2VXMA

Screening a limited structure-based library identifies udp-galnac- specific mutants of alpha-1,3 galactosyltransferase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
273
structure length
268
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYRAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Screening a Limited Structure-Based Library Identifies Udp-Galnac-Specific Mutants of {Alpha}-1,3-Galactosyltransferase.
pubmed doi rcsb
source organism Bos taurus
total genus 85
structure length 268
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2008-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2vxmA00
5CQOA 1FR9A 5L6VA 3CU0A 3F1YA 1ZI1A 1TVYA 3U2TA 1G9RA 1NQIB 3ZGFA 1LL0A 2RIYA 4JISA 4FRPA 2VD4A 1H4CA 2V0KA 1ON6A 1R82A 3SXAA 2Y6PA 3IOHA 4LW3A 2OI5A 4B3UA 1V84A 2PX7A 2FYCB 4FRBA 1FZWA 3BCVA 2Z86A 2E3DA 1IINA 1H5SD 2AH9A 4G3SA 4IRPA 1INIA 2AE7A 4Y6UA 1ZI3A 1JYLA 1FG5N 3RMVA 3SX8A 5IDSA 1R80A 4M4KA 1MP3A 3GUEA 4HO3A 1MP5A 2ICYA 1VM8A 1H7HA 5CQMX 1OMXA 1H7GA 4DE7A 2PGVA 2VS3A 2AESA 1QGSA 1FXJA 3HL3A 1FRWA 4IRQA 4B5BA 5FTSA 3K8EA 2BO8A 2D7IA 4EEMA 1V83A 2OEFA 3D8VA 1ZHJA 2FFVA 1G23A 2PGYA 2QH5A 4NAKA 1TW1A 2VXLA 2GGOA 1H7LA 4G3PA 3QVBA 5DDTA 2Y4JA 3R3IA 1H5RA 4HOCA 4KRVA 5CMHA 4B2WA 4KNRA 3OH1A 5C4DA 4LW6A 1WT3A 1LZ7A 4FCUA 1NMMB 1VZXA 2NXVA 2E8BA 1HM9A 1LZ0A 1WT0A 1E5KA 1TZFA 1ZCYA 4KC2A 2DPWA 2RIXA 3NGWA 3I0KA 3JTJA 2FFUA 5J49A 2Y7AA 4Y7UA 5EIYA 5C48A 3DJ4A 2O1GA 3USQA 3OC9A 1R7TA 4Y7GA 2W0WA 1R7UA 5IFYA 1FOAA 1FWYA 4M28A 3SXBA 2QGIA 3DUVA 4FRAA 1YROB 3OAMA 4AAWA 3E26A 5IDTA 2ZU7A 5C3DA 2YESA 1ZI4A 1VGWA 4FQWA 1R7XA 1W77A 1LL3A 1O7OA 4JD0A 2X60A 2MZBA 2APCA 3FWWA 1WVCA 2V0HA 4D11A 1WSZA 3U0XA 1H3MA 3U2WA 1WT1A 3KIAA 2VFZA 3RSBA 4HO6A 1LZIA 1SS9A 2P72A 2P6WA 1W57A 3IOIA 4G3QA 2A8UA 1EYRA 3V0OA 2V0LA 2ICXA 2Z87A 1JV1A 5C4CA 2FYAA 1GQCA 3JUJA 4HO4A 2AM3A 3TQDA 1I52A 1GX4A 4YS8A 4KPXA 4C2SA 3EE5A 1EZIA 5BXCA 2FY7A 4EEAA 5FU8A 3SXEA 2CU2A 2OI6A 2A8WA 1KWSA 1YP4A 3CKQA 2AECA 5C36A 2BO4A 4MNDA 3Q7UA 1PZYB 1H5TB 3ZLKA 1ZDGA 4KC4A 2XWNA 4EE5A 2FYDB 3OH2A 5EJZA 4Y6NA 4FRDA 5CMIA 5JQQA 1GX0A 1ZCUA 1ZJ1A 3LW6A 2RJ7A 1YP2A 3V0NA 5C4BA 4Y7FA 1ZJ0A 1S4OA 3V8ZA 2RJ9A 3SXDA 4NAIA 1HV9A 2AM5A 4E1KA 4NALA 1LVWA 1ZDFA 4KPZA 3DK5A 1QWJA 4J18A 1MP4A 5CMGX 1VPAA 2X5SA 5AJNA 1O7QA 2V0IA 3CKNA 4M2BA 3V8YA 3RMWA 2PA4A 2Y4LA 1G8OA 1H5RB 3F1CA 4P02A 3OKRA 2YC5A 3I0HA 1WT2A 4HO8A 2OI7A 4G87A 2YCMA 3SX3A 3U2XA 4AYLA 1VGUA 1R7YA 1G0RA 1FO9A 4D0ZA 5CQLX 3IOJA 3OH4A 1ZJPA 1H7TA 2VS4A 5C4EA 4BQHA 4FRMA 1FGXA 3ZF8A 4B42A 3D98A 4L41C 3E25A 5FU0A 2YQHA 2O1HA 4XWIA 2WVMA 4FRHA 4KXOA 4M2AA 4ECMA 1JYKA 2WVKA 4Y64A 5C3BA 3ZGGA 3N9WA 2X5ZA 4Y62A 2RJ5A 1HM0A 5DDVA 1NKHB 1FR8A 3SX7A 1R7VA 1H5SA 1YP3A 2W0VA 3Q80A 3V0LA 4EE3A 1G2VA 4FROA 3JUKA 3U0YA 4B4GA 4ASJA 5C1LA 4CJBA 3USRA 4D11C 3V0QA 1JVDA 4EVWA 2WVLA 2D7RA 2BO7A 4Y9XA 1W55A 1ZJ3A 4BMAA 2RIZA 2JCOA 1S4NA 2QKXA 2O1FA 1K4VA 1NF5B 5AJPA 1GWVA 1FXOA 2JCLA 3D5NA 1G95A 2D0JA 1GQ9A 5C4FA 2I5KA 3TZTA 2VSIA 1VICA 4D48A 2WAWA 1PZTA 1G97A 2XWLA 3K8DA 4B2XA 5C1GA 2VSHA 2JCJA 3CKOA 4AYJA 5FTVA 4B4BA 3OGZA 2X65A 4Y7TA 1OQMB 3SPTA 3U2UA 1JV3A 1IIMA 2YQSA 4FREA 4ASYA 4EE4A 1VGZA 3CKVA 5CQPA 2JCKA 1H4EA 3CKJA 1NHEB 1R81A 5C3AA 1ZI5A 4FRQA 1XZ6A 1JVGA 3OH3A 1OMZA 3I0IX 5FUHA 5EJ1A 2AM4A 1H7FA 2ZU9A 4HO5A 5C49A 3I0EA 3R2WA 2AGDA 2Q4JA 4HO0A 1INJA 5FYEA 4FRLA 2FYBA 5I1FA 2XMHA 1FO8A 2Y4MA 2VXMA 2VS5A 3I0DA 2UX8A 2WE9A 1O23B 2XMEA 5FV9A 1G1LA 5CMFX 3ST8A 3Q4SA 1HJLA 1H5TA 1G93A 4HO9A 3T7NA 4UEGA 4HG6A 2BO6A 1ZIZA 