1FO8A

Crystal structure of n-acetylglucosaminyltransferase i
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
343
structure length
330
Chain Sequence
LAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-ACETYLGLUCOSAMINY
publication title X-ray crystal structure of rabbit N-acetylglucosaminyltransferase I: catalytic mechanism and a new protein superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 111
structure length 330
sequence length 343
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2000-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 1fo8A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1fo8A01
5EJ1A 2RJ6A 1ZI1A 1H4EA 2RJ9A 5HS2A 2AESA 1H5RA 1G9RA 4HO2A 1GA8A 5C1LA 2PGVA 3TQDA 4B4GA 2X65A 1O0RA 5FTSA 1FXJA 3R3IA 5CQPA 5C38A 3V0OA 3JTJA 2Z86A 4BQHA 1R7YA 1FR9A 1TW1A 1H5TB 3JUKA 2BO8A 4M4KA 3JUJA 4UEGA 2FYDB 4G3PA 3SPTA 3N9WA 2RJ1A 4AC3A 2XWLA 1VGWA 4G87A 1OMZA 3LW6A 2YQHA 3GUEA 4NANA 4C2SA 1ZJ1A 2FFUA 4J18A 4Y7VA 1FG5N 4KC2A 4KT7A 3CU0A 2YQJA 5C8RA 3CKVA 5CQNX 1R80A 2E3DA 2VS5A 1JYLA 4P02A 3IOHA 5IDTA 4B4MA 1E5KA 3ZGGA 1FO8A 3O3PA 3F1YA 2VSIA 2ZU8A 1VZXA 4K6RA 2I5EA 4B2WA 4D11A 3HL3A 4P00A 4Y7GA 3ZLLA 5C4EA 5C36A 1INIA 4BMAA 1G2VA 1S4PA 2V0HA 1ZI3A 2WVMA 4Y7UA 4EE4A 1NHEB 2W0WA 3I0FA 5FU8A 4ZDQA 5EIYA 1FGGA 1VGUA 1JV3A 1WVCA 4CJ8A 4FRPA 1SS9A 5J49A 1MP5A 5CQOA 2P72A 4Y7FA 2RJ4A 2Y4KA 1HJJA 4HO5A 5AJNA 2AM5A 2Y7AA 5AJOA 3RSBA 1H5TA 1ZJ0A 4CJCA 2BO4A 1HM9A 1G8OA 1HJLA 3U2WA 1V84A 2FYBA 4B5BA 3CKJA 2XMHA 3I0JA 2VXMA 2RJ8A 2W0VA 2VXLA 2JCKA 1NMMB 4KRVA 2ICXA 3CKOA 1TZFA 2Y4LA 1I52A 1W77A 1ZCTA 4KNXA 4FRLA 1GWVA 4XWIA 5DDTA 3BCVA 1FR8A 2YCMA 1LL2A 1LZJA 1MP3A 1INJA 1JVGA 3PNNA 2AM3A 2OI5A 2MZBA 4FRDA 4KQLA 2FY7A 3E26A 1G93A 1VGZA 2RJ7A 1YROB 3CKQA 3I0EA 3OH3A 3ST8A 3SX7A 4EE3A 1FRWA 1H7EA 4D0TA 5C47A 2APCA 2X5SA 2O1HA 5IDSA 2Z87A 2JCJA 1G3LA 1S4NA 4HO3A 4G3QA 3V8ZA 5C1GA 3I0KA 1W57A 3I0HA 3V0LA 2JCOA 5FUHA 3FWWA 1R7VA 3SXDA 5CMGX 4HO8A 3NGWA 4KC4A 3F1CA 3OH2A 2OEFA 4Y64A 2P6WA 2XWNA 1NQIB 1ZI5A 1H7QA 1ON6A 1YP4A 1PZTA 1YP3A 4HO0A 5C48A 1LL0A 2FYCB 2ZU9A 1H7TA 2PA4A 5CMFX 4ARWA 1H5SC 1OQMB 1O7OA 2YQSA 4Y6NA 1JV1A 1R7XA 3TZTA 1H3MA 2AGDA 4KC1A 3USRA 3K8EA 3KIAA 2O1GA 4FRAA 3SX5A 3IOJA 3QVBA 4HOCA 4Y63A 1ON8A 2O1FA 4Y62A 2YESA 3R2WA 2YC5A 1K4VA 2X60A 5C3AA 1S4OA 5CMHA 4FROA 1H5SB 2FYAA 3CKNA 4HO9A 3I0CA 1LZIA 2V0IA 3V90A 3T7OA 3U2XA 3SXCA 1W55A 2UX8A 1WT0A 3POLA 5C3BA 3T7NA 5JQQA 5IFYA 4CJBA 3PKPA 4EEGA 1ZI4A 4B2XA 4D48A 5AJPA 2V0KA 1LL3A 1HM8A 3E25A 2V0LA 2Q4JA 4CVHA 3I0LA 1NWGB 2VS3A 1FWYA 1GQCA 2QGIA 3OAMA 1QG8A 2GGOA 1FXOA 2XWMA 3OC9A 3D8VA 4M28A 4Y6UA 1HV9A 1QGSA 4EEAA 3OH1A 1R81A 5C4CA 1TVYA 1ZJOA 1ZJPA 4ASJA 1FO9A 3U0XA 4G3SA 2VS4A 2QH5A 1FGXA 4FRBA 3OGZA 5CMIA 3D5NA 3RMVA 4JD0A 5L6VA 1VZTA 2WE9A 3V8YA 1WT3A 1G1LA 1ZCVA 3BRKX 5DDVA 4EE5A 1H4DA 3T7MA 4B3UA 3U2TA 1VH3A 4D11C 1QWJA 1YP2A 2D7RA 1R7UA 5C3DA 1H5SA 1H4CA 4AAWA 2OI6A 2DPWA 2ICYA 2VSHA 1LZ7A 2RIYA 1VZUA 4ASYA 4HO6A 2AM4A 1H5SD 2Y6PA 1VM8A 4FRQA 2I5KA 2PGYA 4KPXA 3U0YA 2RJ5A 2ZU7A 4FRHA 3ZLKA 4L41C 2RIZA 2V0JA 4DE7A 1H7HA 2JCLA 3SX3A 4IRQA 4IRPA 3USQA 3K8DA 5CQMX 1ZDGA 1TW5A 5CMJA 2VD4A 3U2VA 4JISA 4ECMA 1GX4A 3SXGA 3V0PA 1GQ9A 2WEEA 3ZF8A 1IINA 4LW3A 2I7BA 2AE7A 1VICA 3FOQA 4DECA 4HG6A 4EEOA 4E1KA 1FZWA 4EEMA 2BO6A 1MC3A 5FU0A 3IOIA 1HM0A 5C4BA 1V83A 1VH1A 1EZIA 4M2AA 1G95A 4M2BA 1Z90A 3Q4SA 1G0RA 1VPAA 5FYEA 5C4DA 2A8WA 2RITA 4MYBA 3SXBA 1LZ0A 5BXCA 1VGTA 4KNRA 1R82A 5L6SA 1XZ6A 1GX0A 4AYJA 1H7LA 3DK5A 1OMXA 3Q7UA 2CU2A 3SXAA 1NF5B 2NXVA 3CGXA 4HCQA 2X5ZA 2D7IA 5C1HA 2PX7A 4NAIA 3SXEA 3DUVA 1NKHB 2RJ0A 1H7GA 2FFVA 5CQLX 3ZGFA 1WSZA 1WT1A 1O7QA 1R7TA 1ZCYA 1FOAA 1ZCUA 2WVLA 1MP4A 3EE5A 4LW6A 5FTVA 1JVDA 1PZYB 3V0NA 1ZIZA 5C49A 2WVKA 4R7PA 1JYKA 1H5RB 1XHBA 2WGZA 2Y4MA 2WAWA 2XMEA 2YC3A 4FREA 4FCEA 1G97A 2VFZA 3I0DA 3RMWA 3U2UA 2OI7A 2E8BA 2GGQA 1EYRA 4NALA 1KWSA 1O23B 1ZJ2A 1WT2A 4B42A 4FCUA 5EJZA 2Y4JA 2QKXA 4B4BA 1G23A 4Y9XA 3V0QA 2D0JA 4FQWA 3PKQA 4FRMA 2RIXA 4DDZA 3V0MA 4Y7TA 5FV9A 1LVWA 4MNDA 4GBPA 3OH4A 4HO4A 4AYLA 1ZDFA 4KPZA 1GWWA 3DJ4A 5I1FA 2AH9A 2AECA 2OEGA 4KXOA 3OH0A 4NAKA 3I0IX 2A8UA 3SX8A 4YS8A 1QGQA 2BO7A 1ZJ3A 1V82A 1H7FA 3I0GA 3Q80A 2P73A 4D0ZA 3V91A 5C4FA 3OKRA 2YQCA 1IIMA 4EVWA 1ZHJA 3D98A
