1FO8A

Crystal structure of n-acetylglucosaminyltransferase i
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
343
structure length
330
Chain Sequence
LAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-ACETYLGLUCOSAMINY
publication title X-ray crystal structure of rabbit N-acetylglucosaminyltransferase I: catalytic mechanism and a new protein superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 111
structure length 330
sequence length 343
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2000-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 1fo8A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1fo8A01
2XWMA 3D8VA 3ZF8A 3TZTA 2V0JA 2NXVA 5AJOA 2A8UA 1O0RA 4Y7TA 2QH5A 2BO8A 2V0LA 1H7TA 1K4VA 1VH3A 1JV3A 2RJ6A 4J18A 2RIXA 2X5SA 3IOJA 1H7GA 1WT3A 4Y6NA 4C2SA 5C3AA 2Y7AA 4P02A 2V0HA 1I52A 1WT1A 5FTVA 4MYBA 4G3QA 2AM4A 5CQNX 5C3DA 3I0KA 4P00A 5J49A 5CMGX 1MP5A 1YP2A 4D0TA 4EVWA 5EJ1A 4YS8A 1VZXA 4B4BA 5IDTA 4AYJA 4E1KA 1ZCYA 1XHBA 1HJLA 1V84A 4IRQA 3I0DA 1VGUA 5CQPA 3U2TA 2PGVA 4NAKA 3OH2A 1G97A 4FRDA 1Z90A 1XZ6A 3Q4SA 3CKOA 3PKQA 2RIYA 4UEGA 1FO8A 5FYEA 5C4DA 2VXMA 2RJ8A 4B2XA 5C4BA 1R7TA 1H3MA 2VSIA 1WT2A 4L41C 4BQHA 1H5TA 3K8EA 5BXCA 1S4OA 3I0JA 4KQLA 1R82A 1FGGA 4FRHA 2V0KA 2JCKA 1EZIA 2RJ7A 1JVGA 5FTSA 4HO4A 5C36A 4HO3A 5C1GA 1S4NA 5JQQA 2XMHA 1EYRA 1R7YA 2V0IA 2JCOA 1ZCUA 1FO9A 2P73A 1NKHB 3T7MA 4FRPA 5CMJA 1VH1A 2YQJA 5L6SA 4M28A 3V0NA 4LW3A 4Y6UA 1ON8A 4FCEA 2W0WA 1YROB 1ZJ0A 2D7IA 1OMZA 4LW6A 1ON6A 1H7HA 3U0YA 5C8RA 3E26A 1HM9A 3SX8A 3V0PA 2VD4A 1V82A 1W77A 4ECMA 2ICXA 2FFVA 2Y4MA 4NALA 1IIMA 4AAWA 5C4FA 1O7OA 3FWWA 4IRPA 2WAWA 2E3DA 4GBPA 4EE3A 2Y4LA 1ZCVA 1VICA 1JV1A 3LW6A 2QGIA 4ARWA 1R81A 2WVKA 1S4PA 5EIYA 1V83A 2OI7A 1H5TB 2E8BA 2ZU7A 3I0GA 1FGXA 4G3PA 4CJCA 1IINA 4HG6A 1GQCA 1GQ9A 1FG5N 3V90A 2O1GA 3ZGFA 4KC1A 3DK5A 3U2XA 3DJ4A 2XWNA 3Q7UA 2AECA 3SXEA 4HCQA 3RMVA 4ZDQA 4FRAA 1GWWA 1HV9A 5HS2A 1ZIZA 4B5BA 5IFYA 3U2UA 2RJ4A 1G23A 2A8WA 2Y4KA 1H7QA 1VGZA 1ZI4A 4G3SA 1ZCTA 3E25A 4HO6A 4M2BA 3U0XA 3I0CA 2YC3A 2APCA 5FUHA 4EE4A 1R7UA 1ZJOA 2QKXA 3I0FA 3I0HA 2P72A 4HO0A 4K6RA 2GGOA 4EEOA 1FXOA 4HO2A 1PZYB 2P6WA 3POLA 1GA8A 1VPAA 1VM8A 1O23B 1SS9A 2AH9A 3BRKX 3OH3A 3OH0A 2VS5A 3JUKA 4D11A 2PA4A 2OI6A 3I0IX 4EE5A 1GX4A 1WSZA 2RJ1A 2PGYA 3F1YA 2I5KA 1INIA 1INJA 1LZ0A 2VS3A 1QG8A 1ZJ2A 1H5RB 4D0ZA 2Y6PA 4G87A 4MNDA 2FFUA 4D11C 1FRWA 3N9WA 4HO9A 2PX7A 1TZFA 4FQWA 1NF5B 1FXJA 5IDSA 2BO4A 3D5NA 3OH1A 5CQLX 1QGQA 4NANA 1TW1A 1G0RA 1LZ7A 3CKVA 3I0LA 2OEGA 2WEEA 5AJPA 2W0VA 2DPWA 1FR9A 3SXCA 5C1LA 2YESA 1GWVA 3V8YA 2VFZA 1MP3A 3SXDA 2JCJA 1QWJA 2RJ9A 1H5SD 5C47A 5C3BA 4KPZA 3V0MA 2FYCB 3TQDA 2GGQA 4B2WA 1VZTA 3CKNA 3OC9A 2Q4JA 4JD0A 4DDZA 1LL0A 1VZUA 2OI5A 5EJZA 3SPTA 2MZBA 1H7EA 1ZDGA 1R7XA 5FU0A 1JYLA 1ZDFA 3SX3A 4B42A 1G95A 3CKJA 3KIAA 1H4CA 4DE7A 5AJNA 1HM8A 1W55A 5DDTA 1E5KA 1ZI1A 4NAIA 3R3IA 4EEGA 4FCUA 2RIZA 2YQHA 2FY7A 1G3LA 3USRA 1TW5A 4XWIA 1WVCA 4Y62A 1H4DA 4FREA 4Y9XA 5C38A 1W57A 4CJ8A 4EEMA 4AC3A 2X5ZA 1H7FA 1MC3A 5FV9A 1HM0A 3CU0A 2YCMA 3SX7A 2AESA 3V8ZA 3OH4A 4CJBA 5CQMX 4Y7VA 4M2AA 1LZJA 1HJJA 2X60A 3D98A 2Y4JA 1H4EA 1H5SA 4EEAA 1ZJPA 3ZGGA 2CU2A 4HO8A 4JISA 3SXGA 4FRBA 3RSBA 3I0EA 2FYBA 2ZU8A 4KNXA 1R80A 4KXOA 5CMFX 2WVLA 3SXBA 2I7BA 2BO6A 4B4GA 1H5SC 2UX8A 2AM5A 1H7LA 2BO7A 1LL2A 4KC2A 4M4KA 5C1HA 1ZHJA 3OAMA 3DUVA 3V0LA 1ZI3A 3O3PA 1NMMB 5C4EA 4KPXA 1JYKA 3BCVA 4FROA 3JUJA 2AM3A 5CMIA 5C4CA 3T7OA 3IOHA 4AYLA 3PNNA 2YQSA 3SX5A 3K8DA 4BMAA 2D0JA 1G2VA 2ICYA 1LVWA 3U2WA 4HOCA 1KWSA 1YP3A 1ZJ3A 4B3UA 4KT7A 4KNRA 4CVHA 2VXLA 1G93A 2YQCA 5FU8A 3R2WA 5C49A 1G8OA 3EE5A 1FR8A 3Q80A 2WGZA 3ZLLA 1VGTA 2O1FA 3U2VA 3NGWA 1FZWA 1ZI5A 1QGSA 1WT0A 2I5EA 3V0OA 3V0QA 4KRVA 1NQIB 2RJ5A 2XMEA 2VSHA 4KC4A 2JCLA 1FOAA 3OKRA 4FRQA 2O1HA 4Y7GA 1G9RA 1H5SB 4HO5A 4Y7FA 5DDVA 3RMWA 3JTJA 1OMXA 3ST8A 5C48A 1R7VA 1VGWA 2AE7A 3GUEA 4Y7UA 5CMHA 3HL3A 3OGZA 2RITA 2FYDB 4FRMA 2WE9A 1ZJ1A 2Z86A 4FRLA 1PZTA 3USQA 1JVDA 1LL3A 2VS4A 4ASYA 4DECA 5I1FA 2RJ0A 2ZU9A 1GX0A 4ASJA 1MP4A 3QVBA 2X65A 1NHEB 3CKQA 4Y63A 1OQMB 2OEFA 2FYAA 3T7NA 3ZLKA 3SXAA 2D7RA 1FWYA 4Y64A 3V91A 1LZIA 3IOIA 3PKPA 2XWLA 4B4MA 3FOQA 2WVMA 2Z87A 2AGDA 1H5RA 4R7PA 1O7QA 1G1LA 2YC5A 1TVYA 5CQOA 1NWGB 1YP4A 3CGXA 4D48A 3F1CA 5L6VA
