1FO8A

Crystal structure of n-acetylglucosaminyltransferase i
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
343
structure length
330
Chain Sequence
b'LAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-ACETYLGLUCOSAMINY
publication title X-ray crystal structure of rabbit N-acetylglucosaminyltransferase I: catalytic mechanism and a new protein superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 111
structure length 330
sequence length 343
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2000-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 1fo8A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1fo8A01
1H7TA 3SX7A 1FO9A 3D98A 4M2BA 5C3DA 3SX8A 1G95A 3SXBA 3Q80A 1GX0A 3I0DA 1H3MA 1G0RA 3I0FA 5CMGX 1G3LA 3USRA 3ZF8A 3I0LA 3IOHA 3BCVA 4D11A 2RJ7A 3SXAA 1VH1A 1H5TA 2VS5A 5EJZA 3N9WA 1ZIZA 3I0IX 1S4PA 3R3IA 4HOCA 4HO3A 4D48A 1VICA 2VS4A 1NF5B 1INJA 2WVLA 1INIA 3FWWA 1IINA 4DDZA 3D5NA 1LL3A 2V0JA 1HV9A 5CQPA 5C8RA 4M28A 2GGOA 1ZCTA 3RMWA 4FRHA 3V0OA 4M4KA 1H7EA 3PKQA 1MC3A 3I0EA 1JV3A 4L41C 5FTVA 2X65A 2RIZA 2APCA 5JQQA 2YC3A 5I1FA 4D0ZA 5CQNX 2FY7A 4EEAA 2DPWA 2Y4JA 4B2WA 2AESA 1VM8A 5CMJA 4FROA 5AJPA 2AH9A 3CU0A 2RJ4A 4FREA 4ZDQA 2YQJA 4KC2A 1S4OA 5CQMX 2V0IA 4R7PA 1ZDGA 4M2AA 1H4DA 1WT0A 4D0TA 1WT3A 1QWJA 1VGWA 1G1LA 4BMAA 2RJ0A 4IRPA 4Y64A 1JVGA 3K8DA 5C49A 2VXLA 3OAMA 1TW5A 2RJ6A 2P6WA 5CMFX 2PGYA 1FGGA 1YROB 3POLA 2VS3A 3U2XA 3SXDA 1R7YA 5HS2A 4HO6A 3E25A 3E26A 4FRQA 1H7QA 1LZJA 4ECMA 2XWLA 5C1LA 3OH3A 2ZU7A 1ON8A 1R7VA 1GQ9A 3R2WA 1VGTA 4EE5A 3V90A 2FYAA 2BO6A 2Y4MA 5FTSA 5C4BA 1LL2A 4G3QA 3CKNA 1ZHJA 2D0JA 4NANA 3CKOA 2VSIA 2OI6A 1NKHB 5C38A 4CJCA 4LW3A 4AC3A 1HM9A 2O1FA 4CJBA 2ICYA 2WGZA 4B4MA 1EZIA 3KIAA 1FOAA 1O0RA 1VGZA 1VZUA 1I52A 5C48A 5DDTA 1FRWA 1ZJ0A 2UX8A 3PKPA 4EEMA 5C4CA 5EIYA 5FU8A 4E1KA 2ZU9A 3TQDA 3HL3A 3SX3A 4AAWA 2YC5A 1H7HA 4KNRA 2OI5A 3EE5A 2JCKA 1O7QA 1O23B 3JUKA 4Y7VA 3ZLKA 2Y6PA 2ZU8A 1H5RB 3V0MA 2XMHA 2YQCA 3DJ4A 4ARWA 4KNXA 3SXGA 3OH2A 3TZTA 4NALA 3JUJA 5IDSA 1R7XA 5C4FA 1ZI4A 2BO7A 2WE9A 2I5EA 1YP4A 4KXOA 4B2XA 4MNDA 4YS8A 3PNNA 4ASJA 1FR9A 4G3PA 3F1CA 3V0QA 1TZFA 1JYKA 1G9RA 3CKQA 5C36A 5FUHA 1IIMA 4BQHA 1SS9A 3I0JA 3T7NA 1GA8A 1XHBA 3Q7UA 3JTJA 2JCLA 1H7LA 2E3DA 1FXOA 4HO0A 1H4CA 4HO2A 2AM4A 3SXEA 2XWNA 3NGWA 1MP4A 2QH5A 4FCUA 5DDVA 4JISA 5C4DA 2NXVA 3BRKX 1LL0A 2QKXA 3V8YA 4Y63A 5AJOA 4FRPA 4Y7UA 1FXJA 1GWVA 3RMVA 3CGXA 2BO8A 2WEEA 4Y7TA 1YP3A 1H5RA 2Z87A 1ON6A 1ZCVA 1LZIA 2AE7A 4B4GA 1JV1A 3I0GA 2V0HA 4EE3A 1W55A 2V0LA 3K8EA 4FRBA 4G3SA 2O1HA 3SX5A 1R81A 3OKRA 4C2SA 1H7GA 5CQLX 2E8BA 4LW6A 4FRMA 1WSZA 1ZJ1A 3IOIA 4FRLA 1QG8A 2VXMA 4HO8A 3ZLLA 1TVYA 4B42A 3U2UA 1OMZA 4B5BA 1ZI1A 1HJJA 3OGZA 2YQHA 2PGVA 1ZI5A 1VPAA 2W0WA 3I0CA 1W57A 3SPTA 4HO9A 1V82A 2WVKA 3GUEA 1G93A 4NAKA 2WAWA 4P02A 5FYEA 3U2TA 2FFUA 5C4EA 2A8WA 2VSHA 2Q4JA 1MP5A 4KRVA 1WT2A 1NHEB 3CKJA 2GGQA 3V0NA 4KT7A 1GWWA 3V0LA 1W77A 1LZ0A 1ZCYA 4Y6UA 5AJNA 1G8OA 3OH1A 4CJ8A 1ZJ3A 5CMHA 3I0HA 4JD0A 2VFZA 5L6VA 1LZ7A 2XWMA 4FQWA 1PZTA 2YCMA 5C3BA 4HG6A 1ZJOA 1V83A 2WVMA 3CKVA 5IFYA 4G87A 3F1YA 1K4VA 1KWSA 1ZI3A 2RITA 2A8UA 4ASYA 3USQA 1R80A 2MZBA 4IRQA 5FU0A 3DUVA 2VD4A 1EYRA 4NAIA 1H4EA 1MP3A 2Z86A 1ZJ2A 4HO4A 2FYBA 3V0PA 2AM5A 3ZGGA 2X5ZA 2RJ8A 4Y9XA 4B3UA 2Y4KA 4XWIA 2FFVA 3OH4A 1LVWA 3SXCA 3FOQA 4EVWA 1G2VA 1NQIB 4P00A 2AECA 4EEGA 1GX4A 2OI7A 2X60A 5CMIA 1E5KA 5CQOA 1H7FA 2P72A 5C3AA 5BXCA 2RJ9A 2RIYA 1VZXA 4AYLA 1PZYB 5IDTA 1HM0A 1QGSA 3I0KA 3OC9A 1G23A 3IOJA 1ZJPA 1H5SB 2P73A 1FR8A 1NMMB 4Y62A 1V84A 1R7UA 3V8ZA 1FGXA 2XMEA 3DK5A 5C1GA 1FG5N 2OEFA 3O3PA 4MYBA 1ZCUA 3OH0A 2AM3A 4KPZA 1JYLA 4EEOA 1G97A 1HJLA 4EE4A 4DE7A 1WVCA 2RJ1A 1R7TA 1S4NA 2JCJA 5C1HA 5EJ1A 4UEGA 4Y7FA 1TW1A 3ST8A 5J49A 2RIXA 4KPXA 4GBPA 2YESA 2OEGA 5L6SA 3RSBA 2AGDA 1H5TB 1FWYA 2D7RA 3LW6A 1ZDFA 1OMXA 1O7OA 4B4BA 4KC4A 1H5SC 5C47A 4HCQA 4FRAA 1WT1A 5FV9A 2I5KA 2ICXA 1GQCA 1NWGB 2JCOA 1HM8A 2BO4A 4DECA 2PA4A 1OQMB 2PX7A 3T7OA 2X5SA 4FRDA 1H5SD 3U2VA 2CU2A 2I7BA 2Y7AA 4K6RA 4J18A 1FZWA 1R82A 2D7IA 2V0KA 3U0XA 2Y4LA 2YQSA 4AYJA 1XZ6A 2FYCB 3Q4SA 1H5SA 4Y7GA 1VH3A 1QGQA 3QVBA 4HO5A 4CVHA 1VGUA 3D8VA 2O1GA 4FCEA 1YP2A 3U2WA 1Z90A 4KC1A 3T7MA 3V91A 1FO8A 4KQLA 2QGIA 2RJ5A 4Y6NA 4D11C 3U0YA 3ZGFA 1JVDA 2W0VA 1VZTA 2FYDB