chains in the Genus database with same CATH superfamily
4Z6QA 5EJ1A 2IG9A 1NIQB 2RJ6A 1ZI1A 1H4EA 2RJ9A 2PJSA 4LQBA 4GYMA 5HS2A 2AESA 3PKVA 1H5RA 4PV5A 1G9RA 4HO2A 1KLLA 1GA8A 5C1LA 2PGVA 3TQDA 4B4GA 2X65A 1O0RA 5FTSA 1FXJA 4N04A 4HC5A 3R3IA 5CQPA 5C38A 3V0OA 3JTJA 2Z86A 4BQHA 2ZA0A 1HV9A 1NPBA 1R7YA 2RJBA 1FR9A 1TW1A 3E5DA 1H5TB 3JUKA 2BO8A 4M4KA 3JUJA 4UEGA 2FYDB 3ZGJA 4G3PA 3SPTA 3N9WA 2RJ1A 5D7ZA 4AC3A 2XWLA 1VGWA 5CJ3A 1TSJA 4G87A 1OMZA 2P7LA 3LW6A 2YQHA 3GUEA 4NANA 4C2SA 1ZJ1A 2FFUA 1KWCB 4J18A 4Y7VA 1FG5N 4KC2A 1EIQA 4KT7A 3CU0A 3L20A 2YQJA 1R9CA 5C8RA 3CKVA 5CQNX 1R80A 2E3DA 2VS5A 1JYLA 4P02A 3IOHA 5IDTA 1K4NA 4B4MA 1E5KA 1NKIA 3ZGGA 1FO8A 3O3PA 5F6QA 4Z6LA 1Q0OA 2R6UA 4NB1A 3F1YA 2VSIA 2ZU8A 1VZXA 4MYMA 2RBBA 4K6RA 2I5EA 3LHOA 4B2WA 4D11A 3HL3A 4P00A 4Y7GA 3ZLLA 3ZI1A 5C4EA 1MPYA 5C36A 3GM5A 1INIA 2J0AA 4BMAA 1G2VA 1S4PA 2V0HA 1ZI3A 2WVMA 4Y7UA 4IR0A 4EE4A 1NHEB 1SP9A 3OJTA 2W0WA 3I0FA 1TWUA 5FU8A 4ZDQA 5EIYA 2A4WA 5D92A 1FGGA 1VGUA 1JV3A 1WVCA 4CJ8A 4FRPA 2P7PA 2I7RA 1SS9A 5J49A 1MP5A 5CQOA 2P72A 1KW9B 4Y7FA 2RJ4A 5D91A 5EC3A 1HJJA 2Y4KA 4HO5A 5AJNA 2AM5A 3HPYA 2Y7AA 5AJOA 3RSBA 1H5TA 1ZJ0A 2R5VA 4CJCA 2BO4A 1HM9A 1G8OA 4Q7CA 4NAYA 1HJLA 3U2WA 1KW6B 1V84A 2FYBA 3PKXA 4B5BA 3CKJA 2XMHA 1NNRA 4G6XA 3I0JA 2VXMA 2RJ8A 2W0VA 2VXLA 5DHWA 2JCKA 1NMMB 4KRVA 2ICXA 3CKOA 1TZFA 4NVSA 2Y4LA 5C4PA 1I52A 1W77A 3HPVA 1ZCTA 4FRLA 1GWVA 1FROA 4KNXA 4XWIA 5DDTA 3BCVA 1FR8A 2YCMA 2P7MA 1LL2A 1LZJA 1MP3A 1INJA 2J0BA 4FIYA 1JVGA 4IAGA 3PNNA 4Z6NA 2AM3A 2OI5A 2MZBA 4FRDA 4KQLA 2FY7A 2EI1A 3E26A 1G93A 2ZHPA 1VGZA 3IUZA 2Q48A 2RJ7A 1YROB 3L7TA 3CKQA 3I0EA 3OH3A 5HCWA 3ST8A 3SX7A 4EE3A 1FRWA 1H7EA 4D0TA 3PKWA 2APCA 5C47A 2X5SA 2O1HA 5IDSA 1LQPA 2Z87A 4JH4A 2JCJA 4OPNA 1G3LA 1S4NA 4MTTA 3BZAA 5CB9A 2RK0A 5DRHA 4Z6TA 4GHGA 1JC5A 4G3QA 4GHCA 4HO3A 3V8ZA 4MIXA 3RMUA 5C1GA 2ZI8A 3I0KA 1W57A 4JD1A 3VW9A 4NB0A 3I0HA 5C68A 2JCOA 3V0LA 5FUHA 3FWWA 1R7VA 3SXDA 5CMGX 4HO8A 5KEFA 3NGWA 2QNTA 4KC4A 3F1CA 3OH2A 1U69A 4JH2A 2OEFA 4JH3A 4Y64A 2P6WA 1BYLA 2XWNA 1NQIB 1ZI5A 1H7QA 1ON6A 3VB0A 1YP4A 2QH0A 3OPYB 4Z04A 1PZTA 1YP3A 4HO0A 5C48A 1LL0A 3ISQA 2FYCB 3EY7A 2ZU9A 1H7TA 2PA4A 5CMFX 4ARWA 1H5SC 1OQMB 4JH5A 1T47A 3RHEA 1O7OA 2YQSA 4Y6NA 1JV1A 1R7XA 3TZTA 1QIPA 1H3MA 3HNQA 2AGDA 4RT5A 4KC1A 3USRA 3K8EA 3KIAA 2O1GA 4GHDA 4FRAA 1EWJA 3SX5A 3IOJA 1KNFA 3QVBA 4HOCA 4Y63A 1ON8A 2O1FA 1FA5A 4Y62A 3OXHA 4Z6UA 1F9ZA 1KMYA 1K4VA 2YC5A 2YESA 3R2WA 2X60A 5C3AA 1S4OA 5CMHA 4FROA 2VK9A 3OULA 1H5SB 2FYAA 3CKNA 4HO9A 3FCDA 3I0CA 1LZIA 2V0IA 3V90A 4KYKA 3T7OA 3G12A 4JH6A 3SXCA 3U2XA 1SP8A 1W55A 4NB2A 2UX8A 4O6NA 2ZYQA 1WT0A 3POLA 5C3BA 3T7NA 1LQKA 5JQQA 5IFYA 4CJBA 4JH7A 3PKPA 4EEGA 1ZI4A 4B2XA 4D48A 1DHYA 5AJPA 1SS4A 3OAJA 2V0KA 1XRKA 1LL3A 1F1VA 1HM8A 3LM4A 3E25A 3OPYA 2V0LA 2Q4JA 4CVHA 3I0LA 1NWGB 4X2AA 2VS3A 1SQIA 4NAZA 1FWYA 1GQCA 2QGIA 3OAMA 1QG8A 2GGOA 1FXOA 2XWMA 1ZSWA 2EI3A 3D8VA 3OC9A 4M28A 1QGSA 4Z6SA 4Y6UA 3OH1A 4EEAA 1R81A 5C4CA 1TVYA 2P7QA 2ZW5A 1ZJOA 1ZJPA 4ASJA 1FO9A 3U0XA 4G3SA 2VS4A 2ZW4A 2QH5A 1FGXA 4FRBA 1XY7A 3OGZA 5CMIA 4GHHA 1TFZA 3D5NA 3RMVA 2ZW6A 4Z6PA 4JD0A 5L6VA 1VZTA 4QB5A 2WE9A 2EI2A 3V8YA 4JH8A 1WT3A 1G1LA 1ZCVA 4JH9A 3BRKX 5DDVA 4EE5A 1H4DA 3T7MA 4B3UA 3U2TA 3OJNA 1JIEA 1VH3A 4D11C 1QWJA 1YP2A 2D7RA 1R7UA 5C3DA 1H5SA 4JH1A 4Z6WA 1H4CA 4AAWA 2OI6A 2DPWA 2ICYA 2VSHA 5BWGA 1LZ7A 2C21A 2RIYA 1VZUA 1XQAA 4ASYA 4HO6A 2AM4A 3EY8A 1CJXA 3ECJA 1H5SD 2Y6PA 1VM8A 1FA8A 4FRQA 2I5KA 2PGYA 4KPXA 3U0YA 2RJ5A 2ZU7A 4FRHA 3ZLKA 4L41C 2RIZA 2V0JA 4DE7A 1LGTA 3E0RA 4O6MA 2A4XA 1H7HA 2JCLA 1MH6A 5DFGA 3SX3A 4IRQA 4IRPA 4KYHA 3USQA 3K8DA 5CQMX 2WL9A 1ZDGA 1TW5A 5CMJA 3ECKA 3HQ0A 2VD4A 3U2VA 4JISA 1KMZA 4ECMA 3ZW5A 1LQOA 3RRIA 1KWBB 1GX4A 1FA6A 5CTOA 1SQDA 4HUZA 