chains in the Genus database with same CATH superfamily
4O6NA 2R5VA 3LM4A 2XWMA 2RBBA 3D8VA 3ZF8A 3TZTA 2V0JA 2NXVA 5AJOA 2PJSA 4Z04A 2A8UA 3G12A 1O0RA 4Y7TA 2QH5A 2BO8A 2V0LA 1H7TA 1K4VA 1VH3A 1JV3A 4FIYA 4NAYA 1QTOA 2RJ6A 1NIQB 1R9CA 2RIXA 2X5SA 3IOJA 1H7GA 4J18A 1WT3A 1U6LA 4Y6NA 4C2SA 5C3AA 3OULA 3IUZA 2Y7AA 4P02A 1K4NA 2V0HA 1I52A 1WT1A 2ZA0A 5FTVA 4GHHA 4MYBA 4G3QA 2AM4A 5CQNX 5C3DA 3ZW5A 3OPYB 3I0KA 1BYLA 4P00A 5J49A 5CMGX 1MP5A 1YP2A 1LQOA 4D0TA 4EVWA 5EJ1A 4YS8A 1FA5A 1VZXA 4B4BA 5IDTA 4AYJA 4E1KA 1MH6A 1ZCYA 1XHBA 1HJLA 1V84A 4IRQA 3I0DA 4JD1A 1VGUA 2ZYQA 5CQPA 3U2TA 2PGVA 4NAKA 3OH2A 1G97A 3ECJA 2J0AA 4FRDA 1Z90A 1XZ6A 3Q4SA 3CKOA 4Q7CA 3PKQA 5BWGA 2RIYA 1NKIA 4UEGA 1FO8A 5FYEA 5C4DA 2VXMA 4NVSA 2RJ8A 4B2XA 5C4BA 1R7TA 4RT5A 1H3MA 1EWJA 2VSIA 1WT2A 4L41C 4BQHA 4Z6LA 1XQAA 1H5TA 3K8EA 5BXCA 1S4OA 1TG5A 3I0JA 4KQLA 4LQBA 1R82A 1FGGA 4JH8A 4FRHA 2V0KA 2JCKA 1EZIA 2RJ7A 1JVGA 5FTSA 4HO4A 5C36A 4HO3A 5C1GA 1FA7A 1S4NA 3OXHA 3OJTA 2ZI8A 4GHFA 1JIEA 5JQQA 3OJKA 2XMHA 1EYRA 2ZW6A 1R7YA 3OJJA 2V0IA 1LKDA 2JCOA 1ZCUA 1FO9A 3ZGJA 2P73A 5BWHA 1NKHB 3T7MA 4FRPA 5CMJA 1VH1A 2YQJA 3PKVA 4KYHA 4M28A 4LW3A 4Z6NA 3V0NA 5L6SA 4GHCA 4Y6UA 1ON8A 4FCEA 2W0WA 1YROB 1ZJ0A 2D7IA 1OMZA 2P25A 3HPVA 4LW6A 1ON6A 1H7HA 3HQ0A 3U0YA 2P7LA 5C8RA 3E26A 1HM9A 4JH7A 3SX8A 3V0PA 2VD4A 1V82A 3SK2A 1W77A 2ICXA 2FFVA 2Y4MA 4NALA 2I7RA 4ECMA 1IIMA 3LHOA 4AAWA 5C4FA 2WL3A 1KMYA 3BQXA 1O7OA 3FWWA 4JH6A 4IRPA 2WAWA 2E3DA 4GBPA 1JIFA 4EE3A 2Y4LA 1KW3B 1ZCVA 1VICA 1JV1A 3LW6A 1CJXA 1F1VA 1FA6A 2QGIA 4Z6QA 4ARWA 1R81A 3ECKA 5D4FA 2WVKA 4Z6ZA 3R4QA 1S4PA 5EIYA 1NPBA 3ISQA 1LGTA 3PKXA 4IAGA 1V83A 2OI7A 1H5TB 2E8BA 2ZU7A 1Q0OA 3I0GA 1FGXA 4G3PA 4CJCA 1IINA 3E5DA 4HG6A 1GQCA 1GQ9A 1FG5N 3V90A 2RK9A 2O1GA 4KC1A 3DK5A 3ZGFA 1DHYA 3U2XA 3DJ4A 2XWNA 3Q7UA 2AECA 3SXEA 4HCQA 4MIXA 3RMVA 4ZDQA 4FRAA 1GWWA 1HV9A 4JH9A 1ZIZA 4B5BA 5HS2A 5IFYA 3U2UA 2RJ4A 1G23A 2A8WA 2Y4KA 1H7QA 3RMUA 1EIQA 1VGZA 2ZW4A 5DRHA 5C4PA 1ZI4A 4G3SA 4PV5A 1ZCTA 3E25A 4HO6A 4M2BA 3U0XA 1KMZA 5DFGA 3I0CA 2YC3A 2APCA 5FUHA 4EE4A 1R7UA 1ZJOA 2QKXA 3I0FA 3I0HA 2P72A 1KNDA 2P7QA 4HO0A 4K6RA 2GGOA 4EEOA 1FXOA 4HO2A 1PZYB 2P6WA 3POLA 1GA8A 1VPAA 1VM8A 4Z6PA 1SQIA 1JC5A 1O23B 1SS9A 3W0TA 2AH9A 3BRKX 3OH3A 3OH0A 2VS5A 3OAJA 3JUKA 4D11A 2PA4A 2OI6A 2ZW7A 1Q0CA 3I0IX 4EE5A 1GX4A 1WSZA 2RJ1A 2PGYA 3F1YA 1QIPA 4IR0A 2I5KA 1INIA 1INJA 1LZ0A 2VS3A 4MTTA 1QG8A 1T47A 1ZJ2A 1H5RB 4D0ZA 2Y6PA 4G87A 3EY8A 4MNDA 2FFUA 4D11C 4GYMA 4MYMA 1FRWA 3N9WA 5KEFA 2PX7A 4HO9A 1KW6B 1TZFA 4FQWA 1NF5B 1FXJA 5IDSA 4X2AA 3PKWA 2BO4A 3D5NA 3OH1A 3OJNA 5CQLX 1QGQA 4NANA 1TW1A 4O6MA 1G0RA 2P7PA 1LZ7A 3CKVA 3I0LA 2OEGA 3L7TA 4Z6RA 1ECSA 2WEEA 5AJPA 2W0VA 2DPWA 1FR9A 3SXCA 5C1LA 1ZSWA 1GWVA 2YESA 2VFZA 3V8YA 1MP3A 3SXDA 2JCJA 1SQDA 1QWJA 2RJ9A 1H5SD 5C47A 1KWBB 4KPZA 3V0MA 2FYCB 5C3BA 3TQDA 2GGQA 4B2WA 1VZTA 1F9ZA 3CKNA 3OC9A 2A4XA 2EI1A 2QH0A 3E0RA 2Q4JA 4JD0A 4DDZA 2R6UA 1LL0A 3L20A 1VZUA 2OI5A 4PAVA 1LQPA 4GHDA 5EJZA 3SPTA 2MZBA 1H7EA 1ZDGA 4G6XA 1R7XA 5FU0A 3CT8A 1JYLA 1ZDFA 3SX3A 4B42A 1G95A 3CKJA 3KIAA 5D92A 3FCDA 4Z6SA 1H4CA 2P7KA 4DE7A 5EC3A 4MTRA 5AJNA 1HM8A 1W55A 2RJBA 2VK9A 5DDTA 1E5KA 1ZI1A 4NAIA 3R3IA 2C21A 4EEGA 4FCUA 2RIZA 1MPYA 2YQHA 4Z6UA 2FY7A 1U69A 1G3LA 2A4WA 3USRA 1TW5A 4XWIA 1WVCA 4MTQA 4Y62A 1H4DA 1KW9B 1LQKA 4FREA 5D91A 2EI0A 4Y9XA 5C38A 4QB5A 1W57A 4CJ8A 4EEMA 3OA4A 4OPNA 4AC3A 2X5ZA 5C68A 4KYKA 1H7FA 1MC3A 5FV9A 1HM0A 3CU0A 2YCMA 5C6XA 3SX7A 2AESA 3V8ZA 3OH4A 4Z6OA 2IG9A 4CJBA 1HANA 4HC5A 5CQMX 4Y7VA 3W0UA 4M2AA 1LZJA 4NAZA 1HJJA 2X60A 3VW9A 3D98A 2Y4JA 3B59A 5D7ZA 1H4EA 1H5SA 4EEAA 1TSJA 1ZJPA 3ZGGA 5DHWA 3RRIA 2CU2A 1TWUA 4HO8A 1FA8A 2ZW5A 4JISA 3SXGA 4FRBA 3RSBA 3I0EA 3ZI1A 2FYBA 3HUHA 2ZU8A 4KNXA 1R80A 4KXOA 