chains in the Genus database with same CATH superfamily
1H7TA 3SX7A 1Q0OA 2P7LA 1FO9A 3D98A 1F9ZA 4M2BA 1QTOA 5C3DA 3SX8A 1G95A 3SXBA 4MTQA 3Q80A 1GX0A 3I0DA 1H3MA 4Q7CA 4MTRA 1G0RA 1ZSWA 1FROA 3I0FA 1G3LA 5CMGX 1FA6A 3USRA 3ZF8A 3I0LA 3IOHA 3BCVA 4D11A 2RJ7A 3SXAA 2ZHPA 4NVSA 2Q48A 1H5TA 1VH1A 2VS5A 4JH7A 5EJZA 3N9WA 1ZIZA 1BYLA 3I0IX 1S4PA 3R3IA 4HOCA 4HO3A 4Z6NA 5HCWA 4D48A 1VICA 2VS4A 1NF5B 1INJA 2WVLA 1EILA 1INIA 3FWWA 1LQPA 1IINA 3FCDA 4O6NA 2P7QA 4DDZA 2P7KA 3D5NA 3ECJA 5BWHA 3OJNA 1LL3A 2V0JA 1HV9A 5CQPA 1NKIA 5C8RA 4M28A 2GGOA 1ZCTA 1F1RA 3RMWA 4FRHA 3V0OA 4M4KA 3KOLA 1H7EA 3GHJA 1MC3A 3I0EA 1JV3A 3PKQA 4L41C 5FTVA 2X65A 4KYKA 2RIZA 2APCA 5JQQA 1FA8A 2YC3A 5I1FA 5D4FA 4D0ZA 4HC5A 1KW3B 5CQNX 2FY7A 3B59A 4EEAA 2DPWA 1TSJA 2Y4JA 4B2WA 2AESA 1VM8A 5CMJA 1KWCB 4OPNA 4FROA 5KEFA 4JH4A 5AJPA 2AH9A 3CU0A 2RJ4A 3G12A 4FREA 4IAGA 5DFGA 4ZDQA 5EC3A 5C4PA 2YQJA 4KC2A 1S4OA 5CQMX 2V0IA 4R7PA 2P7PA 1ZDGA 4M2AA 1H4DA 1WT0A 4D0TA 1WT3A 3E0RA 2ZW5A 1QWJA 1G1LA 1VGWA 4BMAA 4Z6VA 3ZW5A 2RJ0A 4IRPA 4Y64A 1JVGA 3K8DA 3W0UA 5C49A 1TG5A 2VXLA 3OAMA 1TW5A 2RJ6A 2C0NA 2P6WA 5CMFX 2PGYA 1KMZA 1FGGA 1YROB 3POLA 2VS3A 3U2XA 3SXDA 1R7YA 4JH9A 5HS2A 4HO6A 3E25A 3PKVA 4MYMA 3E26A 4FRQA 1H7QA 1LZJA 4ECMA 3HUHA 3ISQA 2RBBA 1JIFA 2XWLA 2PJSA 4LQBA 3ZI1A 1JC5A 3HDPA 5C1LA 4HUZA 3HNQA 3OH3A 2ZU7A 4MIXA 1ON8A 1GQ9A 1R7VA 3R2WA 1VGTA 1LQOA 4EE5A 1SP9A 1ECSA 3V90A 2FYAA 2BO6A 3OAJA 4NB0A 2Y4MA 1FA5A 5FTSA 4NB2A 5C4BA 1LL2A 1TFZA 1KW6B 3CKNA 1ZHJA 4G3QA 2D0JA 4NANA 3CKOA 2VSIA 2OI6A 5D7ZA 1QIPA 3SK2A 1NKHB 3PKXA 5C38A 5D91A 4CJCA 4LW3A 4AC3A 1HM9A 2O1FA 3W0TA 4CJBA 2ICYA 2WGZA 4B4MA 1EZIA 3KIAA 1EIQA 1FOAA 1FA7A 1F1VA 1O0RA 1VGZA 4Z6SA 2R6UA 4JH1A 1I52A 1VZUA 4Z6RA 5C48A 5DDTA 1FRWA 1KMYA 1ZJ0A 4NAYA 3OJJA 2UX8A 3PKPA 4EEMA 5C4CA 5EIYA 5F6QA 5FU8A 4E1KA 2ZU9A 4JH6A 1KW9B 1JC4A 3TQDA 2ZW4A 3HL3A 3SX3A 4AAWA 2YC5A 2ZA0A 1H7HA 2EHZA 4Z6OA 2ZW7A 4KNRA 1XQAA 2OI5A 3EE5A 1U6LA 2JCKA 1O7QA 1O23B 3HPVA 3JUKA 4Y7VA 3ZLKA 2Y6PA 5DHWA 2ZU8A 1JIEA 1H5RB 3V0MA 2XMHA 2YQCA 3DJ4A 4ARWA 4KNXA 3SXGA 3OH2A 3TZTA 4NALA 3JUJA 5IDSA 5C6XA 1R7XA 5C4FA 1ZI4A 2BO7A 2WE9A 2I5EA 4Z6MA 1YP4A 4KXOA 4B2XA 1KNFA 3OA4A 4MNDA 4YS8A 3PNNA 4ASJA 1LKDA 1FR9A 4G3PA 1HANA 3F1CA 3V0QA 4G6XA 1TZFA 1JYKA 1G9RA 3CKQA 3R4QA 3OJKA 5FUHA 5C36A 1IIMA 3OUMA 4BQHA 1SS9A 3I0JA 3T7NA 1GA8A 1XHBA 3HQ0A 4GHCA 3Q7UA 3JTJA 2ZW6A 2JCLA 4NAZA 1H7LA 2E3DA 1FXOA 1NPBA 4HO0A 1EWJA 1H4CA 4HO2A 2AM4A 3SXEA 2XWNA 3NGWA 3ZGJA 1MP4A 2QH5A 1T47A 4FCUA 5DDVA 4JISA 5C4DA 2NXVA 1KLLA 3BRKX 3L20A 1LL0A 2QKXA 3V8YA 2J0AA 4Y63A 5AJOA 1EIRA 4FRPA 4Y7UA 1FXJA 2P7MA 1GWVA 4NB1A 3RMVA 3CGXA 2EI1A 2BO8A 2WEEA 4Y7TA 1KNDA 1DHYA 1YP3A 1H5RA 2Z87A 1ON6A 1ZCVA 1LZIA 2VK9A 2AE7A 4B4GA 2WL3A 1JV1A 3I0GA 2V0HA 4EE3A 1W55A 2V0LA 3K8EA 4FRBA 4Z04A 4G3SA 2O1HA 3RMUA 3SX5A 1R81A 3OKRA 4C2SA 5BWGA 1H7GA 3GM5A 5CQLX 2E8BA 4LW6A 4FRMA 1WSZA 1ZJ1A 1LQKA 3IOIA 1QG8A 4FRLA 2VXMA 4HO8A 3ZLLA 1XRKA 1TVYA 4B42A 1SQIA 3U2UA 1U69A 2A4WA 1OMZA 4B5BA 1ZI1A 2RK0A 1HJJA 3OGZA 2YQHA 4GYMA 2PGVA 1ZI5A 4FIXA 3LM4A 4JD1A 1VPAA 5DRHA 2W0WA 2R5VA 4O6MA 3I0CA 1W57A 3SPTA 4HO9A 3CT8A 1V82A 2WVKA 4GHEA 1G93A 2WAWA 3GUEA 4NAKA 4P02A 2FFUA 5FYEA 3U2TA 5C4EA 2IG9A 2J0BA 2A8WA 3RHEA 3RRIA 2VSHA 2Q4JA 1MP5A 4KRVA 1WT2A 1NHEB 3CKJA 4JH2A 2GGQA 3V0NA 3OPYB 4JH5A 4KT7A 5CJ3A 1LGTA 3P8AA 4GHHA 4Z6WA 1GWWA 3V0LA 1W77A 1LZ0A 1ZCYA 4Y6UA 1F1XA 5AJNA 3PKWA 1G8OA 3OH1A 4CJ8A 1ZJ3A 5CMHA 3VW9A 3I0HA 4JD0A 2VFZA 4FIYA 3BZAA 5L6VA 1LZ7A 2XWMA 1CJXA 3L7TA 1PZTA 2YCMA 4FQWA 1Q0CA 4HG6A 5C3BA 1ZJOA 1V83A 2WVMA 3CKVA 5IFYA 4G87A 3F1YA 1K4VA 1KWSA 1ZI3A 2RITA 2QQZA 2A8UA 2IGAA 4ASYA 3USQA 1SS4A 1R80A 2MZBA 4IRQA 5FU0A 3DUVA 3OJTA 1EYRA 1XY7A 2VD4A 3LHOA 2QH0A 4NAIA 4PV5A 4GHFA 1H4EA 