3SXGA 3V0PA 1GQ9A 2WEEA 3ZF8A 1IINA 4LW3A 2I7BA 2AE7A 3KOLA 1VICA 3FOQA 4DECA 4HG6A 3HDPA 4EEOA 4E1KA 1FZWA 4GHEA 4EEMA 2BO6A 1F1XA 1MC3A 5FU0A 3IOIA 1HM0A 5C4BA 1JIFA 1BH5A 1EZIA 1V83A 1TG5A 1VH1A 4M2AA 2C0NA 1G95A 4M2BA 1Z90A 3Q4SA 3R4QA 1G0RA 1VPAA 2P7KA 5FYEA 5C4DA 2A8WA 1Q0CA 2RITA 4MYBA 3SXBA 1LZ0A 5BXCA 1VGTA 4KNRA 1R82A 5L6SA 1XZ6A 3W0UA 3GHJA 1GX0A 4AYJA 1H7LA 3DK5A 3OUMA 1OMXA 3Q7UA 2CU2A 1FA7A 3SXAA 1NF5B 2NXVA 3CGXA 4HCQA 2X5ZA 2D7IA 5BWHA 5C1HA 2PX7A 4NAIA 3SXEA 2QQZA 3W0TA 3DUVA 1NKHB 2RJ0A 1H7GA 2FFVA 1KW8B 5CQLX 1F1RA 3ZGFA 2P25A 1WSZA 1WT1A 1KW3B 1O7QA 2IGAA 1R7TA 1ZCYA 1JC4A 5C6XA 1FOAA 1ZCUA 2WVLA 1MP4A 3EE5A 4LW6A 5FTVA 1JVDA 1PZYB 1F1UA 3V0NA 1ZIZA 5C49A 1U6LA 2WVKA 4R7PA 1JYKA 5D4FA 3HUHA 1H5RB 4Z6RA 1XHBA 2WGZA 4MTSA 2ZW7A 2Y4MA 2WAWA 2XMEA 2YC3A 4FREA 4FCEA 1G97A 2VFZA 3I0DA 3RMWA 3U2UA 2OI7A 2E8BA 2GGQA 4Z6OA 1EYRA 4FIXA 1KWSA 4MTRA 1LKDA 1O23B 1ZJ2A 4NALA 1WT2A 1EILA 4B42A 1KNDA 4FCUA 5EJZA 2EI0A 2QKXA 2Y4JA 4B4BA 2WL3A 1G23A 4Y9XA 3B59A 1QINA 3V0QA 2D0JA 2P7OA 4FQWA 3PKQA 4FRMA 2RIXA 4DDZA 3V0MA 3CT8A 4Y7TA 5FV9A 3R6AA 4GHFA 3OA4A 1LVWA 3OJKA 4MNDA 4GBPA 3OH4A 4HO4A 4AYLA 1ZDFA 4KPZA 4MTQA 2RK9A 4Z6VA 1GWWA 3DJ4A 3SK2A 3P8AA 3OJJA 5I1FA 1EIRA 2AECA 2AH9A 2OEGA 4KXOA 4Z6ZA 3OH0A 4NAKA 3I0IX 2A8UA 3SX8A 4Z6MA 4YS8A 1QGQA 2BO7A 1ECSA 1ZJ3A 1HANA 1V82A 1H7FA 3I0GA 3Q80A 2P73A 2EHZA 4D0ZA 3V91A 5C4FA 3BQXA 3OKRA 4PAVA 1QTOA 2YQCA 1IIMA 4EVWA 1ZHJA 3D98A
chains in the Genus database with same CATH topology
5EJ1A 2RJ6A 1ZI1A 1H4EA 2RJ9A 5HS2A 2AESA 1H5RA 1G9RA 4HO2A 1GA8A 5C1LA 2PGVA 3TQDA 4B4GA 2X65A 1O0RA 5FTSA 1FXJA 3R3IA 5CQPA 5C38A 3V0OA 3JTJA 2Z86A 4BQHA 1R7YA 1FR9A 1TW1A 1H5TB 3JUKA 2BO8A 4M4KA 3JUJA 4UEGA 2FYDB 4G3PA 3SPTA 3N9WA 2RJ1A 4AC3A 2XWLA 1VGWA 4G87A 1OMZA 3LW6A 2YQHA 3GUEA 4NANA 4C2SA 1ZJ1A 2FFUA 4J18A 4Y7VA 1FG5N 4KC2A 4KT7A 3CU0A 2YQJA 5C8RA 3CKVA 5CQNX 1R80A 2E3DA 2VS5A 1JYLA 4P02A 3IOHA 5IDTA 4B4MA 1E5KA 3ZGGA 1FO8A 3O3PA 3F1YA 2VSIA 2ZU8A 1VZXA 4K6RA 2I5EA 4B2WA 4D11A 3HL3A 4P00A 4Y7GA 3ZLLA 5C4EA 5C36A 1INIA 2J0AA 4BMAA 1G2VA 1S4PA 2V0HA 1ZI3A 2WVMA 4Y7UA 4EE4A 1NHEB 2W0WA 3I0FA 5FU8A 4ZDQA 5EIYA 5D92A 1FGGA 1VGUA 1JV3A 1WVCA 4CJ8A 4FRPA 1SS9A 5J49A 1MP5A 5CQOA 2P72A 4Y7FA 2RJ4A 5D91A 2Y4KA 1HJJA 4HO5A 5AJNA 2AM5A 2Y7AA 5AJOA 3RSBA 1H5TA 1ZJ0A 4CJCA 2BO4A 1HM9A 1G8OA 4Q7CA 1HJLA 3U2WA 1V84A 2FYBA 4B5BA 3CKJA 2XMHA 3I0JA 2VXMA 2RJ8A 2W0VA 2VXLA 2JCKA 1NMMB 4KRVA 2ICXA 3CKOA 1TZFA 2Y4LA 1I52A 1W77A 1ZCTA 4KNXA 4FRLA 1GWVA 4XWIA 5DDTA 3BCVA 1FR8A 2YCMA 1LL2A 1LZJA 1MP3A 1INJA 2J0BA 4FIYA 1JVGA 3PNNA 2AM3A 2OI5A 2MZBA 4FRDA 4KQLA 2FY7A 3E26A 1G93A 1VGZA 2RJ7A 1YROB 3CKQA 3I0EA 3OH3A 3ST8A 3SX7A 4EE3A 1FRWA 1H7EA 4D0TA 5C47A 2APCA 2X5SA 2O1HA 5IDSA 2Z87A 2JCJA 1G3LA 1S4NA 4HO3A 4G3QA 3V8ZA 4MIXA 5C1GA 3I0KA 1W57A 3I0HA 3V0LA 2JCOA 5FUHA 3FWWA 1R7VA 3SXDA 5CMGX 4HO8A 3NGWA 4KC4A 3F1CA 3OH2A 2OEFA 4Y64A 2P6WA 2XWNA 1NQIB 1ZI5A 1H7QA 1ON6A 1YP4A 1PZTA 1YP3A 4HO0A 5C48A 1LL0A 2FYCB 2ZU9A 1H7TA 2PA4A 5CMFX 4ARWA 1H5SC 1OQMB 1O7OA 2YQSA 4Y6NA 1JV1A 1R7XA 3TZTA 1H3MA 2AGDA 4KC1A 3USRA 3K8EA 3KIAA 2O1GA 4FRAA 3SX5A 3IOJA 3QVBA 4HOCA 4Y63A 1ON8A 2O1FA 4Y62A 2YESA 3R2WA 2YC5A 1K4VA 2X60A 5C3AA 1S4OA 5CMHA 4FROA 2VK9A 1H5SB 2FYAA 3CKNA 4HO9A 3I0CA 1LZIA 2V0IA 3V90A 3T7OA 3U2XA 3SXCA 1W55A 2UX8A 4O6NA 1WT0A 3POLA 5C3BA 3T7NA 5JQQA 5IFYA 4CJBA 3PKPA 4EEGA 1ZI4A 4B2XA 4D48A 5AJPA 2V0KA 1LL3A 1HM8A 3E25A 2V0LA 2Q4JA 4CVHA 3I0LA 1NWGB 2VS3A 1FWYA 1GQCA 2QGIA 3OAMA 1QG8A 2GGOA 1FXOA 2XWMA 3OC9A 3D8VA 4M28A 4Y6UA 1HV9A 1QGSA 4EEAA 3OH1A 1R81A 5C4CA 1TVYA 1ZJOA 1ZJPA 4ASJA 1FO9A 3U0XA 4G3SA 2VS4A 2QH5A 1FGXA 4FRBA 3OGZA 5CMIA 3D5NA 3RMVA 4JD0A 5L6VA 1VZTA 2WE9A 3V8YA 1WT3A 1G1LA 1ZCVA 3BRKX 5DDVA 4EE5A 1H4DA 3T7MA 4B3UA 3U2TA 1VH3A 4D11C 1QWJA 1YP2A 2D7RA 1R7UA 5C3DA 1H5SA 1H4CA 4AAWA 2OI6A 2DPWA 2ICYA 2VSHA 1LZ7A 2RIYA 1VZUA 4ASYA 4HO6A 2AM4A 1H5SD 2Y6PA 1VM8A 4FRQA 2I5KA 2PGYA 4KPXA 3U0YA 2RJ5A 2ZU7A 4FRHA 3ZLKA 4L41C 2RIZA 2V0JA 4DE7A 4O6MA 