1KNFA 1KW8B 5CMFX 2J0BA 2WVLA 3SXBA 2I7BA 2BO6A 4B4GA 3VB0A 1H5SC 2UX8A 2AM5A 1H7LA 4FIXA 4Z6WA 2BO7A 1LL2A 4KC2A 1EILA 4M4KA 2RK0A 5C1HA 1ZHJA 2QQZA 3KOLA 3OAMA 1F1RA 3DUVA 3V0LA 1F1XA 3GHJA 1ZI3A 3HDPA 3O3PA 1NMMB 1FROA 5C4EA 2P7MA 4KPXA 1JYKA 3BCVA 4FROA 3JUJA 2AM3A 5CMIA 5C4CA 3T7OA 3EY7A 3IOHA 4AYLA 3PNNA 2YQSA 1XRKA 3SX5A 3K8DA 4BMAA 2D0JA 2C0NA 1G2VA 2ICYA 4JH2A 1LVWA 3U2WA 4JH3A 4Z6MA 1KWSA 4HOCA 5CTOA 1YP3A 4Z6TA 2Q48A 4N04A 4GHEA 2EI2A 5F6QA 1ZJ3A 4KT7A 4KNRA 4B3UA 4CVHA 2VXLA 1G93A 3GM5A 2YQCA 5FU8A 3R2WA 5C49A 1G8OA 4JH5A 1FR8A 3HPYA 3BZAA 3EE5A 3Q80A 2WGZA 3ZLLA 1VGTA 2O1FA 3U2VA 3NGWA 1FZWA 1ZI5A 1QGSA 1WT0A 2I5EA 3V0OA 4MTSA 3V0QA 4KRVA 1NQIB 2RJ5A 2ZHPA 2VSHA 2XMEA 4KC4A 2JCLA 1FOAA 1EIRA 3OKRA 4FRQA 2O1HA 4Y7GA 1JC4A 1G9RA 1H5SB 4HO5A 1SP9A 4GHGA 4Y7FA 5DDVA 3RMWA 3JTJA 1OMXA 3ST8A 5C48A 1R7VA 2EHZA 1VGWA 2AE7A 3GUEA 4Y7UA 3HL3A 5CMHA 2IGAA 3OGZA 5HCWA 2RITA 2FYDB 4FRMA 2WE9A 1ZJ1A 2Z86A 4FRLA 4JH1A 1PZTA 3USQA 3RHEA 1JVDA 1LL3A 2VS4A 4ASYA 4DECA 5I1FA 2RJ0A 2ZU9A 1GX0A 3OPYA 4NB0A 4ASJA 2EI3A 1MP4A 3QVBA 1KWCB 1SS4A 2X65A 1NHEB 1NNRA 3CKQA 2QNTA 4Y63A 1OQMB 3P8AA 5CJ3A 3OUMA 2OEFA 2FYAA 1TFZA 4JH4A 1F1UA 3T7NA 3R6AA 3ZLKA 3SXAA 2D7RA 4HUZA 1FWYA 1BH5A 1KLLA 4Y64A 3V91A 2P7OA 1LZIA 3IOIA 5CB9A 3PKPA 2XWLA 4B4MA 1QINA 3FOQA 1XY7A 2WVMA 4NB1A 2Z87A 2AGDA 4NB2A 1SP8A 1H5RA 4R7PA 1O7QA 1G1LA 2YC5A 4Z6VA 1TVYA 5CQOA 1NWGB 1YP4A 2WL9A 3CGXA 3HNQA 4D48A 3F1CA 5L6VA
chains in the Genus database with same CATH topology
4O6NA 2XWMA 3D8VA 3ZF8A 3TZTA 2V0JA 2NXVA 5AJOA 2A8UA 1O0RA 4Y7TA 2QH5A 2BO8A 2V0LA 1H7TA 1K4VA 1VH3A 1JV3A 4FIYA 2RJ6A 4J18A 2RIXA 2X5SA 3IOJA 1H7GA 1WT3A 4Y6NA 4C2SA 5C3AA 2Y7AA 4P02A 2V0HA 1I52A 1WT1A 5FTVA 4MYBA 4G3QA 2AM4A 5CQNX 5C3DA 3I0KA 4P00A 5J49A 5CMGX 1MP5A 1YP2A 4D0TA 4EVWA 5EJ1A 4YS8A 1VZXA 4B4BA 5IDTA 4AYJA 4E1KA 1ZCYA 1XHBA 1HJLA 1V84A 4IRQA 3I0DA 1VGUA 5CQPA 3U2TA 2PGVA 4NAKA 3OH2A 1G97A 2J0AA 4FRDA 1Z90A 1XZ6A 3Q4SA 3CKOA 4Q7CA 3PKQA 2RIYA 4UEGA 1FO8A 5FYEA 5C4DA 2VXMA 2RJ8A 4B2XA 5C4BA 1R7TA 1H3MA 2VSIA 1WT2A 4L41C 4BQHA 1H5TA 3K8EA 5BXCA 1S4OA 3I0JA 4KQLA 1R82A 1FGGA 4FRHA 2V0KA 2JCKA 1EZIA 2RJ7A 1JVGA 5FTSA 4HO4A 5C36A 4HO3A 5C1GA 1S4NA 5JQQA 2XMHA 1EYRA 1R7YA 2V0IA 2JCOA 1ZCUA 1FO9A 2P73A 1NKHB 3T7MA 4FRPA 5CMJA 1VH1A 2YQJA 5L6SA 4M28A 3V0NA 4LW3A 4Y6UA 1ON8A 4FCEA 2W0WA 1YROB 1ZJ0A 2D7IA 1OMZA 4LW6A 1ON6A 1H7HA 3U0YA 5C8RA 3E26A 1HM9A 3SX8A 3V0PA 2VD4A 1V82A 1W77A 4ECMA 2ICXA 2FFVA 2Y4MA 4NALA 1IIMA 4AAWA 5C4FA 1O7OA 3FWWA 4IRPA 2WAWA 2E3DA 4GBPA 4EE3A 2Y4LA 1ZCVA 1VICA 1JV1A 3LW6A 2QGIA 4ARWA 1R81A 2WVKA 1S4PA 5EIYA 1V83A 2OI7A 1H5TB 2E8BA 2ZU7A 3I0GA 1FGXA 4G3PA 4CJCA 1IINA 4HG6A 1GQCA 1GQ9A 1FG5N 3V90A 2O1GA 3ZGFA 4KC1A 3DK5A 3U2XA 3DJ4A 2XWNA 3Q7UA 2AECA 3SXEA 4HCQA 4MIXA 3RMVA 4ZDQA 4FRAA 1GWWA 1HV9A 5HS2A 1ZIZA 4B5BA 5IFYA 3U2UA 2RJ4A 1G23A 2A8WA 2Y4KA 1H7QA 1VGZA 1ZI4A 4G3SA 1ZCTA 3E25A 4HO6A 4M2BA 3U0XA 3I0CA 2YC3A 2APCA 5FUHA 4EE4A 1R7UA 1ZJOA 2QKXA 3I0FA 3I0HA 2P72A 4HO0A 4K6RA 2GGOA 4EEOA 1FXOA 4HO2A 1PZYB 2P6WA 3POLA 1GA8A 1VPAA 1VM8A 1O23B 1SS9A 2AH9A 3BRKX 3OH3A 3OH0A 2VS5A 3JUKA 4D11A 2PA4A 2OI6A 3I0IX 4EE5A 1GX4A 1WSZA 2RJ1A 2PGYA 3F1YA 2I5KA 1INIA 1INJA 1LZ0A 2VS3A 1QG8A 1ZJ2A 1H5RB 4D0ZA 2Y6PA 4G87A 4MNDA 2FFUA 4D11C 1FRWA 3N9WA 4HO9A 2PX7A 1TZFA 4FQWA 1NF5B 1FXJA 5IDSA 2BO4A 3D5NA 3OH1A 5CQLX 1QGQA 4NANA 1TW1A 4O6MA 1G0RA 1LZ7A 3CKVA 3I0LA 2OEGA 2WEEA 5AJPA 2W0VA 2DPWA 1FR9A 3SXCA 5C1LA 2YESA 1GWVA 3V8YA 2VFZA 1MP3A 3SXDA 2JCJA 1QWJA 2RJ9A 1H5SD 5C47A 5C3BA 4KPZA 3V0MA 2FYCB 3TQDA 2GGQA 4B2WA 1VZTA 3CKNA 3OC9A 2Q4JA 4JD0A 4DDZA 1LL0A 1VZUA 2OI5A 5EJZA 3SPTA 2MZBA 1H7EA 1ZDGA 1R7XA 5FU0A 1JYLA 1ZDFA 3SX3A 4B42A 1G95A 3CKJA 3KIAA 5D92A 1H4CA 4DE7A 5AJNA 1HM8A 1W55A 5DDTA 2VK9A 1E5KA 1ZI1A 4NAIA 3R3IA 4EEGA 4FCUA 2RIZA 2YQHA 2FY7A 1G3LA 3USRA 1TW5A 4XWIA 1WVCA 4Y62A 1H4DA 4FREA 5D91A 4Y9XA 5C38A 1W57A 4CJ8A 4EEMA 4AC3A 2X5ZA 1H7FA 1MC3A 5FV9A 1HM0A 3CU0A 2YCMA 3SX7A 2AESA 3V8ZA 3OH4A 4CJBA 5CQMX 4Y7VA 