1XHBA 5AJOA 3V90A 3PKPA 1LL2A 1GWWA 3SXCA 3FOQA 2RJ8A 4AC3A 3I0CA 2RJ6A 4ARWA 3SXGA 4KNXA 3PKQA 3I0LA 4FCEA 3O3PA 5C47A 4KQLA 1VGTA 2YC3A 3T7MA 1H5SB 3PNNA 4P00A 4CJ8A 1H5SC 4ZDQA 1ZCTA 2Y4KA 2WGZA 3I0GA 4R7PA 4CVHA 2OEGA 2I5EA 3T7OA 1ZJ2A 4DECA 1LZJA 1H4DA 1ON8A 1NWGB 1V82A 2YQCA 1H7QA 3U2VA 1HJJA 3POLA 2RJ0A 5CQNX 1QGQA 1VZUA 1O0RA 1HM8A 1VH1A 4NANA 3CGXA 3I0JA 4KT7A 3I0FA 2ZU8A 1GA8A 2YQJA 2RITA 1FGGA 5HS2A 2V0JA 4HCQA 3V0MA 4EEGA 5C8RA 1QG8A 4DDZA 4B4MA 1Z90A 4EEOA 1ZCVA 5L6SA 1VZTA 2WEEA 5C1HA 4CJCA 4KC1A 3V0PA 1S4PA 2RJ1A 1VH3A 2RJ4A 4MYBA 1TW5A 2GGQA 3ZLLA 4D0TA 5CMJA 4K6RA 3BRKX 5C38A 1H7EA 4HO2A 2P73A 1ZJOA 4Y63A 4Y7VA 4GBPA 1MC3A 1G3LA 2I7BA 3OH0A 2XWMA 3SX5A 3V91A
chains in the Genus database with same CATH superfamily
5CQOA 1FR9A 5L6VA 3CU0A 3F1YA 1ZI1A 1TVYA 3U2TA 1G9RA 1NQIB 3ZGFA 1LL0A 2RIYA 4JISA 4FRPA 2VD4A 1H4CA 2V0KA 1ON6A 1R82A 3SXAA 2Y6PA 3IOHA 4LW3A 2OI5A 4B3UA 1V84A 2PX7A 2FYCB 4FRBA 1FZWA 3BCVA 2Z86A 2E3DA 1IINA 1H5SD 2AH9A 4G3SA 4IRPA 1INIA 2AE7A 4Y6UA 1ZI3A 1JYLA 1FG5N 3RMVA 3SX8A 5IDSA 1R80A 4M4KA 1MP3A 3GUEA 4HO3A 1MP5A 2ICYA 1VM8A 1H7HA 5CQMX 1OMXA 1H7GA 4DE7A 2PGVA 2VS3A 2AESA 1QGSA 1FXJA 3HL3A 1FRWA 4IRQA 4B5BA 5FTSA 3K8EA 2BO8A 2C0NA 2D7IA 4EEMA 1V83A 2OEFA 3D8VA 1ZHJA 2FFVA 1G23A 2PGYA 2QH5A 4NAKA 1TW1A 2VXLA 2GGOA 1H7LA 4G3PA 3QVBA 5DDTA 2Y4JA 3R3IA 1H5RA 4HOCA 4KRVA 5CMHA 4B2WA 4KNRA 3OH1A 5C4DA 4LW6A 1WT3A 1LZ7A 4FCUA 1NMMB 1VZXA 2NXVA 2E8BA 1HM9A 1LZ0A 1WT0A 1E5KA 1TZFA 1ZCYA 4KC2A 2DPWA 2RIXA 3NGWA 3I0KA 3JTJA 2FFUA 5J49A 2Y7AA 4Y7UA 5EIYA 5C48A 3DJ4A 2O1GA 3USQA 3OC9A 1R7TA 4Y7GA 2W0WA 1R7UA 5IFYA 1FOAA 1FWYA 4M28A 3SXBA 2QGIA 3DUVA 4FRAA 1YROB 3OAMA 4AAWA 3E26A 5IDTA 2ZU7A 5C3DA 2YESA 1ZI4A 1VGWA 4FQWA 1R7XA 1W77A 1LL3A 1O7OA 4JD0A 2X60A 2MZBA 2APCA 3FWWA 1WVCA 2V0HA 4D11A 1WSZA 3U0XA 1H3MA 3U2WA 1WT1A 3KIAA 2VFZA 3RSBA 4HO6A 1LZIA 1SS9A 2P72A 4FIYA 2P6WA 1W57A 3IOIA 2J0BA 4G3QA 2A8UA 1EYRA 3V0OA 2V0LA 2ICXA 2Z87A 1JV1A 5C4CA 2FYAA 1GQCA 3JUJA 4HO4A 2AM3A 3TQDA 1I52A 1GX4A 4YS8A 4KPXA 2VK9A 4C2SA 3EE5A 1EZIA 5BXCA 2FY7A 4EEAA 5FU8A 3SXEA 2CU2A 2OI6A 2A8WA 1KWSA 1YP4A 3CKQA 2AECA 5C36A 2BO4A 4MNDA 3Q7UA 1PZYB 1H5TB 3ZLKA 1ZDGA 4KC4A 2XWNA 4EE5A 2FYDB 3OH2A 5EJZA 4Y6NA 4FRDA 5CMIA 5JQQA 1GX0A 1ZCUA 1ZJ1A 3LW6A 2RJ7A 1YP2A 3V0NA 5C4BA 4Y7FA 1ZJ0A 1S4OA 3V8ZA 2RJ9A 3SXDA 4NAIA 1HV9A 2AM5A 4E1KA 4NALA 1LVWA 1ZDFA 4KPZA 3DK5A 1QWJA 4J18A 1MP4A 5CMGX 1VPAA 2X5SA 5AJNA 1O7QA 2V0IA 3CKNA 4M2BA 3V8YA 3RMWA 2PA4A 2Y4LA 1G8OA 1H5RB 3F1CA 4P02A 3OKRA 2YC5A 3I0HA 1WT2A 4HO8A 2OI7A 4O6NA 4G87A 2YCMA 3SX3A 3U2XA 4AYLA 1VGUA 1R7YA 1G0RA 1FO9A 4D0ZA 5CQLX 3IOJA 3OH4A 1ZJPA 1H7TA 2VS4A 5C4EA 4BQHA 4FRMA 1FGXA 3ZF8A 4B42A 3D98A 4L41C 3E25A 5FU0A 2YQHA 2O1HA 4XWIA 2WVMA 4FRHA 4KXOA 4M2AA 4ECMA 1JYKA 2WVKA 4Y64A 5C3BA 3ZGGA 3N9WA 2X5ZA 4Y62A 5D92A 2RJ5A 1HM0A 5DDVA 1NKHB 1FR8A 3SX7A 2J0AA 1R7VA 1H5SA 1YP3A 2W0VA 3Q80A 3V0LA 4EE3A 1G2VA 4FROA 3JUKA 3U0YA 4B4GA 4ASJA 5C1LA 4CJBA 3USRA 4D11C 3V0QA 4FIXA 1JVDA 4O6MA 4EVWA 2WVLA 2D7RA 4Q7CA 2BO7A 4Y9XA 1W55A 1ZJ3A 4BMAA 2RIZA 2JCOA 1S4NA 2QKXA 2O1FA 1K4VA 1NF5B 5AJPA 1GWVA 1FXOA 2JCLA 3D5NA 1G95A 2D0JA 1GQ9A 5C4FA 2I5KA 3TZTA 2VSIA 1VICA 4D48A 2WAWA 1PZTA 1G97A 2XWLA 3K8DA 4B2XA 5C1GA 2VSHA 2JCJA 3CKOA 4AYJA 5FTVA 4B4BA 3OGZA 2X65A 4Y7TA 1OQMB 3SPTA 3U2UA 1JV3A 1IIMA 2YQSA 4FREA 4ASYA 4EE4A 1VGZA 3CKVA 5CQPA 2JCKA 1H4EA 3CKJA 1NHEB 1R81A 5C3AA 1ZI5A 4FRQA 1XZ6A 1JVGA 3OH3A 1OMZA 3I0IX 5FUHA 5EJ1A 2AM4A 1H7FA 2ZU9A 4HO5A 5C49A 3I0EA 3R2WA 2AGDA 2Q4JA 4HO0A 1INJA 