1MP3A 2Z86A 1ZJ2A 4HO4A 2FYBA 3V0PA 2AM5A 3BQXA 5D92A 3ZGGA 2X5ZA 5C68A 2RJ8A 4Y9XA 4B3UA 2ZYQA 2Y4KA 4XWIA 2FFVA 3OH4A 1LVWA 3SXCA 1QINA 1SQDA 3FOQA 4EVWA 1G2VA 1NQIB 4P00A 2AECA 4EEGA 1GX4A 1KWBB 2OI7A 2X60A 5CMIA 1E5KA 5CQOA 1H7FA 2P72A 5C3AA 5BXCA 2QNTA 2RJ9A 2RIYA 1VZXA 4AYLA 1PZYB 5IDTA 1HM0A 2RK9A 1SP8A 3EY8A 1QGSA 2P7OA 4GHDA 3E5DA 1F1UA 3I0KA 3OC9A 4JH3A 3OPYA 1G23A 3IOJA 1ZJPA 3OULA 1H5SB 1BH5A 4Z6UA 2P73A 2C21A 1FR8A 1NMMB 4Y62A 1V84A 1R7UA 3V8ZA 1FGXA 2XMEA 3DK5A 5C1GA 1FG5N 2OEFA 3O3PA 1MPYA 2ZI8A 4MYBA 1ZCUA 3OH0A 2AM3A 4KPZA 1JYLA 4EEOA 2EI2A 1G97A 1HJLA 4EE4A 2WL9A 4DE7A 1WVCA 3R6AA 4Z6ZA 4MTTA 5CB9A 2RJ1A 1R7TA 1S4NA 2JCJA 4IR0A 5C1HA 5EJ1A 4UEGA 4Y7FA 1TW1A 3ST8A 5J49A 2RIXA 3ECKA 4KPXA 4GBPA 3IUZA 2YESA 2OEGA 5L6SA 3RSBA 2AGDA 4JH8A 1H5TB 1FWYA 2D7RA 3LW6A 1ZDFA 1OMXA 1O7OA 4B4BA 4KYHA 4KC4A 1H5SC 5C47A 4HCQA 3VB0A 1TWUA 5CTOA 4FRAA 1MH6A 1WT1A 5FV9A 2I5KA 2ICXA 1GQCA 1NIQB 1NWGB 2JCOA 1HM8A 2BO4A 4DECA 2PA4A 1OQMB 2PX7A 3T7OA 2A4XA 2P25A 2X5SA 4RT5A 4FRDA 1H5SD 3U2VA 2CU2A 2I7BA 3HPYA 2Y7AA 4K6RA 4J18A 1FZWA 1R82A 2D7IA 2RJBA 2EI0A 4QB5A 2V0KA 3U0XA 3OXHA 2Y4LA 4Z6LA 2YQSA 4AYJA 1XZ6A 2FYCB 3Q4SA 1H5SA 4Y7GA 4N04A 1R9CA 1VH3A 1QGQA 3QVBA 2I7RA 4HO5A 4CVHA 1VGUA 4Z6QA 3D8VA 2O1GA 4FCEA 1YP2A 3U2WA 4Z6PA 1Z90A 4KC1A 3T7MA 3V91A 1KW8B 1K4NA 4Z6TA 1FO8A 2EI3A 4KQLA 2QGIA 2RJ5A 4MTSA 4Y6NA 4PAVA 3EY7A 4D11C 3U0YA 3ZGFA 4X2AA 1JVDA 4GHGA 2W0VA 1VZTA 2FYDB 1NNRA
chains in the Genus database with same CATH topology
1H7TA 3SX7A 1FO9A 3D98A 4M2BA 5C3DA 3SX8A 1G95A 3SXBA 3Q80A 1GX0A 3I0DA 1H3MA 4Q7CA 1G0RA 3I0FA 5CMGX 1G3LA 3USRA 3ZF8A 3I0LA 3IOHA 3BCVA 4D11A 2RJ7A 3SXAA 1VH1A 1H5TA 2VS5A 5EJZA 3N9WA 1ZIZA 3I0IX 1S4PA 3R3IA 4HOCA 4HO3A 4D48A 1VICA 2VS4A 1NF5B 1INJA 2WVLA 1INIA 3FWWA 1IINA 4O6NA 4DDZA 3D5NA 1LL3A 2V0JA 1HV9A 5CQPA 5C8RA 4M28A 2GGOA 1ZCTA 3RMWA 4FRHA 3V0OA 4M4KA 1H7EA 3PKQA 1MC3A 3I0EA 1JV3A 4L41C 5FTVA 2X65A 2RIZA 2APCA 5JQQA 2YC3A 5I1FA 4D0ZA 5CQNX 2FY7A 4EEAA 2DPWA 2Y4JA 4B2WA 2AESA 1VM8A 5CMJA 4FROA 5AJPA 2AH9A 3CU0A 2RJ4A 4FREA 4ZDQA 2YQJA 4KC2A 1S4OA 5CQMX 2V0IA 4R7PA 1ZDGA 4M2AA 1H4DA 1WT0A 4D0TA 1WT3A 1QWJA 1VGWA 1G1LA 4BMAA 2RJ0A 4IRPA 4Y64A 1JVGA 3K8DA 5C49A 2VXLA 3OAMA 1TW5A 2RJ6A 2C0NA 2P6WA 5CMFX 2PGYA 1FGGA 1YROB 3POLA 2VS3A 3U2XA 3SXDA 1R7YA 5HS2A 4HO6A 3E25A 3E26A 4FRQA 1H7QA 1LZJA 4ECMA 2XWLA 5C1LA 3OH3A 2ZU7A 4MIXA 1ON8A 1R7VA 1GQ9A 3R2WA 1VGTA 4EE5A 3V90A 2FYAA 2BO6A 2Y4MA 5FTSA 5C4BA 1LL2A 4G3QA 3CKNA 1ZHJA 2D0JA 4NANA 3CKOA 2VSIA 2OI6A 1NKHB 5C38A 5D91A 4CJCA 4LW3A 4AC3A 1HM9A 2O1FA 4CJBA 2ICYA 2WGZA 4B4MA 1EZIA 3KIAA 1FOAA 1O0RA 1VGZA 1VZUA 1I52A 5C48A 5DDTA 1FRWA 1ZJ0A 2UX8A 3PKPA 4EEMA 5C4CA 5EIYA 5FU8A 4E1KA 2ZU9A 3TQDA 3HL3A 3SX3A 4AAWA 2YC5A 1H7HA 4KNRA 2OI5A 3EE5A 2JCKA 1O7QA 1O23B 3JUKA 4Y7VA 3ZLKA 2Y6PA 2ZU8A 1H5RB 3V0MA 2XMHA 2YQCA 3DJ4A 4ARWA 4KNXA 3SXGA 3OH2A 3TZTA 4NALA 3JUJA 5IDSA 1R7XA 5C4FA 1ZI4A 2BO7A 2WE9A 2I5EA 1YP4A 4KXOA 4B2XA 4MNDA 4YS8A 3PNNA 4ASJA 1FR9A 4G3PA 3F1CA 3V0QA 1TZFA 1JYKA 1G9RA 3CKQA 5C36A 5FUHA 1IIMA 4BQHA 1SS9A 3I0JA 3T7NA 1GA8A 1XHBA 3Q7UA 3JTJA 2JCLA 1H7LA 2E3DA 1FXOA 4HO0A 1H4CA 4HO2A 2AM4A 3SXEA 2XWNA 3NGWA 1MP4A 2QH5A 4FCUA 5DDVA 4JISA 5C4DA 2NXVA 3BRKX 1LL0A 2QKXA 3V8YA 2J0AA 4Y63A 5AJOA 4FRPA 4Y7UA 1FXJA 1GWVA 3RMVA 3CGXA 2BO8A 2WEEA 4Y7TA 1YP3A 1H5RA 2Z87A 1ON6A 1ZCVA 1LZIA 2VK9A 2AE7A 4B4GA 1JV1A 3I0GA 2V0HA 4EE3A 1W55A 2V0LA 3K8EA 4FRBA 4G3SA 2O1HA 3SX5A 1R81A 3OKRA 4C2SA 1H7GA 5CQLX 2E8BA 4LW6A 4FRMA 1WSZA 1ZJ1A 3IOIA 4FRLA 1QG8A 2VXMA 4HO8A 3ZLLA 1TVYA 4B42A 3U2UA 1OMZA 4B5BA 1ZI1A 1HJJA 3OGZA 2YQHA 2PGVA 4FIXA 1ZI5A 4O6MA 1VPAA 2W0WA 3I0CA 1W57A 3SPTA 4HO9A 1V82A 2WVKA 3GUEA 1G93A 4NAKA 2WAWA 4P02A 5FYEA 3U2TA 2FFUA 5C4EA 2J0BA 2A8WA 2VSHA 2Q4JA 1MP5A 4KRVA 1WT2A 1NHEB 3CKJA 2GGQA 3V0NA 4KT7A 1GWWA 3V0LA 1W77A 1LZ0A 1ZCYA 4Y6UA 5AJNA 1G8OA 3OH1A 4CJ8A 1ZJ3A 5CMHA 3I0HA 4JD0A 2VFZA 4FIYA 5L6VA 1LZ7A 2XWMA 4FQWA 1PZTA 2YCMA 5C3BA 4HG6A 1ZJOA 1V83A 2WVMA 3CKVA 5IFYA 