1H7HA 2JCLA 3SX3A 4IRQA 4IRPA 3USQA 3K8DA 5CQMX 1ZDGA 1TW5A 5CMJA 2VD4A 3U2VA 4JISA 4ECMA 1GX4A 3SXGA 3V0PA 1GQ9A 2WEEA 3ZF8A 1IINA 4LW3A 2I7BA 2AE7A 1VICA 3FOQA 4DECA 4HG6A 4EEOA 4E1KA 1FZWA 4EEMA 2BO6A 1MC3A 5FU0A 3IOIA 1HM0A 5C4BA 1V83A 1VH1A 1EZIA 4M2AA 2C0NA 1G95A 4M2BA 1Z90A 3Q4SA 1G0RA 1VPAA 5FYEA 5C4DA 2A8WA 2RITA 4MYBA 3SXBA 1LZ0A 5BXCA 1VGTA 4KNRA 1R82A 5L6SA 1XZ6A 1GX0A 4AYJA 1H7LA 3DK5A 1OMXA 3Q7UA 2CU2A 3SXAA 1NF5B 2NXVA 3CGXA 4HCQA 2X5ZA 2D7IA 5C1HA 2PX7A 4NAIA 3SXEA 3DUVA 1NKHB 2RJ0A 1H7GA 2FFVA 5CQLX 3ZGFA 1WSZA 1WT1A 1O7QA 1R7TA 1ZCYA 1FOAA 1ZCUA 2WVLA 1MP4A 3EE5A 4LW6A 5FTVA 1JVDA 1PZYB 3V0NA 1ZIZA 5C49A 2WVKA 4R7PA 1JYKA 1H5RB 1XHBA 2WGZA 2Y4MA 2WAWA 2XMEA 2YC3A 4FREA 4FCEA 1G97A 2VFZA 3I0DA 3RMWA 3U2UA 2OI7A 2E8BA 2GGQA 1EYRA 4FIXA 4NALA 1KWSA 1O23B 1ZJ2A 1WT2A 4B42A 4FCUA 5EJZA 2Y4JA 2QKXA 4B4BA 1G23A 4Y9XA 3V0QA 2D0JA 4FQWA 3PKQA 4FRMA 2RIXA 4DDZA 3V0MA 4Y7TA 5FV9A 1LVWA 4MNDA 4GBPA 3OH4A 4HO4A 4AYLA 1ZDFA 4KPZA 1GWWA 3DJ4A 5I1FA 2AH9A 2AECA 2OEGA 4KXOA 3OH0A 4NAKA 3I0IX 2A8UA 3SX8A 4YS8A 1QGQA 2BO7A 1ZJ3A 1V82A 1H7FA 3I0GA 3Q80A 2P73A 4D0ZA 3V91A 5C4FA 3OKRA 2YQCA 1IIMA 4EVWA 1ZHJA 3D98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJ1 A;  2RJ6 A;  1ZI1 A;  1H4E A;  2RJ9 A;  5HS2 A;  2AES A;  1H5R A;  1G9R A;  4HO2 A;  1GA8 A;  5C1L A;  2PGV A;  3TQD A;  4B4G A;  2X65 A;  1O0R A;  5FTS A;  1FXJ A;  3R3I A;  5CQP A;  5C38 A;  3V0O A;  3JTJ A;  2Z86 A;  4BQH A;  1R7Y A;  1FR9 A;  1TW1 A;  1H5T B;  3JUK A;  2BO8 A;  4M4K A;  3JUJ A;  4UEG A;  2FYD B;  4G3P A;  3SPT A;  3N9W A;  2RJ1 A;  4AC3 A;  2XWL A;  1VGW A;  4G87 A;  1OMZ A;  3LW6 A;  2YQH A;  3GUE A;  4NAN A;  4C2S A;  1ZJ1 A;  2FFU A;  4J18 A;  4Y7V A;  1FG5 N;  4KC2 A;  4KT7 A;  3CU0 A;  2YQJ A;  5C8R A;  3CKV A;  5CQN X;  1R80 A;  2E3D A;  2VS5 A;  1JYL A;  4P02 A;  3IOH A;  5IDT A;  4B4M A;  1E5K A;  3ZGG A;  1FO8 A;  3O3P A;  3F1Y A;  2VSI A;  2ZU8 A;  1VZX A;  4K6R A;  2I5E A;  4B2W A;  4D11 A;  3HL3 A;  4P00 A;  4Y7G A;  3ZLL A;  5C4E A;  5C36 A;  1INI A;  4BMA A;  1G2V A;  1S4P A;  2V0H A;  1ZI3 A;  2WVM A;  4Y7U A;  4EE4 A;  1NHE B;  2W0W A;  3I0F A;  5FU8 A;  4ZDQ A;  5EIY A;  1FGG A;  1VGU A;  1JV3 A;  1WVC A;  4CJ8 A;  4FRP A;  1SS9 A;  5J49 A;  1MP5 A;  5CQO A;  2P72 A;  4Y7F A;  2RJ4 A;  2Y4K A;  1HJJ A;  4HO5 A;  5AJN A;  2AM5 A;  2Y7A A;  5AJO A;  3RSB A;  1H5T A;  1ZJ0 A;  4CJC A;  2BO4 A;  1HM9 A;  1G8O A;  1HJL A;  3U2W A;  1V84 A;  2FYB A;  4B5B A;  3CKJ A;  2XMH A;  3I0J A;  2VXM A;  2RJ8 A;  2W0V A;  2VXL A;  2JCK A;  1NMM B;  4KRV A;  2ICX A;  3CKO A;  1TZF A;  2Y4L A;  1I52 A;  1W77 A;  1ZCT A;  4KNX A;  4FRL A;  1GWV A;  4XWI A;  5DDT A;  3BCV A;  1FR8 A;  2YCM A;  1LL2 A;  1LZJ A;  1MP3 A;  1INJ A;  1JVG A;  3PNN A;  2AM3 A;  2OI5 A;  2MZB A;  4FRD A;  4KQL A;  2FY7 A;  3E26 A;  1G93 A;  1VGZ A;  2RJ7 A;  1YRO B;  3CKQ A;  3I0E A;  3OH3 A;  3ST8 A;  3SX7 A;  4EE3 A;  1FRW A;  1H7E A;  4D0T A;  5C47 A;  2APC A;  2X5S A;  2O1H A;  5IDS A;  2Z87 A;  2JCJ A;  1G3L A;  1S4N A;  4HO3 A;  4G3Q A;  3V8Z A;  5C1G A;  3I0K A;  1W57 A;  3I0H A;  3V0L A;  2JCO A;  5FUH A;  3FWW A;  1R7V A;  3SXD A;  5CMG X;  4HO8 A;  3NGW A;  4KC4 A;  3F1C A;  3OH2 A;  2OEF A;  4Y64 A;  2P6W A;  2XWN A;  1NQI B;  1ZI5 A;  1H7Q A;  1ON6 A;  1YP4 A;  1PZT A;  1YP3 A;  4HO0 A;  5C48 A;  1LL0 A;  2FYC B;  2ZU9 A;  1H7T A;  2PA4 A;  5CMF X;  4ARW A;  1H5S C;  1OQM B;  1O7O A;  2YQS A;  4Y6N A;  1JV1 A;  1R7X A;  3TZT A;  1H3M A;  2AGD A;  4KC1 A;  3USR A;  3K8E A;  3KIA A;  2O1G A;  4FRA A;  3SX5 A;  3IOJ A;  3QVB A;  4HOC A;  4Y63 A;  1ON8 A;  2O1F A;  4Y62 A;  2YES A;  3R2W A;  2YC5 A;  1K4V A;  2X60 A;  5C3A A;  1S4O A;  5CMH A;  4FRO A;  1H5S B;  2FYA A;  3CKN A;  4HO9 A;  3I0C A;  1LZI A;  2V0I A;  3V90 A;  3T7O A;  3U2X A;  3SXC A;  1W55 A;  2UX8 A;  1WT0 A;  3POL A;  5C3B A;  3T7N A;  5JQQ A;  5IFY A;  4CJB A;  3PKP A;  4EEG A;  1ZI4 A;  4B2X A;  4D48 A;  5AJP A;  2V0K A;  1LL3 