5FYEA 4FRLA 2FYBA 5I1FA 2XMHA 1FO8A 2Y4MA 2VXMA 2VS5A 3I0DA 2UX8A 2WE9A 1O23B 2XMEA 5FV9A 1G1LA 5CMFX 3ST8A 3Q4SA 1HJLA 1H5TA 1G93A 4HO9A 3T7NA 4UEGA 4HG6A 2BO6A 4MIXA 1ZIZA 1XHBA 5D91A 5AJOA 3V90A 3PKPA 1LL2A 1GWWA 3SXCA 3FOQA 2RJ8A 4AC3A 3I0CA 2RJ6A 4ARWA 3SXGA 4KNXA 3PKQA 3I0LA 4FCEA 3O3PA 5C47A 4KQLA 1VGTA 2YC3A 3T7MA 1H5SB 3PNNA 4P00A 4CJ8A 1H5SC 4ZDQA 1ZCTA 2Y4KA 2WGZA 3I0GA 4R7PA 4CVHA 2OEGA 2I5EA 3T7OA 1ZJ2A 4DECA 1LZJA 1H4DA 1ON8A 1NWGB 1V82A 2YQCA 1H7QA 3U2VA 1HJJA 3POLA 2RJ0A 5CQNX 1QGQA 1VZUA 1O0RA 1HM8A 1VH1A 4NANA 3CGXA 3I0JA 4KT7A 3I0FA 2ZU8A 1GA8A 2YQJA 2RITA 1FGGA 5HS2A 2V0JA 4HCQA 3V0MA 4EEGA 5C8RA 1QG8A 4DDZA 4B4MA 1Z90A 4EEOA 1ZCVA 5L6SA 1VZTA 2WEEA 5C1HA 4CJCA 4KC1A 3V0PA 1S4PA 2RJ1A 1VH3A 2RJ4A 4MYBA 1TW5A 2GGQA 3ZLLA 4D0TA 5CMJA 4K6RA 3BRKX 5C38A 1H7EA 4HO2A 2P73A 1ZJOA 4Y63A 4Y7VA 4GBPA 1MC3A 1G3LA 2I7BA 3OH0A 2XWMA 3SX5A 3V91A
chains in the Genus database with same CATH topology
5CQOA 1FR9A 5L6VA 3CU0A 3F1YA 1ZI1A 1TVYA 3U2TA 1G9RA 1NQIB 3ZGFA 1LL0A 2RIYA 4JISA 4FRPA 2VD4A 1H4CA 2V0KA 1ON6A 1R82A 3SXAA 2Y6PA 3IOHA 4LW3A 2OI5A 4B3UA 1V84A 2PX7A 2FYCB 4FRBA 1FZWA 3BCVA 2Z86A 2E3DA 1IINA 1H5SD 2AH9A 4G3SA 4IRPA 1INIA 2AE7A 4Y6UA 1ZI3A 1JYLA 1FG5N 3RMVA 3SX8A 5IDSA 1R80A 4M4KA 1MP3A 3GUEA 4HO3A 1MP5A 2ICYA 1VM8A 1H7HA 5CQMX 1OMXA 1H7GA 4DE7A 2PGVA 2VS3A 2AESA 1QGSA 1FXJA 3HL3A 1FRWA 4IRQA 4B5BA 5FTSA 3K8EA 2BO8A 2C0NA 2D7IA 4EEMA 1V83A 2OEFA 3D8VA 1ZHJA 2FFVA 1G23A 2PGYA 2QH5A 4NAKA 1TW1A 2VXLA 2GGOA 1H7LA 4G3PA 3QVBA 5DDTA 2Y4JA 3R3IA 1H5RA 4HOCA 4KRVA 5CMHA 4B2WA 4KNRA 3OH1A 5C4DA 4LW6A 1WT3A 1LZ7A 4FCUA 1NMMB 1VZXA 2NXVA 2E8BA 1HM9A 1LZ0A 1WT0A 1E5KA 1TZFA 1ZCYA 4KC2A 2DPWA 2RIXA 3NGWA 3I0KA 3JTJA 2FFUA 5J49A 2Y7AA 4Y7UA 5EIYA 5C48A 3DJ4A 2O1GA 3USQA 3OC9A 1R7TA 4Y7GA 2W0WA 1R7UA 5IFYA 1FOAA 1FWYA 4M28A 3SXBA 2QGIA 3DUVA 4FRAA 1YROB 3OAMA 4AAWA 3E26A 5IDTA 2ZU7A 5C3DA 2YESA 1ZI4A 1VGWA 4FQWA 1R7XA 1W77A 1LL3A 1O7OA 4JD0A 2X60A 2MZBA 2APCA 3FWWA 1WVCA 2V0HA 4D11A 1WSZA 3U0XA 1H3MA 3U2WA 1WT1A 3KIAA 2VFZA 3RSBA 4HO6A 1LZIA 1SS9A 2P72A 4FIYA 2P6WA 1W57A 3IOIA 2J0BA 4G3QA 2A8UA 1EYRA 3V0OA 2V0LA 2ICXA 2Z87A 1JV1A 5C4CA 2FYAA 1GQCA 3JUJA 4HO4A 2AM3A 3TQDA 1I52A 1GX4A 4YS8A 4KPXA 2VK9A 4C2SA 3EE5A 1EZIA 5BXCA 2FY7A 4EEAA 5FU8A 3SXEA 2CU2A 2OI6A 2A8WA 1KWSA 1YP4A 3CKQA 2AECA 5C36A 2BO4A 4MNDA 3Q7UA 1PZYB 1H5TB 3ZLKA 1ZDGA 4KC4A 2XWNA 4EE5A 2FYDB 3OH2A 5EJZA 4Y6NA 4FRDA 5CMIA 5JQQA 1GX0A 1ZCUA 1ZJ1A 3LW6A 2RJ7A 1YP2A 3V0NA 5C4BA 4Y7FA 1ZJ0A 1S4OA 3V8ZA 2RJ9A 3SXDA 4NAIA 1HV9A 2AM5A 4E1KA 4NALA 1LVWA 1ZDFA 4KPZA 3DK5A 1QWJA 4J18A 1MP4A 5CMGX 1VPAA 2X5SA 5AJNA 1O7QA 2V0IA 3CKNA 4M2BA 3V8YA 3RMWA 2PA4A 2Y4LA 1G8OA 1H5RB 3F1CA 4P02A 3OKRA 2YC5A 3I0HA 1WT2A 4HO8A 2OI7A 4O6NA 4G87A 2YCMA 3SX3A 3U2XA 4AYLA 1VGUA 1R7YA 1G0RA 1FO9A 4D0ZA 5CQLX 3IOJA 3OH4A 1ZJPA 1H7TA 2VS4A 5C4EA 4BQHA 4FRMA 1FGXA 3ZF8A 4B42A 3D98A 4L41C 3E25A 5FU0A 2YQHA 2O1HA 4XWIA 2WVMA 4FRHA 4KXOA 4M2AA 4ECMA 1JYKA 2WVKA 4Y64A 5C3BA 3ZGGA 3N9WA 2X5ZA 4Y62A 5D92A 2RJ5A 1HM0A 5DDVA 1NKHB 1FR8A 3SX7A 2J0AA 1R7VA 1H5SA 1YP3A 2W0VA 3Q80A 3V0LA 4EE3A 1G2VA 4FROA 3JUKA 3U0YA 4B4GA 4ASJA 5C1LA 4CJBA 3USRA 4D11C 3V0QA 4FIXA 1JVDA 4O6MA 4EVWA 2WVLA 2D7RA 4Q7CA 2BO7A 4Y9XA 1W55A 1ZJ3A 4BMAA 2RIZA 2JCOA 1S4NA 2QKXA 2O1FA 1K4VA 1NF5B 5AJPA 1GWVA 1FXOA 2JCLA 3D5NA 1G95A 2D0JA 1GQ9A 5C4FA 2I5KA 3TZTA 2VSIA 1VICA 4D48A 2WAWA 1PZTA 1G97A 2XWLA 3K8DA 4B2XA 5C1GA 2VSHA 2JCJA 3CKOA 4AYJA 5FTVA 4B4BA 3OGZA 2X65A 4Y7TA 1OQMB 3SPTA 3U2UA 1JV3A 1IIMA 2YQSA 4FREA 4ASYA 4EE4A 