4G87A 3F1YA 1K4VA 1KWSA 1ZI3A 2RITA 2A8UA 4ASYA 3USQA 1R80A 2MZBA 4IRQA 5FU0A 3DUVA 2VD4A 1EYRA 4NAIA 1H4EA 1MP3A 2Z86A 1ZJ2A 4HO4A 2FYBA 3V0PA 2AM5A 5D92A 3ZGGA 2X5ZA 2RJ8A 4Y9XA 4B3UA 2Y4KA 4XWIA 2FFVA 3OH4A 1LVWA 3SXCA 3FOQA 4EVWA 1G2VA 1NQIB 4P00A 2AECA 4EEGA 1GX4A 2OI7A 2X60A 5CMIA 1E5KA 5CQOA 1H7FA 2P72A 5C3AA 5BXCA 2RJ9A 2RIYA 1VZXA 4AYLA 1PZYB 5IDTA 1HM0A 1QGSA 3I0KA 3OC9A 1G23A 3IOJA 1ZJPA 1H5SB 2P73A 1FR8A 1NMMB 4Y62A 1V84A 1R7UA 3V8ZA 1FGXA 2XMEA 3DK5A 5C1GA 1FG5N 2OEFA 3O3PA 4MYBA 1ZCUA 3OH0A 2AM3A 4KPZA 1JYLA 4EEOA 1G97A 1HJLA 4EE4A 4DE7A 1WVCA 2RJ1A 1R7TA 1S4NA 2JCJA 5C1HA 5EJ1A 4UEGA 4Y7FA 1TW1A 3ST8A 5J49A 2RIXA 4KPXA 4GBPA 2YESA 2OEGA 5L6SA 3RSBA 2AGDA 1H5TB 1FWYA 2D7RA 3LW6A 1ZDFA 1OMXA 1O7OA 4B4BA 4KC4A 1H5SC 5C47A 4HCQA 4FRAA 1WT1A 5FV9A 2I5KA 2ICXA 1GQCA 1NWGB 2JCOA 1HM8A 2BO4A 4DECA 2PA4A 1OQMB 2PX7A 3T7OA 2X5SA 4FRDA 1H5SD 3U2VA 2CU2A 2I7BA 2Y7AA 4K6RA 4J18A 1FZWA 1R82A 2D7IA 2V0KA 3U0XA 2Y4LA 2YQSA 4AYJA 1XZ6A 2FYCB 3Q4SA 1H5SA 4Y7GA 1VH3A 1QGQA 3QVBA 4HO5A 4CVHA 1VGUA 3D8VA 2O1GA 4FCEA 1YP2A 3U2WA 1Z90A 4KC1A 3T7MA 3V91A 1FO8A 4KQLA 2QGIA 2RJ5A 4Y6NA 4D11C 3U0YA 3ZGFA 1JVDA 2W0VA 1VZTA 2FYDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7T A;  3SX7 A;  1FO9 A;  3D98 A;  4M2B A;  5C3D A;  3SX8 A;  1G95 A;  3SXB A;  3Q80 A;  1GX0 A;  3I0D A;  1H3M A;  1G0R A;  3I0F A;  5CMG X;  1G3L A;  3USR A;  3ZF8 A;  3I0L A;  3IOH A;  3BCV A;  4D11 A;  2RJ7 A;  3SXA A;  1VH1 A;  1H5T A;  2VS5 A;  5EJZ A;  3N9W A;  1ZIZ A;  3I0I X;  1S4P A;  3R3I A;  4HOC A;  4HO3 A;  4D48 A;  1VIC A;  2VS4 A;  1NF5 B;  1INJ A;  2WVL A;  1INI A;  3FWW A;  1IIN A;  4DDZ A;  3D5N A;  1LL3 A;  2V0J A;  1HV9 A;  5CQP A;  5C8R A;  4M28 A;  2GGO A;  1ZCT A;  3RMW A;  4FRH A;  3V0O A;  4M4K A;  1H7E A;  3PKQ A;  1MC3 A;  3I0E A;  1JV3 A;  4L41 C;  5FTV A;  2X65 A;  2RIZ A;  2APC A;  5JQQ A;  2YC3 A;  5I1F A;  4D0Z A;  5CQN X;  2FY7 A;  4EEA A;  2DPW A;  2Y4J A;  4B2W A;  2AES A;  1VM8 A;  5CMJ A;  4FRO A;  5AJP A;  2AH9 A;  3CU0 A;  2RJ4 A;  4FRE A;  4ZDQ A;  2YQJ A;  4KC2 A;  1S4O A;  5CQM X;  2V0I A;  4R7P A;  1ZDG A;  4M2A A;  1H4D A;  1WT0 A;  4D0T A;  1WT3 A;  1QWJ A;  1VGW A;  1G1L A;  4BMA A;  2RJ0 A;  4IRP A;  4Y64 A;  1JVG A;  3K8D A;  5C49 A;  2VXL A;  3OAM A;  1TW5 A;  2RJ6 A;  2P6W A;  5CMF X;  2PGY A;  1FGG A;  1YRO B;  3POL A;  2VS3 A;  3U2X A;  3SXD A;  1R7Y A;  5HS2 A;  4HO6 A;  3E25 A;  3E26 A;  4FRQ A;  1H7Q A;  1LZJ A;  4ECM A;  2XWL A;  5C1L A;  3OH3 A;  2ZU7 A;  1ON8 A;  1R7V A;  1GQ9 A;  3R2W A;  1VGT A;  4EE5 A;  3V90 A;  2FYA A;  2BO6 A;  2Y4M A;  5FTS A;  5C4B A;  1LL2 A;  4G3Q A;  3CKN A;  1ZHJ A;  2D0J A;  4NAN A;  3CKO A;  2VSI A;  2OI6 A;  1NKH B;  5C38 A;  4CJC A;  4LW3 A;  4AC3 A;  1HM9 A;  2O1F A;  4CJB A;  2ICY A;  2WGZ A;  4B4M A;  1EZI A;  3KIA A;  1FOA A;  1O0R A;  1VGZ A;  1VZU A;  1I52 A;  5C48 A;  5DDT A;  1FRW A;  1ZJ0 A;  2UX8 A;  3PKP A;  4EEM A;  5C4C A;  5EIY A;  5FU8 A;  4E1K A;  2ZU9 A;  3TQD A;  3HL3 A;  3SX3 A;  4AAW A;  2YC5 A;  1H7H A;  4KNR A;  2OI5 A;  3EE5 A;  2JCK A;  1O7Q A;  1O23 B;  3JUK A;  4Y7V A;  3ZLK A;  2Y6P A;  2ZU8 A;  1H5R B;  3V0M A;  2XMH A;  2YQC A;  3DJ4 A;  4ARW A;  4KNX A;  3SXG A;  3OH2 A;  3TZT A;  4NAL A;  3JUJ A;  5IDS A;  1R7X A;  5C4F A;  1ZI4 A;  2BO7 A;  2WE9 A;  2I5E A;  1YP4 A;  4KXO A;  4B2X A;  4MND A;  4YS8 A;  3PNN A;  4ASJ A;  1FR9 A;  4G3P A;  3F1C A;  3V0Q A;  1TZF A;  1JYK A;  1G9R A;  3CKQ A;  5C36 A;  5FUH A;  1IIM A;  4BQH A;  1SS9 A;  3I0J A;  3T7N A;  1GA8 A;  1XHB A;  3Q7U A;  3JTJ A;  2JCL A;  1H7L A;  2E3D A;  1FXO A;  4HO0 A;  1H4C A;  4HO2 A;  2AM4 A;  3SXE A;  2XWN A;  3NGW A;  1MP4 A;  2QH5 A;  4FCU A;  5DDV A;  4JIS A;  5C4D A;  2NXV A;  3BRK X;  1LL0 A;  2QKX A;  3V8Y A;  4Y63 A;  5AJO A;  4FRP A;  4Y7U A;  1FXJ A;  1GWV A;  3RMV A;  3CGX A;  2BO8 A;  2WEE A;  4Y7T A;  1YP3 A;  1H5R A;  2Z87 A;  1ON6 A;  1ZCV A;  1LZI A;  2AE7 A;  4B4G A;  1JV1 A;  3I0G A;  2V0H A;  4EE3 