4M2AA 1LZJA 1HJJA 2X60A 3D98A 2Y4JA 1H4EA 1H5SA 4EEAA 1ZJPA 3ZGGA 2CU2A 4HO8A 4JISA 3SXGA 4FRBA 3RSBA 3I0EA 2FYBA 2ZU8A 4KNXA 1R80A 4KXOA 5CMFX 2J0BA 2WVLA 3SXBA 2I7BA 2BO6A 4B4GA 1H5SC 2UX8A 2AM5A 1H7LA 4FIXA 2BO7A 1LL2A 4KC2A 4M4KA 5C1HA 1ZHJA 3OAMA 3DUVA 3V0LA 1ZI3A 3O3PA 1NMMB 5C4EA 4KPXA 1JYKA 3BCVA 4FROA 3JUJA 2AM3A 5CMIA 5C4CA 3T7OA 3IOHA 4AYLA 3PNNA 2YQSA 3SX5A 3K8DA 4BMAA 2D0JA 2C0NA 1G2VA 2ICYA 1LVWA 3U2WA 4HOCA 1KWSA 1YP3A 1ZJ3A 4B3UA 4KT7A 4KNRA 4CVHA 2VXLA 1G93A 2YQCA 5FU8A 3R2WA 5C49A 1G8OA 3EE5A 1FR8A 3Q80A 2WGZA 3ZLLA 1VGTA 2O1FA 3U2VA 3NGWA 1FZWA 1ZI5A 1QGSA 1WT0A 2I5EA 3V0OA 3V0QA 4KRVA 1NQIB 2RJ5A 2XMEA 2VSHA 4KC4A 2JCLA 1FOAA 3OKRA 4FRQA 2O1HA 4Y7GA 1G9RA 1H5SB 4HO5A 4Y7FA 5DDVA 3RMWA 3JTJA 1OMXA 3ST8A 5C48A 1R7VA 1VGWA 2AE7A 3GUEA 4Y7UA 5CMHA 3HL3A 3OGZA 2RITA 2FYDB 4FRMA 2WE9A 1ZJ1A 2Z86A 4FRLA 1PZTA 3USQA 1JVDA 1LL3A 2VS4A 4ASYA 4DECA 5I1FA 2RJ0A 2ZU9A 1GX0A 4ASJA 1MP4A 3QVBA 2X65A 1NHEB 3CKQA 4Y63A 1OQMB 2OEFA 2FYAA 3T7NA 3ZLKA 3SXAA 2D7RA 1FWYA 4Y64A 3V91A 1LZIA 3IOIA 3PKPA 2XWLA 4B4MA 3FOQA 2WVMA 2Z87A 2AGDA 1H5RA 4R7PA 1O7QA 1G1LA 2YC5A 1TVYA 5CQOA 1NWGB 1YP4A 3CGXA 4D48A 3F1CA 5L6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWM A;  3D8V A;  3ZF8 A;  3TZT A;  2V0J A;  2NXV A;  5AJO A;  2A8U A;  1O0R A;  4Y7T A;  2QH5 A;  2BO8 A;  2V0L A;  1H7T A;  1K4V A;  1VH3 A;  1JV3 A;  2RJ6 A;  4J18 A;  2RIX A;  2X5S A;  3IOJ A;  1H7G A;  1WT3 A;  4Y6N A;  4C2S A;  5C3A A;  2Y7A A;  4P02 A;  2V0H A;  1I52 A;  1WT1 A;  5FTV A;  4MYB A;  4G3Q A;  2AM4 A;  5CQN X;  5C3D A;  3I0K A;  4P00 A;  5J49 A;  5CMG X;  1MP5 A;  1YP2 A;  4D0T A;  4EVW A;  5EJ1 A;  4YS8 A;  1VZX A;  4B4B A;  5IDT A;  4AYJ A;  4E1K A;  1ZCY A;  1XHB A;  1HJL A;  1V84 A;  4IRQ A;  3I0D A;  1VGU A;  5CQP A;  3U2T A;  2PGV A;  4NAK A;  3OH2 A;  1G97 A;  4FRD A;  1Z90 A;  1XZ6 A;  3Q4S A;  3CKO A;  3PKQ A;  2RIY A;  4UEG A;  1FO8 A;  5FYE A;  5C4D A;  2VXM A;  2RJ8 A;  4B2X A;  5C4B A;  1R7T A;  1H3M A;  2VSI A;  1WT2 A;  4L41 C;  4BQH A;  1H5T A;  3K8E A;  5BXC A;  1S4O A;  3I0J A;  4KQL A;  1R82 A;  1FGG A;  4FRH A;  2V0K A;  2JCK A;  1EZI A;  2RJ7 A;  1JVG A;  5FTS A;  4HO4 A;  5C36 A;  4HO3 A;  5C1G A;  1S4N A;  5JQQ A;  2XMH A;  1EYR A;  1R7Y A;  2V0I A;  2JCO A;  1ZCU A;  1FO9 A;  2P73 A;  1NKH B;  3T7M A;  4FRP A;  5CMJ A;  1VH1 A;  2YQJ A;  5L6S A;  4M28 A;  3V0N A;  4LW3 A;  4Y6U A;  1ON8 A;  4FCE A;  2W0W A;  1YRO B;  1ZJ0 A;  2D7I A;  1OMZ A;  4LW6 A;  1ON6 A;  1H7H A;  3U0Y A;  5C8R A;  3E26 A;  1HM9 A;  3SX8 A;  3V0P A;  2VD4 A;  1V82 A;  1W77 A;  4ECM A;  2ICX A;  2FFV A;  2Y4M A;  4NAL A;  1IIM A;  4AAW A;  5C4F A;  1O7O A;  3FWW A;  4IRP A;  2WAW A;  2E3D A;  4GBP A;  4EE3 A;  2Y4L A;  1ZCV A;  1VIC A;  1JV1 A;  3LW6 A;  2QGI A;  4ARW A;  1R81 A;  2WVK A;  1S4P A;  5EIY A;  1V83 A;  2OI7 A;  1H5T B;  2E8B A;  2ZU7 A;  3I0G A;  1FGX A;  4G3P A;  4CJC A;  1IIN A;  4HG6 A;  1GQC A;  1GQ9 A;  1FG5 N;  3V90 A;  2O1G A;  3ZGF A;  4KC1 A;  3DK5 A;  3U2X A;  3DJ4 A;  2XWN A;  3Q7U A;  2AEC A;  3SXE A;  4HCQ A;  3RMV A;  4ZDQ A;  4FRA A;  1GWW A;  1HV9 A;  5HS2 A;  1ZIZ A;  4B5B A;  5IFY A;  3U2U A;  2RJ4 A;  1G23 A;  2A8W A;  2Y4K A;  1H7Q A;  1VGZ A;  1ZI4 A;  4G3S A;  1ZCT A;  3E25 A;  4HO6 A;  4M2B A;  3U0X A;  3I0C A;  2YC3 A;  2APC A;  5FUH A;  4EE4 A;  1R7U A;  1ZJO A;  2QKX A;  3I0F A;  3I0H A;  2P72 A;  4HO0 A;  4K6R A;  2GGO A;  4EEO A;  1FXO A;  4HO2 A;  1PZY B;  2P6W A;  3POL A;  1GA8 A;  1VPA A;  1VM8 A;  1O23 B;  1SS9 A;  2AH9 A;  3BRK X;  3OH3 A;  3OH0 A;  2VS5 A;  3JUK A;  4D11 A;  2PA4 A;  2OI6 A;  3I0I X;  4EE5 A;  1GX4 A;  1WSZ A;  2RJ1 A;  2PGY A;  3F1Y A;  2I5K A;  1INI A;  1INJ A;  1LZ0 A;  2VS3 A;  1QG8 A;  1ZJ2 A;  1H5R B;  4D0Z A;  2Y6P A;  4G87 A;  4MND A;  2FFU A;  4D11 C;  1FRW A;  3N9W A;  4HO9 A;  2PX7 A;  1TZF A;  4FQW A;  1NF5 B;  1FXJ A;  5IDS A;  2BO4 A;  3D5N A;  3OH1 A;  5CQL X;  1QGQ A;  4NAN A;  1TW1 A;  1G0R A;  1LZ7 A;  3CKV