A;  1HM8 A;  3E25 A;  2V0L A;  2Q4J A;  4CVH A;  3I0L A;  1NWG B;  2VS3 A;  1FWY A;  1GQC A;  2QGI A;  3OAM A;  1QG8 A;  2GGO A;  1FXO A;  2XWM A;  3OC9 A;  3D8V A;  4M28 A;  4Y6U A;  1HV9 A;  1QGS A;  4EEA A;  3OH1 A;  1R81 A;  5C4C A;  1TVY A;  1ZJO A;  1ZJP A;  4ASJ A;  1FO9 A;  3U0X A;  4G3S A;  2VS4 A;  2QH5 A;  1FGX A;  4FRB A;  3OGZ A;  5CMI A;  3D5N A;  3RMV A;  4JD0 A;  5L6V A;  1VZT A;  2WE9 A;  3V8Y A;  1WT3 A;  1G1L A;  1ZCV A;  3BRK X;  5DDV A;  4EE5 A;  1H4D A;  3T7M A;  4B3U A;  3U2T A;  1VH3 A;  4D11 C;  1QWJ A;  1YP2 A;  2D7R A;  1R7U A;  5C3D A;  1H5S A;  1H4C A;  4AAW A;  2OI6 A;  2DPW A;  2ICY A;  2VSH A;  1LZ7 A;  2RIY A;  1VZU A;  4ASY A;  4HO6 A;  2AM4 A;  1H5S D;  2Y6P A;  1VM8 A;  4FRQ A;  2I5K A;  2PGY A;  4KPX A;  3U0Y A;  2RJ5 A;  2ZU7 A;  4FRH A;  3ZLK A;  4L41 C;  2RIZ A;  2V0J A;  4DE7 A;  1H7H A;  2JCL A;  3SX3 A;  4IRQ A;  4IRP A;  3USQ A;  3K8D A;  5CQM X;  1ZDG A;  1TW5 A;  5CMJ A;  2VD4 A;  3U2V A;  4JIS A;  4ECM A;  1GX4 A;  3SXG A;  3V0P A;  1GQ9 A;  2WEE A;  3ZF8 A;  1IIN A;  4LW3 A;  2I7B A;  2AE7 A;  1VIC A;  3FOQ A;  4DEC A;  4HG6 A;  4EEO A;  4E1K A;  1FZW A;  4EEM A;  2BO6 A;  1MC3 A;  5FU0 A;  3IOI A;  1HM0 A;  5C4B A;  1V83 A;  1VH1 A;  1EZI A;  4M2A A;  1G95 A;  4M2B A;  1Z90 A;  3Q4S A;  1G0R A;  1VPA A;  5FYE A;  5C4D A;  2A8W A;  2RIT A;  4MYB A;  3SXB A;  1LZ0 A;  5BXC A;  1VGT A;  4KNR A;  1R82 A;  5L6S A;  1XZ6 A;  1GX0 A;  4AYJ A;  1H7L A;  3DK5 A;  1OMX A;  3Q7U A;  2CU2 A;  3SXA A;  1NF5 B;  2NXV A;  3CGX A;  4HCQ A;  2X5Z A;  2D7I A;  5C1H A;  2PX7 A;  4NAI A;  3SXE A;  3DUV A;  1NKH B;  2RJ0 A;  1H7G A;  2FFV A;  5CQL X;  3ZGF A;  1WSZ A;  1WT1 A;  1O7Q A;  1R7T A;  1ZCY A;  1FOA A;  1ZCU A;  2WVL A;  1MP4 A;  3EE5 A;  4LW6 A;  5FTV A;  1JVD A;  1PZY B;  3V0N A;  1ZIZ A;  5C49 A;  2WVK A;  4R7P A;  1JYK A;  1H5R B;  1XHB A;  2WGZ A;  2Y4M A;  2WAW A;  2XME A;  2YC3 A;  4FRE A;  4FCE A;  1G97 A;  2VFZ A;  3I0D A;  3RMW A;  3U2U A;  2OI7 A;  2E8B A;  2GGQ A;  1EYR A;  4NAL A;  1KWS A;  1O23 B;  1ZJ2 A;  1WT2 A;  4B42 A;  4FCU A;  5EJZ A;  2Y4J A;  2QKX A;  4B4B A;  1G23 A;  4Y9X A;  3V0Q A;  2D0J A;  4FQW A;  3PKQ A;  4FRM A;  2RIX A;  4DDZ A;  3V0M A;  4Y7T A;  5FV9 A;  1LVW A;  4MND A;  4GBP A;  3OH4 A;  4HO4 A;  4AYL A;  1ZDF A;  4KPZ A;  1GWW A;  3DJ4 A;  5I1F A;  2AH9 A;  2AEC A;  2OEG A;  4KXO A;  3OH0 A;  4NAK A;  3I0I X;  2A8U A;  3SX8 A;  4YS8 A;  1QGQ A;  2BO7 A;  1ZJ3 A;  1V82 A;  1H7F A;  3I0G A;  3Q80 A;  2P73 A;  4D0Z A;  3V91 A;  5C4F A;  3OKR A;  2YQC A;  1IIM A;  4EVW A;  1ZHJ A;  3D98 A; 
#chains in the Genus database with same CATH topology
 4Z6Q A;  5EJ1 A;  2IG9 A;  1NIQ B;  2RJ6 A;  1ZI1 A;  1H4E A;  2RJ9 A;  2PJS A;  4LQB A;  4GYM A;  5HS2 A;  2AES A;  3PKV A;  1H5R A;  4PV5 A;  1G9R A;  4HO2 A;  1KLL A;  1GA8 A;  5C1L A;  2PGV A;  3TQD A;  4B4G A;  2X65 A;  1O0R A;  5FTS A;  1FXJ A;  4N04 A;  4HC5 A;  3R3I A;  5CQP A;  5C38 A;  3V0O A;  3JTJ A;  2Z86 A;  4BQH A;  2ZA0 A;  1HV9 A;  1NPB A;  1R7Y A;  2RJB A;  1FR9 A;  1TW1 A;  3E5D A;  1H5T B;  3JUK A;  2BO8 A;  4M4K A;  3JUJ A;  4UEG A;  2FYD B;  3ZGJ A;  4G3P A;  3SPT A;  3N9W A;  2RJ1 A;  5D7Z A;  4AC3 A;  2XWL A;  1VGW A;  5CJ3 A;  1TSJ A;  4G87 A;  1OMZ A;  2P7L A;  3LW6 A;  2YQH A;  3GUE A;  4NAN A;  4C2S A;  1ZJ1 A;  2FFU A;  1KWC B;  4J18 A;  4Y7V A;  1FG5 N;  4KC2 A;  1EIQ A;  4KT7 A;  3CU0 A;  3L20 A;  2YQJ A;  1R9C A;  5C8R A;  3CKV A;  5CQN X;  1R80 A;  2E3D A;  2VS5 A;  1JYL A;  4P02 A;  3IOH A;  5IDT A;  1K4N A;  4B4M A;  1E5K A;  1NKI A;  3ZGG A;  1FO8 A;  3O3P A;  5F6Q A;  4Z6L A;  1Q0O A;  2R6U A;  4NB1 A;  3F1Y A;  2VSI A;  2ZU8 A;  1VZX A;  4MYM A;  2RBB A;  4K6R A;  2I5E A;  3LHO A;  4B2W A;  4D11 A;  3HL3 A;  4P00 A;  4Y7G A;  3ZLL A;  3ZI1 A;  5C4E A;  1MPY A;  5C36 A;  3GM5 A;  1INI A;  2J0A A;  4BMA A;  1G2V A;  1S4P A;  2V0H A;  1ZI3 A;  2WVM A;  4Y7U A;  4IR0 A;  4EE4 A;  1NHE B;  1SP9 A;  3OJT A;  2W0W A;  3I0F