A;  1W55 A;  2V0L A;  3K8E A;  4FRB A;  4G3S A;  2O1H A;  3SX5 A;  1R81 A;  3OKR A;  4C2S A;  1H7G A;  5CQL X;  2E8B A;  4LW6 A;  4FRM A;  1WSZ A;  1ZJ1 A;  3IOI A;  4FRL A;  1QG8 A;  2VXM A;  4HO8 A;  3ZLL A;  1TVY A;  4B42 A;  3U2U A;  1OMZ A;  4B5B A;  1ZI1 A;  1HJJ A;  3OGZ A;  2YQH A;  2PGV A;  1ZI5 A;  1VPA A;  2W0W A;  3I0C A;  1W57 A;  3SPT A;  4HO9 A;  1V82 A;  2WVK A;  3GUE A;  1G93 A;  4NAK A;  2WAW A;  4P02 A;  5FYE A;  3U2T A;  2FFU A;  5C4E A;  2A8W A;  2VSH A;  2Q4J A;  1MP5 A;  4KRV A;  1WT2 A;  1NHE B;  3CKJ A;  2GGQ A;  3V0N A;  4KT7 A;  1GWW A;  3V0L A;  1W77 A;  1LZ0 A;  1ZCY A;  4Y6U A;  5AJN A;  1G8O A;  3OH1 A;  4CJ8 A;  1ZJ3 A;  5CMH A;  3I0H A;  4JD0 A;  2VFZ A;  5L6V A;  1LZ7 A;  2XWM A;  4FQW A;  1PZT A;  2YCM A;  5C3B A;  4HG6 A;  1ZJO A;  1V83 A;  2WVM A;  3CKV A;  5IFY A;  4G87 A;  3F1Y A;  1K4V A;  1KWS A;  1ZI3 A;  2RIT A;  2A8U A;  4ASY A;  3USQ A;  1R80 A;  2MZB A;  4IRQ A;  5FU0 A;  3DUV A;  2VD4 A;  1EYR A;  4NAI A;  1H4E A;  1MP3 A;  2Z86 A;  1ZJ2 A;  4HO4 A;  2FYB A;  3V0P A;  2AM5 A;  3ZGG A;  2X5Z A;  2RJ8 A;  4Y9X A;  4B3U A;  2Y4K A;  4XWI A;  2FFV A;  3OH4 A;  1LVW A;  3SXC A;  3FOQ A;  4EVW A;  1G2V A;  1NQI B;  4P00 A;  2AEC A;  4EEG A;  1GX4 A;  2OI7 A;  2X60 A;  5CMI A;  1E5K A;  5CQO A;  1H7F A;  2P72 A;  5C3A A;  5BXC A;  2RJ9 A;  2RIY A;  1VZX A;  4AYL A;  1PZY B;  5IDT A;  1HM0 A;  1QGS A;  3I0K A;  3OC9 A;  1G23 A;  3IOJ A;  1ZJP A;  1H5S B;  2P73 A;  1FR8 A;  1NMM B;  4Y62 A;  1V84 A;  1R7U A;  3V8Z A;  1FGX A;  2XME A;  3DK5 A;  5C1G A;  1FG5 N;  2OEF A;  3O3P A;  4MYB A;  1ZCU A;  3OH0 A;  2AM3 A;  4KPZ A;  1JYL A;  4EEO A;  1G97 A;  1HJL A;  4EE4 A;  4DE7 A;  1WVC A;  2RJ1 A;  1R7T A;  1S4N A;  2JCJ A;  5C1H A;  5EJ1 A;  4UEG A;  4Y7F A;  1TW1 A;  3ST8 A;  5J49 A;  2RIX A;  4KPX A;  4GBP A;  2YES A;  2OEG A;  5L6S A;  3RSB A;  2AGD A;  1H5T B;  1FWY A;  2D7R A;  3LW6 A;  1ZDF A;  1OMX A;  1O7O A;  4B4B A;  4KC4 A;  1H5S C;  5C47 A;  4HCQ A;  4FRA A;  1WT1 A;  5FV9 A;  2I5K A;  2ICX A;  1GQC A;  1NWG B;  2JCO A;  1HM8 A;  2BO4 A;  4DEC A;  2PA4 A;  1OQM B;  2PX7 A;  3T7O A;  2X5S A;  4FRD A;  1H5S D;  3U2V A;  2CU2 A;  2I7B A;  2Y7A A;  4K6R A;  4J18 A;  1FZW A;  1R82 A;  2D7I A;  2V0K A;  3U0X A;  2Y4L A;  2YQS A;  4AYJ A;  1XZ6 A;  2FYC B;  3Q4S A;  1H5S A;  4Y7G A;  1VH3 A;  1QGQ A;  3QVB A;  4HO5 A;  4CVH A;  1VGU A;  3D8V A;  2O1G A;  4FCE A;  1YP2 A;  3U2W A;  1Z90 A;  4KC1 A;  3T7M A;  3V91 A;  1FO8 A;  4KQL A;  2QGI A;  2RJ5 A;  4Y6N A;  4D11 C;  3U0Y A;  3ZGF A;  1JVD A;  2W0V A;  1VZT A;  2FYD B; 
#chains in the Genus database with same CATH topology
 1H7T A;  3SX7 A;  1Q0O A;  2P7L A;  1FO9 A;  3D98 A;  1F9Z A;  4M2B A;  1QTO A;  5C3D A;  3SX8 A;  1G95 A;  3SXB A;  4MTQ A;  3Q80 A;  1GX0 A;  3I0D A;  1H3M A;  4Q7C A;  4MTR A;  1G0R A;  1ZSW A;  1FRO A;  3I0F A;  1G3L A;  5CMG X;  1FA6 A;  3USR A;  3ZF8 A;  3I0L A;  3IOH A;  3BCV A;  4D11 A;  2RJ7 A;  3SXA A;  2ZHP A;  4NVS A;  2Q48 A;  1H5T A;  1VH1 A;  2VS5 A;  4JH7 A;  5EJZ A;  3N9W A;  1ZIZ A;  1BYL A;  3I0I X;  1S4P A;  3R3I A;  4HOC A;  4HO3 A;  4Z6N A;  5HCW A;  4D48 A;  1VIC A;  2VS4 A;  1NF5 B;  1INJ A;  2WVL A;  1EIL A;  1INI A;  3FWW A;  1LQP A;  1IIN A;  3FCD A;  4O6N A;  2P7Q A;  4DDZ A;  2P7K A;  3D5N A;  3ECJ A;  5BWH A;  3OJN A;  1LL3 A;  2V0J A;  1HV9 A;  5CQP A;  1NKI A;  5C8R A;  4M28 A;  2GGO A;  1ZCT A;  1F1R A;  3RMW A;  4FRH A;  3V0O A;  4M4K A;  3KOL A;  1H7E A;  3GHJ A;  1MC3 A;  3I0E A;  1JV3 A;  3PKQ A;  4L41 C;  5FTV A;  2X65 A;  4KYK A;  2RIZ A;  2APC A;  5JQQ A;  1FA8 A;  2YC3 A;  5I1F A;  5D4F A;  4D0Z A;  4HC5 A;  1KW3 B;  5CQN X;  2FY7 A;  3B59 A;  4EEA A;  2DPW A;  1TSJ A;  2Y4J A;  4B2W A;  2AES A;  1VM8 A;  5CMJ A;  1KWC B;  4OPN A;  4FRO A;  5KEF A;  4JH4 A;  5AJP A;  2AH9 A;  3CU0 A;  2RJ4 A;  3G12 A;  4FRE A;  4IAG A;  5DFG A;  4ZDQ A;  5EC3 A;  5C4P A;  2YQJ A;  4KC2 A;  1S4O A;  5CQM X;  2V0I A;  4R7P A;  2P7P