BUV M;  3B2Z A;  1ZS0 A;  1RMZ A;  3KWV C;  456C A;  1MMB A;  1GE5 A;  4XM6 A;  3HY9 A;  1J7N A;  1IAB A;  2DW2 A;  5D3C A;  4ON1 A;  1FBL A;  1IAA A;  1RM8 A;  1CXV A;  1H71 P;  1QJJ A;  4XBH A;  1OM7 A;  1C8T A;  1ZVX A;  2XS3 A;  1C7K A;  2YB9 A;  3KEJ A;  5D2B A;  2L0R A;  4XCT A;  1R1J A;  4PKV A;  3DNG A;  1HY7 A;  1CGE A;  3N2U A;  1ZXC A;  3AIG A;  3ZXH A;  1IAG A;  5I3M A;  3DTI A;  3WV3 A;  3EDI A;  1B3D A;  1R1H A;  5D1U A;  1MMR A;  3F18 A;  1QIA A;  3KMC A;  4PKT A;  3TSK A;  3RTT A;  4L6T A;  1A85 A;  1ATL A;  2DW0 A;  2FV5 A;  3LK8 A;  4GWM A;  4H2E A;  1O0T A;  1AKL A;  2WO8 A;  3O64 A;  1CAQ A;  2MZH A;  1BKC I;  4H3X A;  4DV8 A;  2OXU A;  1Y8J A;  3E8R A;  4DPE A;  1ZXV A;  1JIZ A;  2WO9 A;  5D7W A;  1KUH A;  4H76 A;  3KEK A;  4L63 A;  2AIG P;  4JA1 A;  1XM5 A;  1B8Y A;  2JNP A;  2OI0 A;  2D1O A;  4A3W A;  3TS4 A;  2ERQ A;  1G9K A;  3ELM A;  3LQ0 A;  1QIC A;  1S4B P;  3DTK A;  5CUH A;  2DDY A;  2AYK A;  1JAO A;  1Z3J A;  2OY4 A;  1XAX A;  1SLM A;  4PKS A;  1ROS A;  3DL1 A;  3DSL A;  3AYU A;  2POJ A;  3KME A;  2J0T A;  2QPJ A;  1I76 A;  3VTG A;  5I12 A;  5BOY A;  1K7I A;  4IUW A;  5CXA A;  3EDG A;  4GQL A;  2OY2 A;  1JAQ A;  3LUN A;  3O2X A;  3HY7 A;  1YP1 A;  2W14 A;  3KEC A;  1HOV A;  4GR0 A;  1PWW A;  2CLT A;  3NX7 A;  1Q3A A;  1XFX A; 
#chains in the Genus database with same CATH homology
 3HYG A;  4PKR A;  4R3V A;  2OXW A;  4AXQ A;  1HFS A;  4G9L A;  4FXY P;  3CKI A;  1JIW P;  4WKI A;  3G42 A;  4XM7 A;  4H1Q A;  1D8M A;  1BUD A;  2OW9 A;  2Z2D A;  1PWP A;  3V96 B;  5L7F A;  1ZP5 A;  3EHY A;  1CQR A;  4GUY A;  1ND1 A;  2ERO A;  3L0V A;  2YUF A;  2MLR A;  2I47 A;  4H49 A;  2KRJ A;  1G4K A;  3KRY A;  4WKE A;  4I03 A;  3UVC A;  2O36 A;  1XFZ A;  3LUM A;  1UMS A;  1MNC A;  1JK3 A;  1OS9 A;  1WNI A;  4L7A A;  3OHL A;  1KUK A;  5I0L A;  4ILW D;  5I43 A;  1I1I P;  3G5C A;  3KHI A;  2W0D A;  4JQG A;  1BSW A;  1Y93 A;  2SRT A;  1L6J A;  4JIJ A;  2JIH A;  4GR8 A;  4WF6 A;  2X3C A;  3RTS A;  1KUI A;  1XUC A;  2PJT A;  1UTT A;  4A7B A;  1I73 A;  3EHX A;  4DF9 A;  1R54 A;  2N8R A;  3F15 A;  1SAT A;  2K9C A;  2YIG A;  4JP4 A;  4PKW A;  1FM1 A;  3Q2G A;  1JJ9 A;  1YQY A;  1HTD A;  5BOT A;  2USN A;  1UEA A;  3OHO A;  1XUD A;  3DWB A;  1BQQ M;  3GBO A;  1OMJ A;  1BIW A;  1K7Q A;  2JT6 A;  4AIG A;  1KBC A;  3WV2 A;  3F19 A;  1R55 A;  2Y6D A;  1MMP A;  2OW2 A;  3L0T A;  2OW0 A;  4FU4 A;  1DTH A;  3ZVS A;  3EWJ A;  1K7G A;  3HBU P;  3USN A;  1QUA A;  3HBV P;  1IAC A;  3WV1 A;  1A86 A;  4GF1 A;  5I4O A;  4FVL A;  4WK7 A;  1AYK A;  3P1V A;  830C A;  1CIZ A;  2OVX A;  2W12 A;  4QKZ A;  1SRP A;  4ZR5 A;  2D1N A;  4PKU A;  3LMC A;  1BQO A;  3LQB A;  1HV5 A;  3K7N A;  2OXZ A;  4H30 A;  2JT5 A;  2DW1 A;  5L79 A;  1GXD A;  2E3X A;  1O0Q A;  1GE6 A;  3HDA P;  3TT4 A;  4L19 A;  1SLN A;  3I7I