1VGZA 3CKVA 5CQPA 2JCKA 1H4EA 3CKJA 1NHEB 1R81A 5C3AA 1ZI5A 4FRQA 1XZ6A 1JVGA 3OH3A 1OMZA 3I0IX 5FUHA 5EJ1A 2AM4A 1H7FA 2ZU9A 4HO5A 5C49A 3I0EA 3R2WA 2AGDA 2Q4JA 4HO0A 1INJA 5FYEA 4FRLA 2FYBA 5I1FA 2XMHA 1FO8A 2Y4MA 2VXMA 2VS5A 3I0DA 2UX8A 2WE9A 1O23B 2XMEA 5FV9A 1G1LA 5CMFX 3ST8A 3Q4SA 1HJLA 1H5TA 1G93A 4HO9A 3T7NA 4UEGA 4HG6A 2BO6A 4MIXA 1ZIZA 1XHBA 5D91A 5AJOA 3V90A 3PKPA 1LL2A 1GWWA 3SXCA 3FOQA 2RJ8A 4AC3A 3I0CA 2RJ6A 4ARWA 3SXGA 4KNXA 3PKQA 3I0LA 4FCEA 3O3PA 5C47A 4KQLA 1VGTA 2YC3A 3T7MA 1H5SB 3PNNA 4P00A 4CJ8A 1H5SC 4ZDQA 1ZCTA 2Y4KA 2WGZA 3I0GA 4R7PA 4CVHA 2OEGA 2I5EA 3T7OA 1ZJ2A 4DECA 1LZJA 1H4DA 1ON8A 1NWGB 1V82A 2YQCA 1H7QA 3U2VA 1HJJA 3POLA 2RJ0A 5CQNX 1QGQA 1VZUA 1O0RA 1HM8A 1VH1A 4NANA 3CGXA 3I0JA 4KT7A 3I0FA 2ZU8A 1GA8A 2YQJA 2RITA 1FGGA 5HS2A 2V0JA 4HCQA 3V0MA 4EEGA 5C8RA 1QG8A 4DDZA 4B4MA 1Z90A 4EEOA 1ZCVA 5L6SA 1VZTA 2WEEA 5C1HA 4CJCA 4KC1A 3V0PA 1S4PA 2RJ1A 1VH3A 2RJ4A 4MYBA 1TW5A 2GGQA 3ZLLA 4D0TA 5CMJA 4K6RA 3BRKX 5C38A 1H7EA 4HO2A 2P73A 1ZJOA 4Y63A 4Y7VA 4GBPA 1MC3A 1G3LA 2I7BA 3OH0A 2XWMA 3SX5A 3V91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQO A;  1FR9 A;  5L6V A;  3CU0 A;  3F1Y A;  1ZI1 A;  1TVY A;  3U2T A;  1G9R A;  1NQI B;  3ZGF A;  1LL0 A;  2RIY A;  4JIS A;  4FRP A;  2VD4 A;  1H4C A;  2V0K A;  1ON6 A;  1R82 A;  3SXA A;  2Y6P A;  3IOH A;  4LW3 A;  2OI5 A;  4B3U A;  1V84 A;  2PX7 A;  2FYC B;  4FRB A;  1FZW A;  3BCV A;  2Z86 A;  2E3D A;  1IIN A;  1H5S D;  2AH9 A;  4G3S A;  4IRP A;  1INI A;  2AE7 A;  4Y6U A;  1ZI3 A;  1JYL A;  1FG5 N;  3RMV A;  3SX8 A;  5IDS A;  1R80 A;  4M4K A;  1MP3 A;  3GUE A;  4HO3 A;  1MP5 A;  2ICY A;  1VM8 A;  1H7H A;  5CQM X;  1OMX A;  1H7G A;  4DE7 A;  2PGV A;  2VS3 A;  2AES A;  1QGS A;  1FXJ A;  3HL3 A;  1FRW A;  4IRQ A;  4B5B A;  5FTS A;  3K8E A;  2BO8 A;  2D7I A;  4EEM A;  1V83 A;  2OEF A;  3D8V A;  1ZHJ A;  2FFV A;  1G23 A;  2PGY A;  2QH5 A;  4NAK A;  1TW1 A;  2VXL A;  2GGO A;  1H7L A;  4G3P A;  3QVB A;  5DDT A;  2Y4J A;  3R3I A;  1H5R A;  4HOC A;  4KRV A;  5CMH A;  4B2W A;  4KNR A;  3OH1 A;  5C4D A;  4LW6 A;  1WT3 A;  1LZ7 A;  4FCU A;  1NMM B;  1VZX A;  2NXV A;  2E8B A;  1HM9 A;  1LZ0 A;  1WT0 A;  1E5K A;  1TZF A;  1ZCY A;  4KC2 A;  2DPW A;  2RIX A;  3NGW A;  3I0K A;  3JTJ A;  2FFU A;  5J49 A;  2Y7A A;  4Y7U A;  5EIY A;  5C48 A;  3DJ4 A;  2O1G A;  3USQ A;  3OC9 A;  1R7T A;  4Y7G A;  2W0W A;  1R7U A;  5IFY A;  1FOA A;  1FWY A;  4M28 A;  3SXB A;  2QGI A;  3DUV A;  4FRA A;  1YRO B;  3OAM A;  4AAW A;  3E26 A;  5IDT A;  2ZU7 A;  5C3D A;  2YES A;  1ZI4 A;  1VGW A;  4FQW A;  1R7X A;  1W77 A;  1LL3 A;  1O7O A;  4JD0 A;  2X60 A;  2MZB A;  2APC A;  3FWW A;  1WVC A;  2V0H A;  4D11 A;  1WSZ A;  3U0X A;  1H3M A;  3U2W A;  1WT1 A;  3KIA A;  2VFZ A;  3RSB A;  4HO6 A;  1LZI A;  1SS9 A;  2P72 A;  2P6W A;  1W57 A;  3IOI A;  4G3Q A;  2A8U A;  1EYR A;  3V0O A;  2V0L A;  2ICX A;  2Z87 A;  1JV1 A;  5C4C A;  2FYA A;  1GQC A;  3JUJ A;  4HO4 A;  2AM3 A;  3TQD A;  1I52 A;  1GX4 A;  4YS8 A;  4KPX A;  4C2S A;  3EE5 A;  1EZI A;  5BXC A;  2FY7 A;  4EEA A;  5FU8 A;  3SXE A;  2CU2 A;  2OI6 A;  2A8W A;  1KWS A;  1YP4 A;  3CKQ A;  2AEC A;  5C36 A;  2BO4 A;  4MND A;  3Q7U A;  1PZY B;  1H5T B;  3ZLK A;  1ZDG A;  4KC4 A;  2XWN A;  4EE5 A;  2FYD B;  3OH2 A;  5EJZ A;  4Y6N A;  4FRD A;  5CMI A;  5JQQ A;  1GX0 A;  1ZCU A;  1ZJ1 A;  3LW6 A;  2RJ7 A;  1YP2 A;  3V0N A;  5C4B A;  4Y7F A;  1ZJ0 A;  1S4O A;  3V8Z A;  2RJ9 A;  3SXD A;  4NAI A;  1HV9 A;  2AM5 A;  4E1K A;  4NAL A;  1LVW A;  1ZDF A;  4KPZ A;  3DK5 