A;  1ZDG A;  4M2A A;  1H4D A;  1WT0 A;  4D0T A;  1WT3 A;  3E0R A;  2ZW5 A;  1QWJ A;  1G1L A;  1VGW A;  4BMA A;  4Z6V A;  3ZW5 A;  2RJ0 A;  4IRP A;  4Y64 A;  1JVG A;  3K8D A;  3W0U A;  5C49 A;  1TG5 A;  2VXL A;  3OAM A;  1TW5 A;  2RJ6 A;  2C0N A;  2P6W A;  5CMF X;  2PGY A;  1KMZ A;  1FGG A;  1YRO B;  3POL A;  2VS3 A;  3U2X A;  3SXD A;  1R7Y A;  4JH9 A;  5HS2 A;  4HO6 A;  3E25 A;  3PKV A;  4MYM A;  3E26 A;  4FRQ A;  1H7Q A;  1LZJ A;  4ECM A;  3HUH A;  3ISQ A;  2RBB A;  1JIF A;  2XWL A;  2PJS A;  4LQB A;  3ZI1 A;  1JC5 A;  3HDP A;  5C1L A;  4HUZ A;  3HNQ A;  3OH3 A;  2ZU7 A;  4MIX A;  1ON8 A;  1GQ9 A;  1R7V A;  3R2W A;  1VGT A;  1LQO A;  4EE5 A;  1SP9 A;  1ECS A;  3V90 A;  2FYA A;  2BO6 A;  3OAJ A;  4NB0 A;  2Y4M A;  1FA5 A;  5FTS A;  4NB2 A;  5C4B A;  1LL2 A;  1TFZ A;  1KW6 B;  3CKN A;  1ZHJ A;  4G3Q A;  2D0J A;  4NAN A;  3CKO A;  2VSI A;  2OI6 A;  5D7Z A;  1QIP A;  3SK2 A;  1NKH B;  3PKX A;  5C38 A;  5D91 A;  4CJC A;  4LW3 A;  4AC3 A;  1HM9 A;  2O1F A;  3W0T A;  4CJB A;  2ICY A;  2WGZ A;  4B4M A;  1EZI A;  3KIA A;  1EIQ A;  1FOA A;  1FA7 A;  1F1V A;  1O0R A;  1VGZ A;  4Z6S A;  2R6U A;  4JH1 A;  1I52 A;  1VZU A;  4Z6R A;  5C48 A;  5DDT A;  1FRW A;  1KMY A;  1ZJ0 A;  4NAY A;  3OJJ A;  2UX8 A;  3PKP A;  4EEM A;  5C4C A;  5EIY A;  5F6Q A;  5FU8 A;  4E1K A;  2ZU9 A;  4JH6 A;  1KW9 B;  1JC4 A;  3TQD A;  2ZW4 A;  3HL3 A;  3SX3 A;  4AAW A;  2YC5 A;  2ZA0 A;  1H7H A;  2EHZ A;  4Z6O A;  2ZW7 A;  4KNR A;  1XQA A;  2OI5 A;  3EE5 A;  1U6L A;  2JCK A;  1O7Q A;  1O23 B;  3HPV A;  3JUK A;  4Y7V A;  3ZLK A;  2Y6P A;  5DHW A;  2ZU8 A;  1JIE A;  1H5R B;  3V0M A;  2XMH A;  2YQC A;  3DJ4 A;  4ARW A;  4KNX A;  3SXG A;  3OH2 A;  3TZT A;  4NAL A;  3JUJ A;  5IDS A;  5C6X A;  1R7X A;  5C4F A;  1ZI4 A;  2BO7 A;  2WE9 A;  2I5E A;  4Z6M A;  1YP4 A;  4KXO A;  4B2X A;  1KNF A;  3OA4 A;  4MND A;  4YS8 A;  3PNN A;  4ASJ A;  1LKD A;  1FR9 A;  4G3P A;  1HAN A;  3F1C A;  3V0Q A;  4G6X A;  1TZF A;  1JYK A;  1G9R A;  3CKQ A;  3R4Q A;  3OJK A;  5FUH A;  5C36 A;  1IIM A;  3OUM A;  4BQH A;  1SS9 A;  3I0J A;  3T7N A;  1GA8 A;  1XHB A;  3HQ0 A;  4GHC A;  3Q7U A;  3JTJ A;  2ZW6 A;  2JCL A;  4NAZ A;  1H7L A;  2E3D A;  1FXO A;  1NPB A;  4HO0 A;  1EWJ A;  1H4C A;  4HO2 A;  2AM4 A;  3SXE A;  2XWN A;  3NGW A;  3ZGJ A;  1MP4 A;  2QH5 A;  1T47 A;  4FCU A;  5DDV A;  4JIS A;  5C4D A;  2NXV A;  1KLL A;  3BRK X;  3L20 A;  1LL0 A;  2QKX A;  3V8Y A;  2J0A A;  4Y63 A;  5AJO A;  1EIR A;  4FRP A;  4Y7U A;  1FXJ A;  2P7M A;  1GWV A;  4NB1 A;  3RMV A;  3CGX A;  2EI1 A;  2BO8 A;  2WEE A;  4Y7T A;  1KND A;  1DHY A;  1YP3 A;  1H5R A;  2Z87 A;  1ON6 A;  1ZCV A;  1LZI A;  2VK9 A;  2AE7 A;  4B4G A;  2WL3 A;  1JV1 A;  3I0G A;  2V0H A;  4EE3 A;  1W55 A;  2V0L A;  3K8E A;  4FRB A;  4Z04 A;  4G3S A;  2O1H A;  3RMU A;  3SX5 A;  1R81 A;  3OKR A;  4C2S A;  5BWG A;  1H7G A;  3GM5 A;  5CQL X;  2E8B A;  4LW6 A;  4FRM A;  1WSZ A;  1ZJ1 A;  1LQK A;  3IOI A;  1QG8 A;  4FRL A;  2VXM A;  4HO8 A;  3ZLL A;  1XRK A;  1TVY A;  4B42 A;  1SQI A;  3U2U A;  1U69 A;  2A4W A;  1OMZ A;  4B5B A;  1ZI1 A;  2RK0 A;  1HJJ A;  3OGZ A;  2YQH A;  4GYM A;  2PGV A;  1ZI5 A;  4FIX A;  3LM4 A;  4JD1 A;  1VPA A;  5DRH A;  2W0W A;  2R5V A;  4O6M A;  3I0C A;  1W57 A;  3SPT A;  4HO9 A;  3CT8 A;  1V82 A;  2WVK A;  4GHE A;  1G93 A;  2WAW A;  3GUE A;  4NAK A;  4P02 A;  2FFU A;  5FYE A;  3U2T A;  5C4E A;  2IG9 A;  2J0B A;  2A8W A;  3RHE A;  3RRI A;  2VSH A;  2Q4J A;  1MP5 A;  4KRV A;  1WT2 A;  1NHE B;  3CKJ A;  4JH2 A;  2GGQ A;  3V0N A;  3OPY B;  4JH5 A;  4KT7 A;  5CJ3 A;  1LGT A;  3P8A A;  4GHH A;  4Z6W A;  1GWW A;  3V0L A;  1W77 A;  1LZ0 A;  1ZCY A;  4Y6U A;  1F1X A;  5AJN A;  3PKW A;  1G8O A;  3OH1 A;  4CJ8 A;  1ZJ3 A;  5CMH A;  3VW9 A;  3I0H A;  4JD0 A;  2VFZ A;  4FIY A;  3BZA A;  5L6V A;  1LZ7 A;  2XWM A;  1CJX A;  3L7T A;  1PZT A;  2YCM A;  4FQW A;  1Q0C A;  4HG6 A;  5C3B A;  1ZJO A;  1V83 A;  2WVM A;  3CKV A;  5IFY A;  4G87 A;  3F1Y A;  1K4V A;  1KWS A;  1ZI3 A;  