A;  3I0L A;  2OEG A;  2WEE A;  5AJP A;  2W0V A;  2DPW A;  1FR9 A;  3SXC A;  5C1L A;  2YES A;  1GWV A;  3V8Y A;  2VFZ A;  1MP3 A;  3SXD A;  2JCJ A;  1QWJ A;  2RJ9 A;  1H5S D;  5C47 A;  5C3B A;  4KPZ A;  3V0M A;  2FYC B;  3TQD A;  2GGQ A;  4B2W A;  1VZT A;  3CKN A;  3OC9 A;  2Q4J A;  4JD0 A;  4DDZ A;  1LL0 A;  1VZU A;  2OI5 A;  5EJZ A;  3SPT A;  2MZB A;  1H7E A;  1ZDG A;  1R7X A;  5FU0 A;  1JYL A;  1ZDF A;  3SX3 A;  4B42 A;  1G95 A;  3CKJ A;  3KIA A;  1H4C A;  4DE7 A;  5AJN A;  1HM8 A;  1W55 A;  5DDT A;  1E5K A;  1ZI1 A;  4NAI A;  3R3I A;  4EEG A;  4FCU A;  2RIZ A;  2YQH A;  2FY7 A;  1G3L A;  3USR A;  1TW5 A;  4XWI A;  1WVC A;  4Y62 A;  1H4D A;  4FRE A;  4Y9X A;  5C38 A;  1W57 A;  4CJ8 A;  4EEM A;  4AC3 A;  2X5Z A;  1H7F A;  1MC3 A;  5FV9 A;  1HM0 A;  3CU0 A;  2YCM A;  3SX7 A;  2AES A;  3V8Z A;  3OH4 A;  4CJB A;  5CQM X;  4Y7V A;  4M2A A;  1LZJ A;  1HJJ A;  2X60 A;  3D98 A;  2Y4J A;  1H4E A;  1H5S A;  4EEA A;  1ZJP A;  3ZGG A;  2CU2 A;  4HO8 A;  4JIS A;  3SXG A;  4FRB A;  3RSB A;  3I0E A;  2FYB A;  2ZU8 A;  4KNX A;  1R80 A;  4KXO A;  5CMF X;  2WVL A;  3SXB A;  2I7B A;  2BO6 A;  4B4G A;  1H5S C;  2UX8 A;  2AM5 A;  1H7L A;  2BO7 A;  1LL2 A;  4KC2 A;  4M4K A;  5C1H A;  1ZHJ A;  3OAM A;  3DUV A;  3V0L A;  1ZI3 A;  3O3P A;  1NMM B;  5C4E A;  4KPX A;  1JYK A;  3BCV A;  4FRO A;  3JUJ A;  2AM3 A;  5CMI A;  5C4C A;  3T7O A;  3IOH A;  4AYL A;  3PNN A;  2YQS A;  3SX5 A;  3K8D A;  4BMA A;  2D0J A;  1G2V A;  2ICY A;  1LVW A;  3U2W A;  4HOC A;  1KWS A;  1YP3 A;  1ZJ3 A;  4B3U A;  4KT7 A;  4KNR A;  4CVH A;  2VXL A;  1G93 A;  2YQC A;  5FU8 A;  3R2W A;  5C49 A;  1G8O A;  3EE5 A;  1FR8 A;  3Q80 A;  2WGZ A;  3ZLL A;  1VGT A;  2O1F A;  3U2V A;  3NGW A;  1FZW A;  1ZI5 A;  1QGS A;  1WT0 A;  2I5E A;  3V0O A;  3V0Q A;  4KRV A;  1NQI B;  2RJ5 A;  2XME A;  2VSH A;  4KC4 A;  2JCL A;  1FOA A;  3OKR A;  4FRQ A;  2O1H A;  4Y7G A;  1G9R A;  1H5S B;  4HO5 A;  4Y7F A;  5DDV A;  3RMW A;  3JTJ A;  1OMX A;  3ST8 A;  5C48 A;  1R7V A;  1VGW A;  2AE7 A;  3GUE A;  4Y7U A;  5CMH A;  3HL3 A;  3OGZ A;  2RIT A;  2FYD B;  4FRM A;  2WE9 A;  1ZJ1 A;  2Z86 A;  4FRL A;  1PZT A;  3USQ A;  1JVD A;  1LL3 A;  2VS4 A;  4ASY A;  4DEC A;  5I1F A;  2RJ0 A;  2ZU9 A;  1GX0 A;  4ASJ A;  1MP4 A;  3QVB A;  2X65 A;  1NHE B;  3CKQ A;  4Y63 A;  1OQM B;  2OEF A;  2FYA A;  3T7N A;  3ZLK A;  3SXA A;  2D7R A;  1FWY A;  4Y64 A;  3V91 A;  1LZI A;  3IOI A;  3PKP A;  2XWL A;  4B4M A;  3FOQ A;  2WVM A;  2Z87 A;  2AGD A;  1H5R A;  4R7P A;  1O7Q A;  1G1L A;  2YC5 A;  1TVY A;  5CQO A;  1NWG B;  1YP4 A;  3CGX A;  4D48 A;  3F1C A;  5L6V A; 
#chains in the Genus database with same CATH topology
 4O6N A;  2R5V A;  3LM4 A;  2XWM A;  2RBB A;  3D8V A;  3ZF8 A;  3TZT A;  2V0J A;  2NXV A;  5AJO A;  2PJS A;  4Z04 A;  2A8U A;  3G12 A;  1O0R A;  4Y7T A;  2QH5 A;  2BO8 A;  2V0L A;  1H7T A;  1K4V A;  1VH3 A;  1JV3 A;  4FIY A;  4NAY A;  1QTO A;  2RJ6 A;  1NIQ B;  1R9C A;  2RIX A;  2X5S A;  3IOJ A;  1H7G A;  4J18 A;  1WT3 A;  1U6L A;  4Y6N A;  4C2S A;  5C3A A;  3OUL A;  3IUZ A;  2Y7A A;  4P02 A;  1K4N A;  2V0H A;  1I52 A;  1WT1 A;  2ZA0 A;  5FTV A;  4GHH A;  4MYB A;  4G3Q A;  2AM4 A;  5CQN X;  5C3D A;  3ZW5 A;  3OPY B;  3I0K A;  1BYL A;  4P00 A;  5J49 A;  5CMG X;  1MP5 A;  1YP2 A;  1LQO A;  4D0T A;  4EVW A;  5EJ1 A;  4YS8 A;  1FA5 A;  1VZX A;  4B4B A;  5IDT A;  4AYJ A;  4E1K A;  1MH6 A;  1ZCY A;  1XHB A;  1HJL A;  1V84 A;  4IRQ A;  3I0D A;  4JD1 A;  1VGU A;  2ZYQ A;  5CQP A;  3U2T A;  2PGV A;  4NAK A;  3OH2 A;  1G97 A;  3ECJ A;  2J0A A;  4FRD A;  1Z90 A;  1XZ6 A;  3Q4S A;  3CKO A;  4Q7C A;  3PKQ A;  5BWG A;  2RIY A;  1NKI A;  4UEG A;  1FO8 A;  5FYE A;  5C4D A;  2VXM A;  4NVS A;  2RJ8 A;  4B2X A;  5C4B A;  1R7T A;  4RT5 A;  1H3M A;  1EWJ A;  2VSI A;  1WT2 A;  4L41 C;  4BQH A;  4Z6L A;  1XQA A;  1H5T A;  3K8E A;  5BXC A;  1S4O A;  1TG5 A;  3I0J A;  4KQL A;  4LQB A;  1R82 A;  1FGG A;  4JH8 A;  4FRH A;  2V0K A;  2JCK A;  1EZI A;  2RJ7 A;  1JVG A;  5FTS A;  4HO4 