A;  1QWJ A;  4J18 A;  1MP4 A;  5CMG X;  1VPA A;  2X5S A;  5AJN A;  1O7Q A;  2V0I A;  3CKN A;  4M2B A;  3V8Y A;  3RMW A;  2PA4 A;  2Y4L A;  1G8O A;  1H5R B;  3F1C A;  4P02 A;  3OKR A;  2YC5 A;  3I0H A;  1WT2 A;  4HO8 A;  2OI7 A;  4G87 A;  2YCM A;  3SX3 A;  3U2X A;  4AYL A;  1VGU A;  1R7Y A;  1G0R A;  1FO9 A;  4D0Z A;  5CQL X;  3IOJ A;  3OH4 A;  1ZJP A;  1H7T A;  2VS4 A;  5C4E A;  4BQH A;  4FRM A;  1FGX A;  3ZF8 A;  4B42 A;  3D98 A;  4L41 C;  3E25 A;  5FU0 A;  2YQH A;  2O1H A;  4XWI A;  2WVM A;  4FRH A;  4KXO A;  4M2A A;  4ECM A;  1JYK A;  2WVK A;  4Y64 A;  5C3B A;  3ZGG A;  3N9W A;  2X5Z A;  4Y62 A;  2RJ5 A;  1HM0 A;  5DDV A;  1NKH B;  1FR8 A;  3SX7 A;  1R7V A;  1H5S A;  1YP3 A;  2W0V A;  3Q80 A;  3V0L A;  4EE3 A;  1G2V A;  4FRO A;  3JUK A;  3U0Y A;  4B4G A;  4ASJ A;  5C1L A;  4CJB A;  3USR A;  4D11 C;  3V0Q A;  1JVD A;  4EVW A;  2WVL A;  2D7R A;  2BO7 A;  4Y9X A;  1W55 A;  1ZJ3 A;  4BMA A;  2RIZ A;  2JCO A;  1S4N A;  2QKX A;  2O1F A;  1K4V A;  1NF5 B;  5AJP A;  1GWV A;  1FXO A;  2JCL A;  3D5N A;  1G95 A;  2D0J A;  1GQ9 A;  5C4F A;  2I5K A;  3TZT A;  2VSI A;  1VIC A;  4D48 A;  2WAW A;  1PZT A;  1G97 A;  2XWL A;  3K8D A;  4B2X A;  5C1G A;  2VSH A;  2JCJ A;  3CKO A;  4AYJ A;  5FTV A;  4B4B A;  3OGZ A;  2X65 A;  4Y7T A;  1OQM B;  3SPT A;  3U2U A;  1JV3 A;  1IIM A;  2YQS A;  4FRE A;  4ASY A;  4EE4 A;  1VGZ A;  3CKV A;  5CQP A;  2JCK A;  1H4E A;  3CKJ A;  1NHE B;  1R81 A;  5C3A A;  1ZI5 A;  4FRQ A;  1XZ6 A;  1JVG A;  3OH3 A;  1OMZ A;  3I0I X;  5FUH A;  5EJ1 A;  2AM4 A;  1H7F A;  2ZU9 A;  4HO5 A;  5C49 A;  3I0E A;  3R2W A;  2AGD A;  2Q4J A;  4HO0 A;  1INJ A;  5FYE A;  4FRL A;  2FYB A;  5I1F A;  2XMH A;  1FO8 A;  2Y4M A;  2VXM A;  2VS5 A;  3I0D A;  2UX8 A;  2WE9 A;  1O23 B;  2XME A;  5FV9 A;  1G1L A;  5CMF X;  3ST8 A;  3Q4S A;  1HJL A;  1H5T A;  1G93 A;  4HO9 A;  3T7N A;  4UEG A;  4HG6 A;  2BO6 A;  1ZIZ A;  1XHB A;  5AJO A;  3V90 A;  3PKP A;  1LL2 A;  1GWW A;  3SXC A;  3FOQ A;  2RJ8 A;  4AC3 A;  3I0C A;  2RJ6 A;  4ARW A;  3SXG A;  4KNX A;  3PKQ A;  3I0L A;  4FCE A;  3O3P A;  5C47 A;  4KQL A;  1VGT A;  2YC3 A;  3T7M A;  1H5S B;  3PNN A;  4P00 A;  4CJ8 A;  1H5S C;  4ZDQ A;  1ZCT A;  2Y4K A;  2WGZ A;  3I0G A;  4R7P A;  4CVH A;  2OEG A;  2I5E A;  3T7O A;  1ZJ2 A;  4DEC A;  1LZJ A;  1H4D A;  1ON8 A;  1NWG B;  1V82 A;  2YQC A;  1H7Q A;  3U2V A;  1HJJ A;  3POL A;  2RJ0 A;  5CQN X;  1QGQ A;  1VZU A;  1O0R A;  1HM8 A;  1VH1 A;  4NAN A;  3CGX A;  3I0J A;  4KT7 A;  3I0F A;  2ZU8 A;  1GA8 A;  2YQJ A;  2RIT A;  1FGG A;  5HS2 A;  2V0J A;  4HCQ A;  3V0M A;  4EEG A;  5C8R A;  1QG8 A;  4DDZ A;  4B4M A;  1Z90 A;  4EEO A;  1ZCV A;  5L6S A;  1VZT A;  2WEE A;  5C1H A;  4CJC A;  4KC1 A;  3V0P A;  1S4P A;  2RJ1 A;  1VH3 A;  2RJ4 A;  4MYB A;  1TW5 A;  2GGQ A;  3ZLL A;  4D0T A;  5CMJ A;  4K6R A;  3BRK X;  5C38 A;  1H7E A;  4HO2 A;  2P73 A;  1ZJO A;  4Y63 A;  4Y7V A;  4GBP A;  1MC3 A;  1G3L A;  2I7B A;  3OH0 A;  2XWM A;  3SX5 A;  3V91 A; 
#chains in the Genus database with same CATH topology