2RIT A;  2QQZ A;  2A8U A;  2IGA A;  4ASY A;  3USQ A;  1SS4 A;  1R80 A;  2MZB A;  4IRQ A;  5FU0 A;  3DUV A;  3OJT A;  1EYR A;  1XY7 A;  2VD4 A;  3LHO A;  2QH0 A;  4NAI A;  4PV5 A;  4GHF A;  1H4E A;  1MP3 A;  2Z86 A;  1ZJ2 A;  4HO4 A;  2FYB A;  3V0P A;  2AM5 A;  3BQX A;  5D92 A;  3ZGG A;  2X5Z A;  5C68 A;  2RJ8 A;  4Y9X A;  4B3U A;  2ZYQ A;  2Y4K A;  4XWI A;  2FFV A;  3OH4 A;  1LVW A;  3SXC A;  1QIN A;  1SQD A;  3FOQ A;  4EVW A;  1G2V A;  1NQI B;  4P00 A;  2AEC A;  4EEG A;  1GX4 A;  1KWB B;  2OI7 A;  2X60 A;  5CMI A;  1E5K A;  5CQO A;  1H7F A;  2P72 A;  5C3A A;  5BXC A;  2QNT A;  2RJ9 A;  2RIY A;  1VZX A;  4AYL A;  1PZY B;  5IDT A;  1HM0 A;  2RK9 A;  1SP8 A;  3EY8 A;  1QGS A;  2P7O A;  4GHD A;  3E5D A;  1F1U A;  3I0K A;  3OC9 A;  4JH3 A;  3OPY A;  1G23 A;  3IOJ A;  1ZJP A;  3OUL A;  1H5S B;  1BH5 A;  4Z6U A;  2P73 A;  2C21 A;  1FR8 A;  1NMM B;  4Y62 A;  1V84 A;  1R7U A;  3V8Z A;  1FGX A;  2XME A;  3DK5 A;  5C1G A;  1FG5 N;  2OEF A;  3O3P A;  1MPY A;  2ZI8 A;  4MYB A;  1ZCU A;  3OH0 A;  2AM3 A;  4KPZ A;  1JYL A;  4EEO A;  2EI2 A;  1G97 A;  1HJL A;  4EE4 A;  2WL9 A;  4DE7 A;  1WVC A;  3R6A A;  4Z6Z A;  4MTT A;  5CB9 A;  2RJ1 A;  1R7T A;  1S4N A;  2JCJ A;  4IR0 A;  5C1H A;  5EJ1 A;  4UEG A;  4Y7F A;  1TW1 A;  3ST8 A;  5J49 A;  2RIX A;  3ECK A;  4KPX A;  4GBP A;  3IUZ A;  2YES A;  2OEG A;  5L6S A;  3RSB A;  2AGD A;  4JH8 A;  1H5T B;  1FWY A;  2D7R A;  3LW6 A;  1ZDF A;  1OMX A;  1O7O A;  4B4B A;  4KYH A;  4KC4 A;  1H5S C;  5C47 A;  4HCQ A;  3VB0 A;  1TWU A;  5CTO A;  4FRA A;  1MH6 A;  1WT1 A;  5FV9 A;  2I5K A;  2ICX A;  1GQC A;  1NIQ B;  1NWG B;  2JCO A;  1HM8 A;  2BO4 A;  4DEC A;  2PA4 A;  1OQM B;  2PX7 A;  3T7O A;  2A4X A;  2P25 A;  2X5S A;  4RT5 A;  4FRD A;  1H5S D;  3U2V A;  2CU2 A;  2I7B A;  3HPY A;  2Y7A A;  4K6R A;  4J18 A;  1FZW A;  1R82 A;  2D7I A;  2RJB A;  2EI0 A;  4QB5 A;  2V0K A;  3U0X A;  3OXH A;  2Y4L A;  4Z6L A;  2YQS A;  4AYJ A;  1XZ6 A;  2FYC B;  3Q4S A;  1H5S A;  4Y7G A;  4N04 A;  1R9C A;  1VH3 A;  1QGQ A;  3QVB A;  2I7R A;  4HO5 A;  4CVH A;  1VGU A;  4Z6Q A;  3D8V A;  2O1G A;  4FCE A;  1YP2 A;  3U2W A;  4Z6P A;  1Z90 A;  4KC1 A;  3T7M A;  3V91 A;  1KW8 B;  1K4N A;  4Z6T A;  1FO8 A;  2EI3 A;  4KQL A;  2QGI A;  2RJ5 A;  4MTS A;  4Y6N A;  4PAV A;  3EY7 A;  4D11 C;  3U0Y A;  3ZGF A;  4X2A A;  1JVD A;  4GHG A;  2W0V A;  1VZT A;  2FYD B;  1NNR A; 
#chains in the Genus database with same CATH homology
 1H7T A;  3SX7 A;  1FO9 A;  3D98 A;  4M2B A;  5C3D A;  3SX8 A;  1G95 A;  3SXB A;  3Q80 A;  1GX0 A;  3I0D A;  1H3M A;  4Q7C A;  1G0R A;  3I0F A;  5CMG X;  1G3L A;  3USR A;  3ZF8 A;  3I0L A;  3IOH A;  3BCV A;  4D11 A;  2RJ7 A;  3SXA A;  1VH1 A;  1H5T A;  2VS5 A;  5EJZ A;  3N9W A;  1ZIZ A;  3I0I X;  1S4P A;  3R3I A;  4HOC A;  4HO3 A;  4D48 A;  1VIC A;  2VS4 A;  1NF5 B;  1INJ A;  2WVL A;  1INI A;  3FWW A;  1IIN A;  4O6N A;  4DDZ A;  3D5N A;  1LL3 A;  2V0J A;  1HV9 A;  5CQP A;  5C8R A;  4M28 A;  2GGO A;  1ZCT A;  3RMW A;  4FRH A;  3V0O A;  4M4K A;  1H7E A;  3PKQ A;  1MC3 A;  3I0E A;  1JV3 A;  4L41 C;  5FTV A;  2X65 A;  2RIZ A;  2APC A;  5JQQ A;  2YC3 A;  5I1F A;  4D0Z A;  5CQN X;  2FY7 A;  4EEA A;  2DPW A;  2Y4J A;  4B2W A;  2AES A;  1VM8 A;  5CMJ A;  4FRO A;  5AJP A;  2AH9 A;  3CU0 A;  2RJ4 A;  4FRE A;  4ZDQ A;  2YQJ A;  4KC2 A;  1S4O A;  5CQM X;  2V0I A;  4R7P A;  1ZDG A;  4M2A A;  1H4D A;  1WT0 A;  4D0T A;  1WT3 A;  1QWJ A;  1VGW A;  1G1L A;  4BMA A;  2RJ0 A;  4IRP A;  4Y64 A;  1JVG A;  3K8D A;  5C49 A;  2VXL A;  3OAM A;  1TW5 A;  2RJ6 A;  2C0N A;  2P6W A;  5CMF X;  2PGY A;  1FGG A;  1YRO B;  3POL A;  2VS3 A;  3U2X A;  3SXD A;  1R7Y A;  5HS2 A;  4HO6 A;  3E25 A;  3E26 A;  4FRQ A;  1H7Q A;  1LZJ A;  4ECM A;  2XWL A;  5C1L A;  3OH3 A;  2ZU7 A;  4MIX A;  1ON8 A;  1R7V A;  1GQ9 A;  3R2W A;  1VGT A;  4EE5 A;  3V90 A;  2FYA A;  2BO6 A;  2Y4M A;  5FTS A;  5C4B A;  1LL2 A;  4G3Q A;  3CKN A;  1ZHJ A;  2D0J A;  4NAN A;  3CKO A;  2VSI A;  2OI6 A;  1NKH B;  5C38 A;  5D91 A;  