A;  5C36 A;  4HO3 A;  5C1G A;  1FA7 A;  1S4N A;  3OXH A;  3OJT A;  2ZI8 A;  4GHF A;  1JIE A;  5JQQ A;  3OJK A;  2XMH A;  1EYR A;  2ZW6 A;  1R7Y A;  3OJJ A;  2V0I A;  1LKD A;  2JCO A;  1ZCU A;  1FO9 A;  3ZGJ A;  2P73 A;  5BWH A;  1NKH B;  3T7M A;  4FRP A;  5CMJ A;  1VH1 A;  2YQJ A;  3PKV A;  4KYH A;  4M28 A;  4LW3 A;  4Z6N A;  3V0N A;  5L6S A;  4GHC A;  4Y6U A;  1ON8 A;  4FCE A;  2W0W A;  1YRO B;  1ZJ0 A;  2D7I A;  1OMZ A;  2P25 A;  3HPV A;  4LW6 A;  1ON6 A;  1H7H A;  3HQ0 A;  3U0Y A;  2P7L A;  5C8R A;  3E26 A;  1HM9 A;  4JH7 A;  3SX8 A;  3V0P A;  2VD4 A;  1V82 A;  3SK2 A;  1W77 A;  2ICX A;  2FFV A;  2Y4M A;  4NAL A;  2I7R A;  4ECM A;  1IIM A;  3LHO A;  4AAW A;  5C4F A;  2WL3 A;  1KMY A;  3BQX A;  1O7O A;  3FWW A;  4JH6 A;  4IRP A;  2WAW A;  2E3D A;  4GBP A;  1JIF A;  4EE3 A;  2Y4L A;  1KW3 B;  1ZCV A;  1VIC A;  1JV1 A;  3LW6 A;  1CJX A;  1F1V A;  1FA6 A;  2QGI A;  4Z6Q A;  4ARW A;  1R81 A;  3ECK A;  5D4F A;  2WVK A;  4Z6Z A;  3R4Q A;  1S4P A;  5EIY A;  1NPB A;  3ISQ A;  1LGT A;  3PKX A;  4IAG A;  1V83 A;  2OI7 A;  1H5T B;  2E8B A;  2ZU7 A;  1Q0O A;  3I0G A;  1FGX A;  4G3P A;  4CJC A;  1IIN A;  3E5D A;  4HG6 A;  1GQC A;  1GQ9 A;  1FG5 N;  3V90 A;  2RK9 A;  2O1G A;  4KC1 A;  3DK5 A;  3ZGF A;  1DHY A;  3U2X A;  3DJ4 A;  2XWN A;  3Q7U A;  2AEC A;  3SXE A;  4HCQ A;  4MIX A;  3RMV A;  4ZDQ A;  4FRA A;  1GWW A;  1HV9 A;  4JH9 A;  1ZIZ A;  4B5B A;  5HS2 A;  5IFY A;  3U2U A;  2RJ4 A;  1G23 A;  2A8W A;  2Y4K A;  1H7Q A;  3RMU A;  1EIQ A;  1VGZ A;  2ZW4 A;  5DRH A;  5C4P A;  1ZI4 A;  4G3S A;  4PV5 A;  1ZCT A;  3E25 A;  4HO6 A;  4M2B A;  3U0X A;  1KMZ A;  5DFG A;  3I0C A;  2YC3 A;  2APC A;  5FUH A;  4EE4 A;  1R7U A;  1ZJO A;  2QKX A;  3I0F A;  3I0H A;  2P72 A;  1KND A;  2P7Q A;  4HO0 A;  4K6R A;  2GGO A;  4EEO A;  1FXO A;  4HO2 A;  1PZY B;  2P6W A;  3POL A;  1GA8 A;  1VPA A;  1VM8 A;  4Z6P A;  1SQI A;  1JC5 A;  1O23 B;  1SS9 A;  3W0T A;  2AH9 A;  3BRK X;  3OH3 A;  3OH0 A;  2VS5 A;  3OAJ A;  3JUK A;  4D11 A;  2PA4 A;  2OI6 A;  2ZW7 A;  1Q0C A;  3I0I X;  4EE5 A;  1GX4 A;  1WSZ A;  2RJ1 A;  2PGY A;  3F1Y A;  1QIP A;  4IR0 A;  2I5K A;  1INI A;  1INJ A;  1LZ0 A;  2VS3 A;  4MTT A;  1QG8 A;  1T47 A;  1ZJ2 A;  1H5R B;  4D0Z A;  2Y6P A;  4G87 A;  3EY8 A;  4MND A;  2FFU A;  4D11 C;  4GYM A;  4MYM A;  1FRW A;  3N9W A;  5KEF A;  2PX7 A;  4HO9 A;  1KW6 B;  1TZF A;  4FQW A;  1NF5 B;  1FXJ A;  5IDS A;  4X2A A;  3PKW A;  2BO4 A;  3D5N A;  3OH1 A;  3OJN A;  5CQL X;  1QGQ A;  4NAN A;  1TW1 A;  4O6M A;  1G0R A;  2P7P A;  1LZ7 A;  3CKV A;  3I0L A;  2OEG A;  3L7T A;  4Z6R A;  1ECS A;  2WEE A;  5AJP A;  2W0V A;  2DPW A;  1FR9 A;  3SXC A;  5C1L A;  1ZSW A;  1GWV A;  2YES A;  2VFZ A;  3V8Y A;  1MP3 A;  3SXD A;  2JCJ A;  1SQD A;  1QWJ A;  2RJ9 A;  1H5S D;  5C47 A;  1KWB B;  4KPZ A;  3V0M A;  2FYC B;  5C3B A;  3TQD A;  2GGQ A;  4B2W A;  1VZT A;  1F9Z A;  3CKN A;  3OC9 A;  2A4X A;  2EI1 A;  2QH0 A;  3E0R A;  2Q4J A;  4JD0 A;  4DDZ A;  2R6U A;  1LL0 A;  3L20 A;  1VZU A;  2OI5 A;  4PAV A;  1LQP A;  4GHD A;  5EJZ A;  3SPT A;  2MZB A;  1H7E A;  1ZDG A;  4G6X A;  1R7X A;  5FU0 A;  3CT8 A;  1JYL A;  1ZDF A;  3SX3 A;  4B42 A;  1G95 A;  3CKJ A;  3KIA A;  5D92 A;  3FCD A;  4Z6S A;  1H4C A;  2P7K A;  4DE7 A;  5EC3 A;  4MTR A;  5AJN A;  1HM8 A;  1W55 A;  2RJB A;  2VK9 A;  5DDT A;  1E5K A;  1ZI1 A;  4NAI A;  3R3I A;  2C21 A;  4EEG A;  4FCU A;  2RIZ A;  1MPY A;  2YQH A;  4Z6U A;  2FY7 A;  1U69 A;  1G3L A;  2A4W A;  3USR A;  1TW5 A;  4XWI A;  1WVC A;  4MTQ A;  4Y62 A;  1H4D A;  1KW9 B;  1LQK A;  4FRE A;  5D91 A;  2EI0 A;  4Y9X A;  5C38 A;  4QB5 A;  1W57 A;  4CJ8 A;  4EEM A;  3OA4 A;  4OPN A;  4AC3 A;  2X5Z A;  5C68 A;  4KYK A;  1H7F A;  1MC3 A;  5FV9 A;  1HM0 A;  3CU0 A;  2YCM A;  5C6X A;  3SX7 A;  2AES A;  3V8Z A;  3OH4 A;  4Z6O A;  2IG9 A;  4CJB A;  1HAN A;  4HC5 A;  5CQM X;  4Y7V A;  3W0U A;  4M2A A;  1LZJ A;  4NAZ A;  1HJJ A;  2X60 A;  3VW9 A;  3D98 A;  2Y4J A;  3B59 A;  5D7Z A;  1H4E A;  1H5S A;  4EEA A;  