 5CQO A;  1FR9 A;  5L6V A;  3CU0 A;  3F1Y A;  1ZI1 A;  1TVY A;  3U2T A;  1G9R A;  1NQI B;  3ZGF A;  1LL0 A;  2RIY A;  4JIS A;  4FRP A;  2VD4 A;  1H4C A;  2V0K A;  1ON6 A;  1R82 A;  3SXA A;  2Y6P A;  3IOH A;  4LW3 A;  2OI5 A;  4B3U A;  1V84 A;  2PX7 A;  2FYC B;  4FRB A;  1FZW A;  3BCV A;  2Z86 A;  2E3D A;  1IIN A;  1H5S D;  2AH9 A;  4G3S A;  4IRP A;  1INI A;  2AE7 A;  4Y6U A;  1ZI3 A;  1JYL A;  1FG5 N;  3RMV A;  3SX8 A;  5IDS A;  1R80 A;  4M4K A;  1MP3 A;  3GUE A;  4HO3 A;  1MP5 A;  2ICY A;  1VM8 A;  1H7H A;  5CQM X;  1OMX A;  1H7G A;  4DE7 A;  2PGV A;  2VS3 A;  2AES A;  1QGS A;  1FXJ A;  3HL3 A;  1FRW A;  4IRQ A;  4B5B A;  5FTS A;  3K8E A;  2BO8 A;  2C0N A;  2D7I A;  4EEM A;  1V83 A;  2OEF A;  3D8V A;  1ZHJ A;  2FFV A;  1G23 A;  2PGY A;  2QH5 A;  4NAK A;  1TW1 A;  2VXL A;  2GGO A;  1H7L A;  4G3P A;  3QVB A;  5DDT A;  2Y4J A;  3R3I A;  1H5R A;  4HOC A;  4KRV A;  5CMH A;  4B2W A;  4KNR A;  3OH1 A;  5C4D A;  4LW6 A;  1WT3 A;  1LZ7 A;  4FCU A;  1NMM B;  1VZX A;  2NXV A;  2E8B A;  1HM9 A;  1LZ0 A;  1WT0 A;  1E5K A;  1TZF A;  1ZCY A;  4KC2 A;  2DPW A;  2RIX A;  3NGW A;  3I0K A;  3JTJ A;  2FFU A;  5J49 A;  2Y7A A;  4Y7U A;  5EIY A;  5C48 A;  3DJ4 A;  2O1G A;  3USQ A;  3OC9 A;  1R7T A;  4Y7G A;  2W0W A;  1R7U A;  5IFY A;  1FOA A;  1FWY A;  4M28 A;  3SXB A;  2QGI A;  3DUV A;  4FRA A;  1YRO B;  3OAM A;  4AAW A;  3E26 A;  5IDT A;  2ZU7 A;  5C3D A;  2YES A;  1ZI4 A;  1VGW A;  4FQW A;  1R7X A;  1W77 A;  1LL3 A;  1O7O A;  4JD0 A;  2X60 A;  2MZB A;  2APC A;  3FWW A;  1WVC A;  2V0H A;  4D11 A;  1WSZ A;  3U0X A;  1H3M A;  3U2W A;  1WT1 A;  3KIA A;  2VFZ A;  3RSB A;  4HO6 A;  1LZI A;  1SS9 A;  2P72 A;  4FIY A;  2P6W A;  1W57 A;  3IOI A;  2J0B A;  4G3Q A;  2A8U A;  1EYR A;  3V0O A;  2V0L A;  2ICX A;  2Z87 A;  1JV1 A;  5C4C A;  2FYA A;  1GQC A;  3JUJ A;  4HO4 A;  2AM3 A;  3TQD A;  1I52 A;  1GX4 A;  4YS8 A;  4KPX A;  2VK9 A;  4C2S A;  3EE5 A;  1EZI A;  5BXC A;  2FY7 A;  4EEA A;  5FU8 A;  3SXE A;  2CU2 A;  2OI6 A;  2A8W A;  1KWS A;  1YP4 A;  3CKQ A;  2AEC A;  5C36 A;  2BO4 A;  4MND A;  3Q7U A;  1PZY B;  1H5T B;  3ZLK A;  1ZDG A;  4KC4 A;  2XWN A;  4EE5 A;  2FYD B;  3OH2 A;  5EJZ A;  4Y6N A;  4FRD A;  5CMI A;  5JQQ A;  1GX0 A;  1ZCU A;  1ZJ1 A;  3LW6 A;  2RJ7 A;  1YP2 A;  3V0N A;  5C4B A;  4Y7F A;  1ZJ0 A;  1S4O A;  3V8Z A;  2RJ9 A;  3SXD A;  4NAI A;  1HV9 A;  2AM5 A;  4E1K A;  4NAL A;  1LVW A;  1ZDF A;  4KPZ A;  3DK5 A;  1QWJ A;  4J18 A;  1MP4 A;  5CMG X;  1VPA A;  2X5S A;  5AJN A;  1O7Q A;  2V0I A;  3CKN A;  4M2B A;  3V8Y A;  3RMW A;  2PA4 A;  2Y4L A;  1G8O A;  1H5R B;  3F1C A;  4P02 A;  3OKR A;  2YC5 A;  3I0H A;  1WT2 A;  4HO8 A;  2OI7 A;  4O6N A;  4G87 A;  2YCM A;  3SX3 A;  3U2X A;  4AYL A;  1VGU A;  1R7Y A;  1G0R A;  1FO9 A;  4D0Z A;  5CQL X;  3IOJ A;  3OH4 A;  1ZJP A;  1H7T A;  2VS4 A;  5C4E A;  4BQH A;  4FRM A;  1FGX A;  3ZF8 A;  4B42 A;  3D98 A;  4L41 C;  3E25 A;  5FU0 A;  2YQH A;  2O1H A;  4XWI A;  2WVM A;  4FRH A;  4KXO A;  4M2A A;  4ECM A;  1JYK A;  2WVK A;  4Y64 A;  5C3B A;  3ZGG A;  3N9W A;  2X5Z A;  4Y62 A;  5D92 A;  2RJ5 A;  1HM0 A;  5DDV A;  1NKH B;  1FR8 A;  3SX7 A;  2J0A A;  1R7V A;  1H5S A;  1YP3 A;  2W0V A;  3Q80 A;  3V0L A;  4EE3 A;  1G2V A;  4FRO A;  3JUK A;  3U0Y A;  4B4G A;  4ASJ A;  5C1L A;  4CJB A;  3USR A;  4D11 C;  3V0Q A;  4FIX A;  1JVD A;  4O6M A;  4EVW A;  2WVL A;  2D7R A;  4Q7C A;  2BO7 A;  4Y9X A;  1W55 A;  1ZJ3 A;  4BMA A;  2RIZ A;  2JCO A;  1S4N A;  2QKX A;  2O1F A;  1K4V A;  1NF5 B;  5AJP A;  1GWV A;  1FXO A;  2JCL A;  3D5N A;  1G95 A;  2D0J A;  1GQ9 A;  5C4F A;  2I5K A;  3TZT A;  2VSI A;  1VIC A;  4D48 A;  2WAW A;  1PZT A;  1G97 A;  2XWL A;  3K8D A;  4B2X A;  5C1G A;  2VSH A;  2JCJ A;  3CKO A;  4AYJ A;  5FTV A;  4B4B A;  3OGZ A;  2X65 A;  4Y7T A;  1OQM B;  3SPT A;  3U2U A;  1JV3 A;  1IIM A;  2YQS A;  4FRE A;  4ASY A;  4EE4 A;  1VGZ A;  3CKV A;  5CQP A;  2JCK A;  1H4E A;  3CKJ A;  1NHE B;  1R81 A;  5C3A A;  1ZI5 A;  4FRQ A;  1XZ6 A;  1JVG A;  3OH3 A;  1OMZ A;  3I0I X;  5FUH A;  