4CJC A;  4LW3 A;  4AC3 A;  1HM9 A;  2O1F A;  4CJB A;  2ICY A;  2WGZ A;  4B4M A;  1EZI A;  3KIA A;  1FOA A;  1O0R A;  1VGZ A;  1VZU A;  1I52 A;  5C48 A;  5DDT A;  1FRW A;  1ZJ0 A;  2UX8 A;  3PKP A;  4EEM A;  5C4C A;  5EIY A;  5FU8 A;  4E1K A;  2ZU9 A;  3TQD A;  3HL3 A;  3SX3 A;  4AAW A;  2YC5 A;  1H7H A;  4KNR A;  2OI5 A;  3EE5 A;  2JCK A;  1O7Q A;  1O23 B;  3JUK A;  4Y7V A;  3ZLK A;  2Y6P A;  2ZU8 A;  1H5R B;  3V0M A;  2XMH A;  2YQC A;  3DJ4 A;  4ARW A;  4KNX A;  3SXG A;  3OH2 A;  3TZT A;  4NAL A;  3JUJ A;  5IDS A;  1R7X A;  5C4F A;  1ZI4 A;  2BO7 A;  2WE9 A;  2I5E A;  1YP4 A;  4KXO A;  4B2X A;  4MND A;  4YS8 A;  3PNN A;  4ASJ A;  1FR9 A;  4G3P A;  3F1C A;  3V0Q A;  1TZF A;  1JYK A;  1G9R A;  3CKQ A;  5C36 A;  5FUH A;  1IIM A;  4BQH A;  1SS9 A;  3I0J A;  3T7N A;  1GA8 A;  1XHB A;  3Q7U A;  3JTJ A;  2JCL A;  1H7L A;  2E3D A;  1FXO A;  4HO0 A;  1H4C A;  4HO2 A;  2AM4 A;  3SXE A;  2XWN A;  3NGW A;  1MP4 A;  2QH5 A;  4FCU A;  5DDV A;  4JIS A;  5C4D A;  2NXV A;  3BRK X;  1LL0 A;  2QKX A;  3V8Y A;  2J0A A;  4Y63 A;  5AJO A;  4FRP A;  4Y7U A;  1FXJ A;  1GWV A;  3RMV A;  3CGX A;  2BO8 A;  2WEE A;  4Y7T A;  1YP3 A;  1H5R A;  2Z87 A;  1ON6 A;  1ZCV A;  1LZI A;  2VK9 A;  2AE7 A;  4B4G A;  1JV1 A;  3I0G A;  2V0H A;  4EE3 A;  1W55 A;  2V0L A;  3K8E A;  4FRB A;  4G3S A;  2O1H A;  3SX5 A;  1R81 A;  3OKR A;  4C2S A;  1H7G A;  5CQL X;  2E8B A;  4LW6 A;  4FRM A;  1WSZ A;  1ZJ1 A;  3IOI A;  4FRL A;  1QG8 A;  2VXM A;  4HO8 A;  3ZLL A;  1TVY A;  4B42 A;  3U2U A;  1OMZ A;  4B5B A;  1ZI1 A;  1HJJ A;  3OGZ A;  2YQH A;  2PGV A;  4FIX A;  1ZI5 A;  4O6M A;  1VPA A;  2W0W A;  3I0C A;  1W57 A;  3SPT A;  4HO9 A;  1V82 A;  2WVK A;  3GUE A;  1G93 A;  4NAK A;  2WAW A;  4P02 A;  5FYE A;  3U2T A;  2FFU A;  5C4E A;  2J0B A;  2A8W A;  2VSH A;  2Q4J A;  1MP5 A;  4KRV A;  1WT2 A;  1NHE B;  3CKJ A;  2GGQ A;  3V0N A;  4KT7 A;  1GWW A;  3V0L A;  1W77 A;  1LZ0 A;  1ZCY A;  4Y6U A;  5AJN A;  1G8O A;  3OH1 A;  4CJ8 A;  1ZJ3 A;  5CMH A;  3I0H A;  4JD0 A;  2VFZ A;  4FIY A;  5L6V A;  1LZ7 A;  2XWM A;  4FQW A;  1PZT A;  2YCM A;  5C3B A;  4HG6 A;  1ZJO A;  1V83 A;  2WVM A;  3CKV A;  5IFY A;  4G87 A;  3F1Y A;  1K4V A;  1KWS A;  1ZI3 A;  2RIT A;  2A8U A;  4ASY A;  3USQ A;  1R80 A;  2MZB A;  4IRQ A;  5FU0 A;  3DUV A;  2VD4 A;  1EYR A;  4NAI A;  1H4E A;  1MP3 A;  2Z86 A;  1ZJ2 A;  4HO4 A;  2FYB A;  3V0P A;  2AM5 A;  5D92 A;  3ZGG A;  2X5Z A;  2RJ8 A;  4Y9X A;  4B3U A;  2Y4K A;  4XWI A;  2FFV A;  3OH4 A;  1LVW A;  3SXC A;  3FOQ A;  4EVW A;  1G2V A;  1NQI B;  4P00 A;  2AEC A;  4EEG A;  1GX4 A;  2OI7 A;  2X60 A;  5CMI A;  1E5K A;  5CQO A;  1H7F A;  2P72 A;  5C3A A;  5BXC A;  2RJ9 A;  2RIY A;  1VZX A;  4AYL A;  1PZY B;  5IDT A;  1HM0 A;  1QGS A;  3I0K A;  3OC9 A;  1G23 A;  3IOJ A;  1ZJP A;  1H5S B;  2P73 A;  1FR8 A;  1NMM B;  4Y62 A;  1V84 A;  1R7U A;  3V8Z A;  1FGX A;  2XME A;  3DK5 A;  5C1G A;  1FG5 N;  2OEF A;  3O3P A;  4MYB A;  1ZCU A;  3OH0 A;  2AM3 A;  4KPZ A;  1JYL A;  4EEO A;  1G97 A;  1HJL A;  4EE4 A;  4DE7 A;  1WVC A;  2RJ1 A;  1R7T A;  1S4N A;  2JCJ A;  5C1H A;  5EJ1 A;  4UEG A;  4Y7F A;  1TW1 A;  3ST8 A;  5J49 A;  2RIX A;  4KPX A;  4GBP A;  2YES A;  2OEG A;  5L6S A;  3RSB A;  2AGD A;  1H5T B;  1FWY A;  2D7R A;  3LW6 A;  1ZDF A;  1OMX A;  1O7O A;  4B4B A;  4KC4 A;  1H5S C;  5C47 A;  4HCQ A;  4FRA A;  1WT1 A;  5FV9 A;  2I5K A;  2ICX A;  1GQC A;  1NWG B;  2JCO A;  1HM8 A;  2BO4 A;  4DEC A;  2PA4 A;  1OQM B;  2PX7 A;  3T7O A;  2X5S A;  4FRD A;  1H5S D;  3U2V A;  2CU2 A;  2I7B A;  2Y7A A;  4K6R A;  4J18 A;  1FZW A;  1R82 A;  2D7I A;  2V0K A;  3U0X A;  2Y4L A;  2YQS A;  4AYJ A;  1XZ6 A;  2FYC B;  3Q4S A;  1H5S A;  4Y7G A;  1VH3 A;  1QGQ A;  3QVB A;  4HO5 A;  4CVH A;  1VGU A;  3D8V A;  2O1G A;  4FCE A;  1YP2 A;  3U2W A;  1Z90 A;  4KC1 A;  3T7M A;  3V91 A;  1FO8 A;  4KQL A;  2QGI A;  2RJ5 A;  4Y6N A;  4D11 C;  3U0Y A;  3ZGF A;  1JVD A;  2W0V A;  1VZT A;  2FYD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...