A;  1TWU A;  5FU8 A;  4ZDQ A;  5EIY A;  2A4W A;  5D92 A;  1FGG A;  1VGU A;  1JV3 A;  1WVC A;  4CJ8 A;  4FRP A;  2P7P A;  2I7R A;  1SS9 A;  5J49 A;  1MP5 A;  5CQO A;  2P72 A;  1KW9 B;  4Y7F A;  2RJ4 A;  5D91 A;  5EC3 A;  1HJJ A;  2Y4K A;  4HO5 A;  5AJN A;  2AM5 A;  3HPY A;  2Y7A A;  5AJO A;  3RSB A;  1H5T A;  1ZJ0 A;  2R5V A;  4CJC A;  2BO4 A;  1HM9 A;  1G8O A;  4Q7C A;  4NAY A;  1HJL A;  3U2W A;  1KW6 B;  1V84 A;  2FYB A;  3PKX A;  4B5B A;  3CKJ A;  2XMH A;  1NNR A;  4G6X A;  3I0J A;  2VXM A;  2RJ8 A;  2W0V A;  2VXL A;  5DHW A;  2JCK A;  1NMM B;  4KRV A;  2ICX A;  3CKO A;  1TZF A;  4NVS A;  2Y4L A;  5C4P A;  1I52 A;  1W77 A;  3HPV A;  1ZCT A;  4FRL A;  1GWV A;  1FRO A;  4KNX A;  4XWI A;  5DDT A;  3BCV A;  1FR8 A;  2YCM A;  2P7M A;  1LL2 A;  1LZJ A;  1MP3 A;  1INJ A;  2J0B A;  4FIY A;  1JVG A;  4IAG A;  3PNN A;  4Z6N A;  2AM3 A;  2OI5 A;  2MZB A;  4FRD A;  4KQL A;  2FY7 A;  2EI1 A;  3E26 A;  1G93 A;  2ZHP A;  1VGZ A;  3IUZ A;  2Q48 A;  2RJ7 A;  1YRO B;  3L7T A;  3CKQ A;  3I0E A;  3OH3 A;  5HCW A;  3ST8 A;  3SX7 A;  4EE3 A;  1FRW A;  1H7E A;  4D0T A;  3PKW A;  2APC A;  5C47 A;  2X5S A;  2O1H A;  5IDS A;  1LQP A;  2Z87 A;  4JH4 A;  2JCJ A;  4OPN A;  1G3L A;  1S4N A;  4MTT A;  3BZA A;  5CB9 A;  2RK0 A;  5DRH A;  4Z6T A;  4GHG A;  1JC5 A;  4G3Q A;  4GHC A;  4HO3 A;  3V8Z A;  4MIX A;  3RMU A;  5C1G A;  2ZI8 A;  3I0K A;  1W57 A;  4JD1 A;  3VW9 A;  4NB0 A;  3I0H A;  5C68 A;  2JCO A;  3V0L A;  5FUH A;  3FWW A;  1R7V A;  3SXD A;  5CMG X;  4HO8 A;  5KEF A;  3NGW A;  2QNT A;  4KC4 A;  3F1C A;  3OH2 A;  1U69 A;  4JH2 A;  2OEF A;  4JH3 A;  4Y64 A;  2P6W A;  1BYL A;  2XWN A;  1NQI B;  1ZI5 A;  1H7Q A;  1ON6 A;  3VB0 A;  1YP4 A;  2QH0 A;  3OPY B;  4Z04 A;  1PZT A;  1YP3 A;  4HO0 A;  5C48 A;  1LL0 A;  3ISQ A;  2FYC B;  3EY7 A;  2ZU9 A;  1H7T A;  2PA4 A;  5CMF X;  4ARW A;  1H5S C;  1OQM B;  4JH5 A;  1T47 A;  3RHE A;  1O7O A;  2YQS A;  4Y6N A;  1JV1 A;  1R7X A;  3TZT A;  1QIP A;  1H3M A;  3HNQ A;  2AGD A;  4RT5 A;  4KC1 A;  3USR A;  3K8E A;  3KIA A;  2O1G A;  4GHD A;  4FRA A;  1EWJ A;  3SX5 A;  3IOJ A;  1KNF A;  3QVB A;  4HOC A;  4Y63 A;  1ON8 A;  2O1F A;  1FA5 A;  4Y62 A;  3OXH A;  4Z6U A;  1F9Z A;  1KMY A;  1K4V A;  2YC5 A;  2YES A;  3R2W A;  2X60 A;  5C3A A;  1S4O A;  5CMH A;  4FRO A;  2VK9 A;  3OUL A;  1H5S B;  2FYA A;  3CKN A;  4HO9 A;  3FCD A;  3I0C A;  1LZI A;  2V0I A;  3V90 A;  4KYK A;  3T7O A;  3G12 A;  4JH6 A;  3SXC A;  3U2X A;  1SP8 A;  1W55 A;  4NB2 A;  2UX8 A;  4O6N A;  2ZYQ A;  1WT0 A;  3POL A;  5C3B A;  3T7N A;  1LQK A;  5JQQ A;  5IFY A;  4CJB A;  4JH7 A;  3PKP A;  4EEG A;  1ZI4 A;  4B2X A;  4D48 A;  1DHY A;  5AJP A;  1SS4 A;  3OAJ A;  2V0K A;  1XRK A;  1LL3 A;  1F1V A;  1HM8 A;  3LM4 A;  3E25 A;  3OPY A;  2V0L A;  2Q4J A;  4CVH A;  3I0L A;  1NWG B;  4X2A A;  2VS3 A;  1SQI A;  4NAZ A;  1FWY A;  1GQC A;  2QGI A;  3OAM A;  1QG8 A;  2GGO A;  1FXO A;  2XWM A;  1ZSW A;  2EI3 A;  3D8V A;  3OC9 A;  4M28 A;  1QGS A;  4Z6S A;  4Y6U A;  3OH1 A;  4EEA A;  1R81 A;  5C4C A;  1TVY A;  2P7Q A;  2ZW5 A;  1ZJO A;  1ZJP A;  4ASJ A;  1FO9 A;  3U0X A;  4G3S A;  2VS4 A;  2ZW4 A;  2QH5 A;  1FGX A;  4FRB A;  1XY7 A;  3OGZ A;  5CMI A;  4GHH A;  1TFZ A;  3D5N A;  3RMV A;  2ZW6 A;  4Z6P A;  4JD0 A;  5L6V A;  1VZT A;  4QB5 A;  2WE9 A;  2EI2 A;  3V8Y A;  4JH8 A;  1WT3 A;  1G1L A;  1ZCV A;  4JH9 A;  3BRK X;  5DDV A;  4EE5 A;  1H4D A;  3T7M A;  4B3U A;  3U2T A;  3OJN A;  1JIE A;  1VH3 A;  4D11 C;  1QWJ A;  1YP2 A;  2D7R A;  1R7U A;  5C3D A;  1H5S A;  4JH1 A;  4Z6W A;  1H4C A;  4AAW A;  2OI6 A;  2DPW A;  2ICY A;  2VSH A;  5BWG A;  1LZ7 A;  2C21 A;  2RIY A;  1VZU A;  1XQA A;  4ASY A;  4HO6 A;  2AM4 A;  3EY8 A;  1CJX A;  3ECJ A;  1H5S D;  2Y6P A;  1VM8 A;  1FA8 A;  4FRQ A;  2I5K A;  2PGY A;  4KPX A;  3U0Y A;  2RJ5 A;  2ZU7 A;  4FRH A;  3ZLK A;  4L41 C;  2RIZ A;  2V0J A;  4DE7 A;  1LGT A;  3E0R A;  4O6M A;  2A4X A;  1H7H A;  2JCL A;  1MH6 A;  5DFG A;  3SX3 A;  4IRQ A;  4IRP A;  4KYH A;  3USQ A;  