5EJ1 A;  2AM4 A;  1H7F A;  2ZU9 A;  4HO5 A;  5C49 A;  3I0E A;  3R2W A;  2AGD A;  2Q4J A;  4HO0 A;  1INJ A;  5FYE A;  4FRL A;  2FYB A;  5I1F A;  2XMH A;  1FO8 A;  2Y4M A;  2VXM A;  2VS5 A;  3I0D A;  2UX8 A;  2WE9 A;  1O23 B;  2XME A;  5FV9 A;  1G1L A;  5CMF X;  3ST8 A;  3Q4S A;  1HJL A;  1H5T A;  1G93 A;  4HO9 A;  3T7N A;  4UEG A;  4HG6 A;  2BO6 A;  4MIX A;  1ZIZ A;  1XHB A;  5D91 A;  5AJO A;  3V90 A;  3PKP A;  1LL2 A;  1GWW A;  3SXC A;  3FOQ A;  2RJ8 A;  4AC3 A;  3I0C A;  2RJ6 A;  4ARW A;  3SXG A;  4KNX A;  3PKQ A;  3I0L A;  4FCE A;  3O3P A;  5C47 A;  4KQL A;  1VGT A;  2YC3 A;  3T7M A;  1H5S B;  3PNN A;  4P00 A;  4CJ8 A;  1H5S C;  4ZDQ A;  1ZCT A;  2Y4K A;  2WGZ A;  3I0G A;  4R7P A;  4CVH A;  2OEG A;  2I5E A;  3T7O A;  1ZJ2 A;  4DEC A;  1LZJ A;  1H4D A;  1ON8 A;  1NWG B;  1V82 A;  2YQC A;  1H7Q A;  3U2V A;  1HJJ A;  3POL A;  2RJ0 A;  5CQN X;  1QGQ A;  1VZU A;  1O0R A;  1HM8 A;  1VH1 A;  4NAN A;  3CGX A;  3I0J A;  4KT7 A;  3I0F A;  2ZU8 A;  1GA8 A;  2YQJ A;  2RIT A;  1FGG A;  5HS2 A;  2V0J A;  4HCQ A;  3V0M A;  4EEG A;  5C8R A;  1QG8 A;  4DDZ A;  4B4M A;  1Z90 A;  4EEO A;  1ZCV A;  5L6S A;  1VZT A;  2WEE A;  5C1H A;  4CJC A;  4KC1 A;  3V0P A;  1S4P A;  2RJ1 A;  1VH3 A;  2RJ4 A;  4MYB A;  1TW5 A;  2GGQ A;  3ZLL A;  4D0T A;  5CMJ A;  4K6R A;  3BRK X;  5C38 A;  1H7E A;  4HO2 A;  2P73 A;  1ZJO A;  4Y63 A;  4Y7V A;  4GBP A;  1MC3 A;  1G3L A;  2I7B A;  3OH0 A;  2XWM A;  3SX5 A;  3V91 A; 
#chains in the Genus database with same CATH homology
 5CQO A;  1FR9 A;  5L6V A;  3CU0 A;  3F1Y A;  1ZI1 A;  1TVY A;  3U2T A;  1G9R A;  1NQI B;  3ZGF A;  1LL0 A;  2RIY A;  4JIS A;  4FRP A;  2VD4 A;  1H4C A;  2V0K A;  1ON6 A;  1R82 A;  3SXA A;  2Y6P A;  3IOH A;  4LW3 A;  2OI5 A;  4B3U A;  1V84 A;  2PX7 A;  2FYC B;  4FRB A;  1FZW A;  3BCV A;  2Z86 A;  2E3D A;  1IIN A;  1H5S D;  2AH9 A;  4G3S A;  4IRP A;  1INI A;  2AE7 A;  4Y6U A;  1ZI3 A;  1JYL A;  1FG5 N;  3RMV A;  3SX8 A;  5IDS A;  1R80 A;  4M4K A;  1MP3 A;  3GUE A;  4HO3 A;  1MP5 A;  2ICY A;  1VM8 A;  1H7H A;  5CQM X;  1OMX A;  1H7G A;  4DE7 A;  2PGV A;  2VS3 A;  2AES A;  1QGS A;  1FXJ A;  3HL3 A;  1FRW A;  4IRQ A;  4B5B A;  5FTS A;  3K8E A;  2BO8 A;  2C0N A;  2D7I A;  4EEM A;  1V83 A;  2OEF A;  3D8V A;  1ZHJ A;  2FFV A;  1G23 A;  2PGY A;  2QH5 A;  4NAK A;  1TW1 A;  2VXL A;  2GGO A;  1H7L A;  4G3P A;  3QVB A;  5DDT A;  2Y4J A;  3R3I A;  1H5R A;  4HOC A;  4KRV A;  5CMH A;  4B2W A;  4KNR A;  3OH1 A;  5C4D A;  4LW6 A;  1WT3 A;  1LZ7 A;  4FCU A;  1NMM B;  1VZX A;  2NXV A;  2E8B A;  1HM9 A;  1LZ0 A;  1WT0 A;  1E5K A;  1TZF A;  1ZCY A;  4KC2 A;  2DPW A;  2RIX A;  3NGW A;  3I0K A;  3JTJ A;  2FFU A;  5J49 A;  2Y7A A;  4Y7U A;  5EIY A;  5C48 A;  3DJ4 A;  2O1G A;  3USQ A;  3OC9 A;  1R7T A;  4Y7G A;  2W0W A;  1R7U A;  5IFY A;  1FOA A;  1FWY A;  4M28 A;  3SXB A;  2QGI A;  3DUV A;  4FRA A;  1YRO B;  3OAM A;  4AAW A;  3E26 A;  5IDT A;  2ZU7 A;  5C3D A;  2YES A;  1ZI4 A;  1VGW A;  4FQW A;  1R7X A;  1W77 A;  1LL3 A;  1O7O A;  4JD0 A;  2X60 A;  2MZB A;  2APC A;  3FWW A;  1WVC A;  2V0H A;  4D11 A;  1WSZ A;  3U0X A;  1H3M A;  3U2W A;  1WT1 A;  3KIA A;  2VFZ A;  3RSB A;  4HO6 A;  1LZI A;  1SS9 A;  2P72 A;  4FIY A;  2P6W A;  1W57 A;  3IOI A;  2J0B A;  4G3Q A;  2A8U A;  1EYR A;  3V0O A;  2V0L A;  2ICX A;  2Z87 A;  1JV1 A;  5C4C A;  2FYA A;  1GQC A;  3JUJ A;  4HO4 A;  2AM3 A;  3TQD A;  1I52 A;  1GX4 A;  4YS8 A;  4KPX A;  2VK9 A;  4C2S A;  3EE5 A;  1EZI A;  5BXC A;  2FY7 A;  4EEA A;  5FU8 A;  3SXE A;  2CU2 A;  2OI6 A;  2A8W