1TSJ A;  1ZJP A;  3ZGG A;  5DHW A;  3RRI A;  2CU2 A;  1TWU A;  4HO8 A;  1FA8 A;  2ZW5 A;  4JIS A;  3SXG A;  4FRB A;  3RSB A;  3I0E A;  3ZI1 A;  2FYB A;  3HUH A;  2ZU8 A;  4KNX A;  1R80 A;  4KXO A;  1KNF A;  1KW8 B;  5CMF X;  2J0B A;  2WVL A;  3SXB A;  2I7B A;  2BO6 A;  4B4G A;  3VB0 A;  1H5S C;  2UX8 A;  2AM5 A;  1H7L A;  4FIX A;  4Z6W A;  2BO7 A;  1LL2 A;  4KC2 A;  1EIL A;  4M4K A;  2RK0 A;  5C1H A;  1ZHJ A;  2QQZ A;  3KOL A;  3OAM A;  1F1R A;  3DUV A;  3V0L A;  1F1X A;  3GHJ A;  1ZI3 A;  3HDP A;  3O3P A;  1NMM B;  1FRO A;  5C4E A;  2P7M A;  4KPX A;  1JYK A;  3BCV A;  4FRO A;  3JUJ A;  2AM3 A;  5CMI A;  5C4C A;  3T7O A;  3EY7 A;  3IOH A;  4AYL A;  3PNN A;  2YQS A;  1XRK A;  3SX5 A;  3K8D A;  4BMA A;  2D0J A;  2C0N A;  1G2V A;  2ICY A;  4JH2 A;  1LVW A;  3U2W A;  4JH3 A;  4Z6M A;  1KWS A;  4HOC A;  5CTO A;  1YP3 A;  4Z6T A;  2Q48 A;  4N04 A;  4GHE A;  2EI2 A;  5F6Q A;  1ZJ3 A;  4KT7 A;  4KNR A;  4B3U A;  4CVH A;  2VXL A;  1G93 A;  3GM5 A;  2YQC A;  5FU8 A;  3R2W A;  5C49 A;  1G8O A;  4JH5 A;  1FR8 A;  3HPY A;  3BZA A;  3EE5 A;  3Q80 A;  2WGZ A;  3ZLL A;  1VGT A;  2O1F A;  3U2V A;  3NGW A;  1FZW A;  1ZI5 A;  1QGS A;  1WT0 A;  2I5E A;  3V0O A;  4MTS A;  3V0Q A;  4KRV A;  1NQI B;  2RJ5 A;  2ZHP A;  2VSH A;  2XME A;  4KC4 A;  2JCL A;  1FOA A;  1EIR A;  3OKR A;  4FRQ A;  2O1H A;  4Y7G A;  1JC4 A;  1G9R A;  1H5S B;  4HO5 A;  1SP9 A;  4GHG A;  4Y7F A;  5DDV A;  3RMW A;  3JTJ A;  1OMX A;  3ST8 A;  5C48 A;  1R7V A;  2EHZ A;  1VGW A;  2AE7 A;  3GUE A;  4Y7U A;  3HL3 A;  5CMH A;  2IGA A;  3OGZ A;  5HCW A;  2RIT A;  2FYD B;  4FRM A;  2WE9 A;  1ZJ1 A;  2Z86 A;  4FRL A;  4JH1 A;  1PZT A;  3USQ A;  3RHE A;  1JVD A;  1LL3 A;  2VS4 A;  4ASY A;  4DEC A;  5I1F A;  2RJ0 A;  2ZU9 A;  1GX0 A;  3OPY A;  4NB0 A;  4ASJ A;  2EI3 A;  1MP4 A;  3QVB A;  1KWC B;  1SS4 A;  2X65 A;  1NHE B;  1NNR A;  3CKQ A;  2QNT A;  4Y63 A;  1OQM B;  3P8A A;  5CJ3 A;  3OUM A;  2OEF A;  2FYA A;  1TFZ A;  4JH4 A;  1F1U A;  3T7N A;  3R6A A;  3ZLK A;  3SXA A;  2D7R A;  4HUZ A;  1FWY A;  1BH5 A;  1KLL A;  4Y64 A;  3V91 A;  2P7O A;  1LZI A;  3IOI A;  5CB9 A;  3PKP A;  2XWL A;  4B4M A;  1QIN A;  3FOQ A;  1XY7 A;  2WVM A;  4NB1 A;  2Z87 A;  2AGD A;  4NB2 A;  1SP8 A;  1H5R A;  4R7P A;  1O7Q A;  1G1L A;  2YC5 A;  4Z6V A;  1TVY A;  5CQO A;  1NWG B;  1YP4 A;  2WL9 A;  3CGX A;  3HNQ A;  4D48 A;  3F1C A;  5L6V A; 
#chains in the Genus database with same CATH homology
 4O6N A;  2XWM A;  3D8V A;  3ZF8 A;  3TZT A;  2V0J A;  2NXV A;  5AJO A;  2A8U A;  1O0R A;  4Y7T A;  2QH5 A;  2BO8 A;  2V0L A;  1H7T A;  1K4V A;  1VH3 A;  1JV3 A;  4FIY A;  2RJ6 A;  4J18 A;  2RIX A;  2X5S A;  3IOJ A;  1H7G A;  1WT3 A;  4Y6N A;  4C2S A;  5C3A A;  2Y7A A;  4P02 A;  2V0H A;  1I52 A;  1WT1 A;  5FTV A;  4MYB A;  4G3Q A;  2AM4 A;  5CQN X;  5C3D A;  3I0K A;  4P00 A;  5J49 A;  5CMG X;  1MP5 A;  1YP2 A;  4D0T A;  4EVW A;  5EJ1 A;  4YS8 A;  1VZX A;  4B4B A;  5IDT A;  4AYJ A;  4E1K A;  1ZCY A;  1XHB A;  1HJL A;  1V84 A;  4IRQ A;  3I0D A;  1VGU A;  5CQP A;  3U2T A;  2PGV A;  4NAK A;  3OH2 A;  1G97 A;  2J0A A;  4FRD A;  1Z90 A;  1XZ6 A;  3Q4S A;  3CKO A;  4Q7C A;  3PKQ A;  2RIY A;  4UEG A;  1FO8 A;  5FYE A;  5C4D A;  2VXM A;  2RJ8 A;  4B2X A;  5C4B A;  1R7T A;  1H3M A;  2VSI A;  1WT2 A;  4L41 C;  4BQH A;  1H5T A;  3K8E A;  5BXC A;  1S4O A;  3I0J A;  4KQL A;  1R82 A;  1FGG A;  4FRH A;  2V0K A;  2JCK A;  1EZI A;  2RJ7 A;  1JVG A;  5FTS A;  4HO4 A;  5C36 A;  4HO3 A;  5C1G A;  1S4N A;  5JQQ A;  2XMH A;  1EYR A;  1R7Y A;  2V0I A;  2JCO A;  1ZCU A;  1FO9 A;  2P73 A;  1NKH B;  3T7M A;  4FRP A;  5CMJ A;  1VH1 A;  2YQJ A;  5L6S A;  4M28 A;  3V0N A;  4LW3 A;  4Y6U A;  1ON8 A;  4FCE A;  2W0W A;  1YRO B;  1ZJ0 A;  2D7I A;  1OMZ A;  4LW6 A;  1ON6 A;  1H7H A;  3U0Y A;  5C8R A;  3E26 A;  1HM9 A;  3SX8 A;  3V0P A;  2VD4 A;  1V82 A;  1W77 A;  4ECM A;  2ICX A;  2FFV A;  2Y4M A;  4NAL A;  1IIM A;  4AAW A;  5C4F A;  1O7O A;  3FWW A;  4IRP A;  2WAW A;  2E3D A;  4GBP A;  4EE3 A;  