A;  1EAK A;  3AYK A;  2OW1 A;  1UTZ A;  1QIB A;  4IJO A;  3F17 A;  5BPA A;  1GKD A;  5D1T A;  1GE7 A;  3LJZ A;  1EB6 A;  1PWQ A;  3DPE A;  1AST A;  2DDF A;  3Q2H A;  1G49 A;  2ERP A;  1OM6 A;  1EUB A;  4Q1L A;  1KUF A;  2X3A A;  3HDB A;  3SHI A;  3K7L A;  1SU3 A;  1ZTQ A;  3LJG A;  2JSD A;  3VI1 A;  4FXQ A;  5D1S A;  4EFS A;  4GR3 A;  4AYK A;  5I2Z A;  5JMY A;  1C3I A;  3F1A A;  2FV9 A;  1XFU A;  3LEA A;  4I35 A;  3TVC A;  3LIR A;  2OZR A;  4HMA A;  1XFW A;  2MZE A;  1XFY A;  1OM8 A;  3MA2 A;  2TCL A;  3LJT A;  3HB2 P;  3BA0 A;  1BM6 A;  1FLS A;  3B8Z A;  1GKC A;  4H82 A;  1OS2 A;  3DPF A;  3LIK A;  4J4M A;  5H8X A;  2X7M A;  5B5P A;  2O3E A;  1USN A;  5CZM A;  4CTH A;  2WOA A;  2A8H A;  1OO9 A;  1YOU A;  3LGP A;  1PWV A;  3ZUK A;  3DTE A;  1IAE A;  3P24 A;  4DD8 A;  2RJQ A;  1D8F A;  1GO7 P;  1BKC A;  1BKC E;  2K2G A;  1G05 A;  4AUO A;  4GWN A;  1YCM A;  3U1R A;  4G0D A;  4PKQ A;  1UMT A;  3EDZ A;  1XUR A;  1JAN A;  1D5J A;  3LE9 A;  1GO8 P;  1BZS A;  2OVZ A;  2MZI A;  1JKY A;  2HU6 A;  5LAB A;  3LKA A;  1DMT A;  3N2V A;  1G12 A;  3EDH A;  1SMP A;  1MMQ A;  2RJP A;  4HX3 A;  1HFC A;  4IN9 A;  1Y0V A;  2E2D A;  2J83 A;  1JH1 A;  1CGL A;  1XFV A;  1AF0 A;  1KAP P;  3LIL A;  2X3B A;  2W13 A;  2MLS A;  1R1I A;  966C A;  2Y6C A;  1PWU A;  1IAD A;  1KUG A;  1QJI A;  1D7X A;  4H84 A;  4XM8 A;  1CK7 A;  4WZV A;  4JPA A;  3B92 A;  1JAP A;  2XS4 A;  5B5O A;  1CGF A;  2W15 A;  2CKI A;  2V4B A;  3I7G A;  3F16 A;  1BUV M;  3B2Z A;  1ZS0 A;  1RMZ A;  3KWV C;  456C A;  1MMB A;  1GE5 A;  4XM6 A;  3HY9 A;  1J7N A;  1IAB A;  2DW2 A;  5D3C A;  4ON1 A;  1FBL A;  1IAA A;  1RM8 A;  1CXV A;  1H71 P;  1QJJ A;  4XBH A;  1OM7 A;  1C8T A;  1ZVX A;  2XS3 A;  1C7K A;  2YB9 A;  3KEJ A;  5D2B A;  2L0R A;  4XCT A;  1R1J A;  4PKV A;  3DNG A;  1HY7 A;  1CGE A;  3N2U A;  1ZXC A;  3AIG A;  3ZXH A;  1IAG A;  5I3M A;  3DTI A;  3WV3 A;  3EDI A;  1B3D A;  1R1H A;  5D1U A;  1MMR A;  3F18 A;  1QIA A;  3KMC A;  4PKT A;  3TSK A;  3RTT A;  4L6T A;  1A85 A;  1ATL A;  2DW0 A;  2FV5 A;  3LK8 A;  4GWM A;  4H2E A;  1O0T A;  1AKL A;  2WO8 A;  3O64 A;  1CAQ A;  2MZH A;  1BKC I;  4H3X A;  4DV8 A;  2OXU A;  1Y8J A;  3E8R A;  4DPE A;  1ZXV A;  1JIZ A;  2WO9 A;  5D7W A;  1KUH A;  4H76 A;  3KEK A;  4L63 A;  2AIG P;  4JA1 A;  1B8Y A;  2JNP A;  2OI0 A;  2D1O A;  4A3W A;  3TS4 A;  2ERQ A;  1G9K A;  3ELM A;  3LQ0 A;  1QIC A;  1S4B P;  3DTK A;  5CUH A;  2DDY A;  2AYK A;  1JAO A;  1Z3J A;  2OY4 A;  1SLM A;  4PKS A;  1ROS A;  3DL1 A;  3DSL A;  3AYU A;  2POJ A;  3KME A;  2J0T A;  2QPJ A;  1I76 A;  3VTG A;  5I12 A;  5BOY A;  1K7I A;  4IUW A;  5CXA A;  3EDG A;  4GQL A;  2OY2 A;  1JAQ A;  3LUN A;  3O2X A;  3HY7 A;  1YP1 A;  2W14 A;  3KEC A;  1HOV A;  4GR0 A;  1PWW A;  2CLT A;  3NX7 A;  1Q3A A;  1XFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...