3K8D A;  5CQM X;  2WL9 A;  1ZDG A;  1TW5 A;  5CMJ A;  3ECK A;  3HQ0 A;  2VD4 A;  3U2V A;  4JIS A;  1KMZ A;  4ECM A;  3ZW5 A;  1LQO A;  3RRI A;  1KWB B;  1GX4 A;  1FA6 A;  5CTO A;  1SQD A;  4HUZ A;  3SXG A;  3V0P A;  1GQ9 A;  2WEE A;  3ZF8 A;  1IIN A;  4LW3 A;  2I7B A;  2AE7 A;  3KOL A;  1VIC A;  3FOQ A;  4DEC A;  4HG6 A;  3HDP A;  4EEO A;  4E1K A;  1FZW A;  4GHE A;  4EEM A;  2BO6 A;  1F1X A;  1MC3 A;  5FU0 A;  3IOI A;  1HM0 A;  5C4B A;  1JIF A;  1BH5 A;  1EZI A;  1V83 A;  1TG5 A;  1VH1 A;  4M2A A;  2C0N A;  1G95 A;  4M2B A;  1Z90 A;  3Q4S A;  3R4Q A;  1G0R A;  1VPA A;  2P7K A;  5FYE A;  5C4D A;  2A8W A;  1Q0C A;  2RIT A;  4MYB A;  3SXB A;  1LZ0 A;  5BXC A;  1VGT A;  4KNR A;  1R82 A;  5L6S A;  1XZ6 A;  3W0U A;  3GHJ A;  1GX0 A;  4AYJ A;  1H7L A;  3DK5 A;  3OUM A;  1OMX A;  3Q7U A;  2CU2 A;  1FA7 A;  3SXA A;  1NF5 B;  2NXV A;  3CGX A;  4HCQ A;  2X5Z A;  2D7I A;  5BWH A;  5C1H A;  2PX7 A;  4NAI A;  3SXE A;  2QQZ A;  3W0T A;  3DUV A;  1NKH B;  2RJ0 A;  1H7G A;  2FFV A;  1KW8 B;  5CQL X;  1F1R A;  3ZGF A;  2P25 A;  1WSZ A;  1WT1 A;  1KW3 B;  1O7Q A;  2IGA A;  1R7T A;  1ZCY A;  1JC4 A;  5C6X A;  1FOA A;  1ZCU A;  2WVL A;  1MP4 A;  3EE5 A;  4LW6 A;  5FTV A;  1JVD A;  1PZY B;  1F1U A;  3V0N A;  1ZIZ A;  5C49 A;  1U6L A;  2WVK A;  4R7P A;  1JYK A;  5D4F A;  3HUH A;  1H5R B;  4Z6R A;  1XHB A;  2WGZ A;  4MTS A;  2ZW7 A;  2Y4M A;  2WAW A;  2XME A;  2YC3 A;  4FRE A;  4FCE A;  1G97 A;  2VFZ A;  3I0D A;  3RMW A;  3U2U A;  2OI7 A;  2E8B A;  2GGQ A;  4Z6O A;  1EYR A;  4FIX A;  1KWS A;  4MTR A;  1LKD A;  1O23 B;  1ZJ2 A;  4NAL A;  1WT2 A;  1EIL A;  4B42 A;  1KND A;  4FCU A;  5EJZ A;  2EI0 A;  2QKX A;  2Y4J A;  4B4B A;  2WL3 A;  1G23 A;  4Y9X A;  3B59 A;  1QIN A;  3V0Q A;  2D0J A;  2P7O A;  4FQW A;  3PKQ A;  4FRM A;  2RIX A;  4DDZ A;  3V0M A;  3CT8 A;  4Y7T A;  5FV9 A;  3R6A A;  4GHF A;  3OA4 A;  1LVW A;  3OJK A;  4MND A;  4GBP A;  3OH4 A;  4HO4 A;  4AYL A;  1ZDF A;  4KPZ A;  4MTQ A;  2RK9 A;  4Z6V A;  1GWW A;  3DJ4 A;  3SK2 A;  3P8A A;  3OJJ A;  5I1F A;  1EIR A;  2AEC A;  2AH9 A;  2OEG A;  4KXO A;  4Z6Z A;  3OH0 A;  4NAK A;  3I0I X;  2A8U A;  3SX8 A;  4Z6M A;  4YS8 A;  1QGQ A;  2BO7 A;  1ECS A;  1ZJ3 A;  1HAN A;  1V82 A;  1H7F A;  3I0G A;  3Q80 A;  2P73 A;  2EHZ A;  4D0Z A;  3V91 A;  5C4F A;  3BQX A;  3OKR A;  4PAV A;  1QTO A;  2YQC A;  1IIM A;  4EVW A;  1ZHJ A;  3D98 A; 
#chains in the Genus database with same CATH homology
 5EJ1 A;  2RJ6 A;  1ZI1 A;  1H4E A;  2RJ9 A;  5HS2 A;  2AES A;  1H5R A;  1G9R A;  4HO2 A;  1GA8 A;  5C1L A;  2PGV A;  3TQD A;  4B4G A;  2X65 A;  1O0R A;  5FTS A;  1FXJ A;  3R3I A;  5CQP A;  5C38 A;  3V0O A;  3JTJ A;  2Z86 A;  4BQH A;  1R7Y A;  1FR9 A;  1TW1 A;  1H5T B;  3JUK A;  2BO8 A;  4M4K A;  3JUJ A;  4UEG A;  2FYD B;  4G3P A;  3SPT A;  3N9W A;  2RJ1 A;  4AC3 A;  2XWL A;  1VGW A;  4G87 A;  1OMZ A;  3LW6 A;  2YQH A;  3GUE A;  4NAN A;  4C2S A;  1ZJ1 A;  2FFU A;  4J18 A;  4Y7V A;  1FG5 N;  4KC2 A;  4KT7 A;  3CU0 A;  2YQJ A;  5C8R A;  3CKV A;  5CQN X;  1R80 A;  2E3D A;  2VS5 A;  1JYL A;  4P02 A;  3IOH A;  5IDT A;  4B4M A;  1E5K A;  3ZGG A;  1FO8 A;  3O3P A;  3F1Y A;  2VSI A;  2ZU8 A;  1VZX A;  4K6R A;  2I5E A;  4B2W A;  4D11 A;  3HL3 A;  4P00 A;  4Y7G A;  3ZLL A;  5C4E A;  5C36 A;  1INI A;  2J0A A;  4BMA A;  1G2V A;  1S4P A;  2V0H A;  1ZI3 A;  2WVM A;  4Y7U A;  4EE4 A;  1NHE B;  2W0W A;  3I0F A;  5FU8 A;  4ZDQ A;  5EIY A;  5D92 A;  1FGG A;  1VGU A;  1JV3 A;  1WVC A;  4CJ8 A;  4FRP A;  1SS9 A;  5J49 A;  1MP5 A;  5CQO A;  2P72 A;  4Y7F A;  2RJ4 A;  5D91 A;  2Y4K A;  1HJJ A;  4HO5 A;  5AJN A;  2AM5 A;  2Y7A A;  5AJO A;  3RSB A;  1H5T A;  1ZJ0 A;  4CJC A;  2BO4 A;  1HM9 A;  1G8O A;  4Q7C A;  1HJL A;  3U2W A;  1V84 A;  2FYB A;  4B5B A;  3CKJ A;  2XMH A;  3I0J A;  2VXM A;  2RJ8 A;  2W0V A;  2VXL A;  2JCK A;  1NMM B;  4KRV A;  2ICX A;  3CKO A;  1TZF A;  2Y4L A;  1I52 A;  1W77 A;  1ZCT A;  4KNX A;  4FRL A;  1GWV A;  4XWI A;  5DDT A;  3BCV A;  1FR8 A;  2YCM A;  1LL2 A;  