A;  1KWS A;  1YP4 A;  3CKQ A;  2AEC A;  5C36 A;  2BO4 A;  4MND A;  3Q7U A;  1PZY B;  1H5T B;  3ZLK A;  1ZDG A;  4KC4 A;  2XWN A;  4EE5 A;  2FYD B;  3OH2 A;  5EJZ A;  4Y6N A;  4FRD A;  5CMI A;  5JQQ A;  1GX0 A;  1ZCU A;  1ZJ1 A;  3LW6 A;  2RJ7 A;  1YP2 A;  3V0N A;  5C4B A;  4Y7F A;  1ZJ0 A;  1S4O A;  3V8Z A;  2RJ9 A;  3SXD A;  4NAI A;  1HV9 A;  2AM5 A;  4E1K A;  4NAL A;  1LVW A;  1ZDF A;  4KPZ A;  3DK5 A;  1QWJ A;  4J18 A;  1MP4 A;  5CMG X;  1VPA A;  2X5S A;  5AJN A;  1O7Q A;  2V0I A;  3CKN A;  4M2B A;  3V8Y A;  3RMW A;  2PA4 A;  2Y4L A;  1G8O A;  1H5R B;  3F1C A;  4P02 A;  3OKR A;  2YC5 A;  3I0H A;  1WT2 A;  4HO8 A;  2OI7 A;  4O6N A;  4G87 A;  2YCM A;  3SX3 A;  3U2X A;  4AYL A;  1VGU A;  1R7Y A;  1G0R A;  1FO9 A;  4D0Z A;  5CQL X;  3IOJ A;  3OH4 A;  1ZJP A;  1H7T A;  2VS4 A;  5C4E A;  4BQH A;  4FRM A;  1FGX A;  3ZF8 A;  4B42 A;  3D98 A;  4L41 C;  3E25 A;  5FU0 A;  2YQH A;  2O1H A;  4XWI A;  2WVM A;  4FRH A;  4KXO A;  4M2A A;  4ECM A;  1JYK A;  2WVK A;  4Y64 A;  5C3B A;  3ZGG A;  3N9W A;  2X5Z A;  4Y62 A;  5D92 A;  2RJ5 A;  1HM0 A;  5DDV A;  1NKH B;  1FR8 A;  3SX7 A;  2J0A A;  1R7V A;  1H5S A;  1YP3 A;  2W0V A;  3Q80 A;  3V0L A;  4EE3 A;  1G2V A;  4FRO A;  3JUK A;  3U0Y A;  4B4G A;  4ASJ A;  5C1L A;  4CJB A;  3USR A;  4D11 C;  3V0Q A;  4FIX A;  1JVD A;  4O6M A;  4EVW A;  2WVL A;  2D7R A;  4Q7C A;  2BO7 A;  4Y9X A;  1W55 A;  1ZJ3 A;  4BMA A;  2RIZ A;  2JCO A;  1S4N A;  2QKX A;  2O1F A;  1K4V A;  1NF5 B;  5AJP A;  1GWV A;  1FXO A;  2JCL A;  3D5N A;  1G95 A;  2D0J A;  1GQ9 A;  5C4F A;  2I5K A;  3TZT A;  2VSI A;  1VIC A;  4D48 A;  2WAW A;  1PZT A;  1G97 A;  2XWL A;  3K8D A;  4B2X A;  5C1G A;  2VSH A;  2JCJ A;  3CKO A;  4AYJ A;  5FTV A;  4B4B A;  3OGZ A;  2X65 A;  4Y7T A;  1OQM B;  3SPT A;  3U2U A;  1JV3 A;  1IIM A;  2YQS A;  4FRE A;  4ASY A;  4EE4 A;  1VGZ A;  3CKV A;  5CQP A;  2JCK A;  1H4E A;  3CKJ A;  1NHE B;  1R81 A;  5C3A A;  1ZI5 A;  4FRQ A;  1XZ6 A;  1JVG A;  3OH3 A;  1OMZ A;  3I0I X;  5FUH A;  5EJ1 A;  2AM4 A;  1H7F A;  2ZU9 A;  4HO5 A;  5C49 A;  3I0E A;  3R2W A;  2AGD A;  2Q4J A;  4HO0 A;  1INJ A;  5FYE A;  4FRL A;  2FYB A;  5I1F A;  2XMH A;  1FO8 A;  2Y4M A;  2VXM A;  2VS5 A;  3I0D A;  2UX8 A;  2WE9 A;  1O23 B;  2XME A;  5FV9 A;  1G1L A;  5CMF X;  3ST8 A;  3Q4S A;  1HJL A;  1H5T A;  1G93 A;  4HO9 A;  3T7N A;  4UEG A;  4HG6 A;  2BO6 A;  4MIX A;  1ZIZ A;  1XHB A;  5D91 A;  5AJO A;  3V90 A;  3PKP A;  1LL2 A;  1GWW A;  3SXC A;  3FOQ A;  2RJ8 A;  4AC3 A;  3I0C A;  2RJ6 A;  4ARW A;  3SXG A;  4KNX A;  3PKQ A;  3I0L A;  4FCE A;  3O3P A;  5C47 A;  4KQL A;  1VGT A;  2YC3 A;  3T7M A;  1H5S B;  3PNN A;  4P00 A;  4CJ8 A;  1H5S C;  4ZDQ A;  1ZCT A;  2Y4K A;  2WGZ A;  3I0G A;  4R7P A;  4CVH A;  2OEG A;  2I5E A;  3T7O A;  1ZJ2 A;  4DEC A;  1LZJ A;  1H4D A;  1ON8 A;  1NWG B;  1V82 A;  2YQC A;  1H7Q A;  3U2V A;  1HJJ A;  3POL A;  2RJ0 A;  5CQN X;  1QGQ A;  1VZU A;  1O0R A;  1HM8 A;  1VH1 A;  4NAN A;  3CGX A;  3I0J A;  4KT7 A;  3I0F A;  2ZU8 A;  1GA8 A;  2YQJ A;  2RIT A;  1FGG A;  5HS2 A;  2V0J A;  4HCQ A;  3V0M A;  4EEG A;  5C8R A;  1QG8 A;  4DDZ A;  4B4M A;  1Z90 A;  4EEO A;  1ZCV A;  5L6S A;  1VZT A;  2WEE A;  5C1H A;  4CJC A;  4KC1 A;  3V0P A;  1S4P A;  2RJ1 A;  1VH3 A;  2RJ4 A;  4MYB A;  1TW5 A;  2GGQ A;  3ZLL A;  4D0T A;  5CMJ A;  4K6R A;  3BRK X;  5C38 A;  1H7E A;  4HO2 A;  2P73 A;  1ZJO A;  4Y63 A;  4Y7V A;  4GBP A;  1MC3 A;  1G3L A;  2I7B A;  3OH0 A;  2XWM A;  3SX5 A;  3V91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...