2Y4L A;  1ZCV A;  1VIC A;  1JV1 A;  3LW6 A;  2QGI A;  4ARW A;  1R81 A;  2WVK A;  1S4P A;  5EIY A;  1V83 A;  2OI7 A;  1H5T B;  2E8B A;  2ZU7 A;  3I0G A;  1FGX A;  4G3P A;  4CJC A;  1IIN A;  4HG6 A;  1GQC A;  1GQ9 A;  1FG5 N;  3V90 A;  2O1G A;  3ZGF A;  4KC1 A;  3DK5 A;  3U2X A;  3DJ4 A;  2XWN A;  3Q7U A;  2AEC A;  3SXE A;  4HCQ A;  4MIX A;  3RMV A;  4ZDQ A;  4FRA A;  1GWW A;  1HV9 A;  5HS2 A;  1ZIZ A;  4B5B A;  5IFY A;  3U2U A;  2RJ4 A;  1G23 A;  2A8W A;  2Y4K A;  1H7Q A;  1VGZ A;  1ZI4 A;  4G3S A;  1ZCT A;  3E25 A;  4HO6 A;  4M2B A;  3U0X A;  3I0C A;  2YC3 A;  2APC A;  5FUH A;  4EE4 A;  1R7U A;  1ZJO A;  2QKX A;  3I0F A;  3I0H A;  2P72 A;  4HO0 A;  4K6R A;  2GGO A;  4EEO A;  1FXO A;  4HO2 A;  1PZY B;  2P6W A;  3POL A;  1GA8 A;  1VPA A;  1VM8 A;  1O23 B;  1SS9 A;  2AH9 A;  3BRK X;  3OH3 A;  3OH0 A;  2VS5 A;  3JUK A;  4D11 A;  2PA4 A;  2OI6 A;  3I0I X;  4EE5 A;  1GX4 A;  1WSZ A;  2RJ1 A;  2PGY A;  3F1Y A;  2I5K A;  1INI A;  1INJ A;  1LZ0 A;  2VS3 A;  1QG8 A;  1ZJ2 A;  1H5R B;  4D0Z A;  2Y6P A;  4G87 A;  4MND A;  2FFU A;  4D11 C;  1FRW A;  3N9W A;  4HO9 A;  2PX7 A;  1TZF A;  4FQW A;  1NF5 B;  1FXJ A;  5IDS A;  2BO4 A;  3D5N A;  3OH1 A;  5CQL X;  1QGQ A;  4NAN A;  1TW1 A;  4O6M A;  1G0R A;  1LZ7 A;  3CKV A;  3I0L A;  2OEG A;  2WEE A;  5AJP A;  2W0V A;  2DPW A;  1FR9 A;  3SXC A;  5C1L A;  2YES A;  1GWV A;  3V8Y A;  2VFZ A;  1MP3 A;  3SXD A;  2JCJ A;  1QWJ A;  2RJ9 A;  1H5S D;  5C47 A;  5C3B A;  4KPZ A;  3V0M A;  2FYC B;  3TQD A;  2GGQ A;  4B2W A;  1VZT A;  3CKN A;  3OC9 A;  2Q4J A;  4JD0 A;  4DDZ A;  1LL0 A;  1VZU A;  2OI5 A;  5EJZ A;  3SPT A;  2MZB A;  1H7E A;  1ZDG A;  1R7X A;  5FU0 A;  1JYL A;  1ZDF A;  3SX3 A;  4B42 A;  1G95 A;  3CKJ A;  3KIA A;  5D92 A;  1H4C A;  4DE7 A;  5AJN A;  1HM8 A;  1W55 A;  5DDT A;  2VK9 A;  1E5K A;  1ZI1 A;  4NAI A;  3R3I A;  4EEG A;  4FCU A;  2RIZ A;  2YQH A;  2FY7 A;  1G3L A;  3USR A;  1TW5 A;  4XWI A;  1WVC A;  4Y62 A;  1H4D A;  4FRE A;  5D91 A;  4Y9X A;  5C38 A;  1W57 A;  4CJ8 A;  4EEM A;  4AC3 A;  2X5Z A;  1H7F A;  1MC3 A;  5FV9 A;  1HM0 A;  3CU0 A;  2YCM A;  3SX7 A;  2AES A;  3V8Z A;  3OH4 A;  4CJB A;  5CQM X;  4Y7V A;  4M2A A;  1LZJ A;  1HJJ A;  2X60 A;  3D98 A;  2Y4J A;  1H4E A;  1H5S A;  4EEA A;  1ZJP A;  3ZGG A;  2CU2 A;  4HO8 A;  4JIS A;  3SXG A;  4FRB A;  3RSB A;  3I0E A;  2FYB A;  2ZU8 A;  4KNX A;  1R80 A;  4KXO A;  5CMF X;  2J0B A;  2WVL A;  3SXB A;  2I7B A;  2BO6 A;  4B4G A;  1H5S C;  2UX8 A;  2AM5 A;  1H7L A;  4FIX A;  2BO7 A;  1LL2 A;  4KC2 A;  4M4K A;  5C1H A;  1ZHJ A;  3OAM A;  3DUV A;  3V0L A;  1ZI3 A;  3O3P A;  1NMM B;  5C4E A;  4KPX A;  1JYK A;  3BCV A;  4FRO A;  3JUJ A;  2AM3 A;  5CMI A;  5C4C A;  3T7O A;  3IOH A;  4AYL A;  3PNN A;  2YQS A;  3SX5 A;  3K8D A;  4BMA A;  2D0J A;  2C0N A;  1G2V A;  2ICY A;  1LVW A;  3U2W A;  4HOC A;  1KWS A;  1YP3 A;  1ZJ3 A;  4B3U A;  4KT7 A;  4KNR A;  4CVH A;  2VXL A;  1G93 A;  2YQC A;  5FU8 A;  3R2W A;  5C49 A;  1G8O A;  3EE5 A;  1FR8 A;  3Q80 A;  2WGZ A;  3ZLL A;  1VGT A;  2O1F A;  3U2V A;  3NGW A;  1FZW A;  1ZI5 A;  1QGS A;  1WT0 A;  2I5E A;  3V0O A;  3V0Q A;  4KRV A;  1NQI B;  2RJ5 A;  2XME A;  2VSH A;  4KC4 A;  2JCL A;  1FOA A;  3OKR A;  4FRQ A;  2O1H A;  4Y7G A;  1G9R A;  1H5S B;  4HO5 A;  4Y7F A;  5DDV A;  3RMW A;  3JTJ A;  1OMX A;  3ST8 A;  5C48 A;  1R7V A;  1VGW A;  2AE7 A;  3GUE A;  4Y7U A;  5CMH A;  3HL3 A;  3OGZ A;  2RIT A;  2FYD B;  4FRM A;  2WE9 A;  1ZJ1 A;  2Z86 A;  4FRL A;  1PZT A;  3USQ A;  1JVD A;  1LL3 A;  2VS4 A;  4ASY A;  4DEC A;  5I1F A;  2RJ0 A;  2ZU9 A;  1GX0 A;  4ASJ A;  1MP4 A;  3QVB A;  2X65 A;  1NHE B;  3CKQ A;  4Y63 A;  1OQM B;  2OEF A;  2FYA A;  3T7N A;  3ZLK A;  3SXA A;  2D7R A;  1FWY A;  4Y64 A;  3V91 A;  1LZI A;  3IOI A;  3PKP A;  2XWL A;  4B4M A;  3FOQ A;  2WVM A;  2Z87 A;  2AGD A;  1H5R A;  4R7P A;  1O7Q A;  1G1L A;  2YC5 A;  1TVY A;  5CQO A;  1NWG B;  1YP4 A;  3CGX A;  4D48 A;  3F1C A;  5L6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...