1LZJ A;  1MP3 A;  1INJ A;  2J0B A;  4FIY A;  1JVG A;  3PNN A;  2AM3 A;  2OI5 A;  2MZB A;  4FRD A;  4KQL A;  2FY7 A;  3E26 A;  1G93 A;  1VGZ A;  2RJ7 A;  1YRO B;  3CKQ A;  3I0E A;  3OH3 A;  3ST8 A;  3SX7 A;  4EE3 A;  1FRW A;  1H7E A;  4D0T A;  5C47 A;  2APC A;  2X5S A;  2O1H A;  5IDS A;  2Z87 A;  2JCJ A;  1G3L A;  1S4N A;  4HO3 A;  4G3Q A;  3V8Z A;  4MIX A;  5C1G A;  3I0K A;  1W57 A;  3I0H A;  3V0L A;  2JCO A;  5FUH A;  3FWW A;  1R7V A;  3SXD A;  5CMG X;  4HO8 A;  3NGW A;  4KC4 A;  3F1C A;  3OH2 A;  2OEF A;  4Y64 A;  2P6W A;  2XWN A;  1NQI B;  1ZI5 A;  1H7Q A;  1ON6 A;  1YP4 A;  1PZT A;  1YP3 A;  4HO0 A;  5C48 A;  1LL0 A;  2FYC B;  2ZU9 A;  1H7T A;  2PA4 A;  5CMF X;  4ARW A;  1H5S C;  1OQM B;  1O7O A;  2YQS A;  4Y6N A;  1JV1 A;  1R7X A;  3TZT A;  1H3M A;  2AGD A;  4KC1 A;  3USR A;  3K8E A;  3KIA A;  2O1G A;  4FRA A;  3SX5 A;  3IOJ A;  3QVB A;  4HOC A;  4Y63 A;  1ON8 A;  2O1F A;  4Y62 A;  2YES A;  3R2W A;  2YC5 A;  1K4V A;  2X60 A;  5C3A A;  1S4O A;  5CMH A;  4FRO A;  2VK9 A;  1H5S B;  2FYA A;  3CKN A;  4HO9 A;  3I0C A;  1LZI A;  2V0I A;  3V90 A;  3T7O A;  3U2X A;  3SXC A;  1W55 A;  2UX8 A;  4O6N A;  1WT0 A;  3POL A;  5C3B A;  3T7N A;  5JQQ A;  5IFY A;  4CJB A;  3PKP A;  4EEG A;  1ZI4 A;  4B2X A;  4D48 A;  5AJP A;  2V0K A;  1LL3 A;  1HM8 A;  3E25 A;  2V0L A;  2Q4J A;  4CVH A;  3I0L A;  1NWG B;  2VS3 A;  1FWY A;  1GQC A;  2QGI A;  3OAM A;  1QG8 A;  2GGO A;  1FXO A;  2XWM A;  3OC9 A;  3D8V A;  4M28 A;  4Y6U A;  1HV9 A;  1QGS A;  4EEA A;  3OH1 A;  1R81 A;  5C4C A;  1TVY A;  1ZJO A;  1ZJP A;  4ASJ A;  1FO9 A;  3U0X A;  4G3S A;  2VS4 A;  2QH5 A;  1FGX A;  4FRB A;  3OGZ A;  5CMI A;  3D5N A;  3RMV A;  4JD0 A;  5L6V A;  1VZT A;  2WE9 A;  3V8Y A;  1WT3 A;  1G1L A;  1ZCV A;  3BRK X;  5DDV A;  4EE5 A;  1H4D A;  3T7M A;  4B3U A;  3U2T A;  1VH3 A;  4D11 C;  1QWJ A;  1YP2 A;  2D7R A;  1R7U A;  5C3D A;  1H5S A;  1H4C A;  4AAW A;  2OI6 A;  2DPW A;  2ICY A;  2VSH A;  1LZ7 A;  2RIY A;  1VZU A;  4ASY A;  4HO6 A;  2AM4 A;  1H5S D;  2Y6P A;  1VM8 A;  4FRQ A;  2I5K A;  2PGY A;  4KPX A;  3U0Y A;  2RJ5 A;  2ZU7 A;  4FRH A;  3ZLK A;  4L41 C;  2RIZ A;  2V0J A;  4DE7 A;  4O6M A;  1H7H A;  2JCL A;  3SX3 A;  4IRQ A;  4IRP A;  3USQ A;  3K8D A;  5CQM X;  1ZDG A;  1TW5 A;  5CMJ A;  2VD4 A;  3U2V A;  4JIS A;  4ECM A;  1GX4 A;  3SXG A;  3V0P A;  1GQ9 A;  2WEE A;  3ZF8 A;  1IIN A;  4LW3 A;  2I7B A;  2AE7 A;  1VIC A;  3FOQ A;  4DEC A;  4HG6 A;  4EEO A;  4E1K A;  1FZW A;  4EEM A;  2BO6 A;  1MC3 A;  5FU0 A;  3IOI A;  1HM0 A;  5C4B A;  1V83 A;  1VH1 A;  1EZI A;  4M2A A;  2C0N A;  1G95 A;  4M2B A;  1Z90 A;  3Q4S A;  1G0R A;  1VPA A;  5FYE A;  5C4D A;  2A8W A;  2RIT A;  4MYB A;  3SXB A;  1LZ0 A;  5BXC A;  1VGT A;  4KNR A;  1R82 A;  5L6S A;  1XZ6 A;  1GX0 A;  4AYJ A;  1H7L A;  3DK5 A;  1OMX A;  3Q7U A;  2CU2 A;  3SXA A;  1NF5 B;  2NXV A;  3CGX A;  4HCQ A;  2X5Z A;  2D7I A;  5C1H A;  2PX7 A;  4NAI A;  3SXE A;  3DUV A;  1NKH B;  2RJ0 A;  1H7G A;  2FFV A;  5CQL X;  3ZGF A;  1WSZ A;  1WT1 A;  1O7Q A;  1R7T A;  1ZCY A;  1FOA A;  1ZCU A;  2WVL A;  1MP4 A;  3EE5 A;  4LW6 A;  5FTV A;  1JVD A;  1PZY B;  3V0N A;  1ZIZ A;  5C49 A;  2WVK A;  4R7P A;  1JYK A;  1H5R B;  1XHB A;  2WGZ A;  2Y4M A;  2WAW A;  2XME A;  2YC3 A;  4FRE A;  4FCE A;  1G97 A;  2VFZ A;  3I0D A;  3RMW A;  3U2U A;  2OI7 A;  2E8B A;  2GGQ A;  1EYR A;  4FIX A;  4NAL A;  1KWS A;  1O23 B;  1ZJ2 A;  1WT2 A;  4B42 A;  4FCU A;  5EJZ A;  2Y4J A;  2QKX A;  4B4B A;  1G23 A;  4Y9X A;  3V0Q A;  2D0J A;  4FQW A;  3PKQ A;  4FRM A;  2RIX A;  4DDZ A;  3V0M A;  4Y7T A;  5FV9 A;  1LVW A;  4MND A;  4GBP A;  3OH4 A;  4HO4 A;  4AYL A;  1ZDF A;  4KPZ A;  1GWW A;  3DJ4 A;  5I1F A;  2AH9 A;  2AEC A;  2OEG A;  4KXO A;  3OH0 A;  4NAK A;  3I0I X;  2A8U A;  3SX8 A;  4YS8 A;  1QGQ A;  2BO7 A;  1ZJ3 A;  1V82 A;  1H7F A;  3I0G A;  3Q80 A;  2P73 A;  4D0Z A;  3V91 A;  5C4F A;  3OKR A;  2YQC A;  1IIM A;  4EVW A;  1ZHJ A;  3D98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...