2VXMA

Screening a limited structure-based library identifies udp-galnac- specific mutants of alpha-1,3 galactosyltransferase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
273
structure length
268
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYRAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Screening a Limited Structure-Based Library Identifies Udp-Galnac-Specific Mutants of {Alpha}-1,3-Galactosyltransferase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 85
structure length 268
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2008-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2vxmA00
1ZI3A 4C2SA 3PNNA 2PGYA 1H5SC 4AYJA 2BO6A 3RMVA 3FWWA 4P00A 3CKQA 1GWVA 1VGZA 1G3LA 5EIYA 5AJPA 4NANA 3SXDA 3IOIA 2OI6A 3ZGFA 1NMMB 1NKHB 5CMJA 2CU2A 2D7IA 3EE5A 4M28A 5I1FA 4CVHA 3DJ4A 4ZDQA 3OH3A 5C1HA 1OMZA 2I5EA 4ASYA 3ZLLA 1R7UA 2RIXA 2A8UA 2VS5A 4KC4A 4HO6A 4EEAA 5BXCA 1FOAA 1IINA 4FRQA 4HO8A 1FRWA 1FO8A 2OI5A 4J18A 2RJ4A 5DDTA 4KNXA 5L6VA 1E5KA 1TW1A 1ZJPA 2XMEA 3T7NA 1S4NA 4Y62A 3U2XA 4FQWA 4KPXA 1I52A 2X5SA 3K8EA 1LL2A 3IOHA 2RIZA 2Z86A 4Y9XA 1INJA 4FRAA 2WVLA 1VGWA 4NAIA 2W0WA 4M2BA 2VD4A 1FWYA 4HO2A 3SX8A 3I0CA 4B42A 2RJ7A 3USRA 3SX5A 2AE7A 1HM8A 4EEMA 2BO7A 5FTSA 1QWJA 1GQ9A 4KRVA 3T7OA 3CKNA 2WGZA 2V0LA 4M2AA 1Z90A 1VZUA 4Y7GA 1LZIA 3BRKX 3E26A 5EJ1A 1WSZA 2YC5A 1OMXA 2ICYA 5CMHA 3I0IX 2Z87A 4D0ZA 3U0XA 1PZTA 2V0KA 4Y6NA 1LL0A 2XWLA 3D8VA 3E25A 1H5TB 4HO9A 4M4KA 4EE3A 5C4FA 2E8BA 1S4PA 4B3UA 5C3AA 3CU0A 1INIA 3OH2A 3U2VA 2W0VA 2YQHA 4KQLA 4EE4A 5C3DA 1H4CA 1YROB 4HO4A 2VXLA 3T7MA 2YESA 1FR9A 1VZXA 1SS9A 3OKRA 1FR8A 4LW6A 3I0HA 5FV9A 3I0LA 3U2UA 1YP4A 1PZYB 4G3SA 3V0OA 2FYCB 1ZCYA 4Y7FA 4D11C 3GUEA 2Y4MA 2ICXA 3Q4SA 2X60A 1S4OA 4JD0A 1G97A 2WVKA 2V0HA 4P02A 4R7PA 1H5SB 1ZHJA 3OGZA 3NGWA 1GX4A 3V8YA 1H7HA 3SXCA 2Y4LA 5C38A 3JUJA 4BQHA 3OH1A 2JCKA 1V84A 1LZJA 3PKPA 1R7VA 1JVDA 3ZLKA 1H4EA 1GA8A 1QGQA 2GGQA 1ZCVA 5C1LA 1H4DA 1G8OA 1YP2A 4HOCA 4EVWA 3PKQA 1ZJOA 1G2VA 1H5SD 3SXBA 1KWSA 1H7EA 1ZI1A 4FRDA 4ARWA 1TW5A 4FRLA 2JCLA 2X65A 1ZI5A 2WEEA 3I0FA 2V0JA 2RIYA 4D48A 3V90A 4G3QA 3LW6A 5CQOA 1G9RA 5C4BA 1EYRA 5C4CA 2WVMA 5FUHA 5DDVA 3JUKA 3ZGGA 4Y7TA 4KPZA 1ZI4A 2RJ0A 4Y7VA 3ZF8A 1G93A 4AC3A 5C3BA 1R7TA 3TZTA 4XWIA 3IOJA 4MNDA 4JISA 3V0QA 2RJ8A 3F1CA 4KC1A 1FZWA 1WT1A 4GBPA 1WT0A 1H3MA 1JYLA 3SX7A 1VGUA 4HG6A 4AAWA 2O1FA 3CKOA 4Y63A 4KT7A 1JVGA 3F1YA 4HCQA 3U0YA 5L6SA 1W55A 2Q4JA 5CMGX 1H7LA 2O1HA 3OAMA 5FU0A 2A8WA 1G0RA 1XZ6A 4FRBA 1V83A 4B4BA 2MZBA 5AJNA 1R7XA 4CJCA 1VPAA 1TVYA 4FCUA 3DUVA 3USQA 2BO4A 3BCVA 2ZU9A 1HJLA 1VH3A 2QGIA 2QH5A 1ZJ0A 3ST8A 3DK5A 2OEFA 1ZJ1A 3CKVA 4B5BA 1GWWA 3HL3A 3V0NA 3FOQA 1WT2A 1O7QA 5J49A 4IRQA 4FROA 2Y6PA 5EJZA 2YCMA 5AJOA 3TQDA 2YQSA 2X5ZA 2VXMA 4NAKA 2VS3A 2AGDA 5C1GA 2E3DA 4BMAA 1ZDGA 4E1KA 2NXVA 4G87A 5C36A 4ASJA 1FXJA 4FRHA 3Q80A 1ZJ2A 4YS8A 1EZIA 3SXEA 2ZU7A 2D7RA 5IDTA 1FO9A 3I0DA 3SXGA 2AM5A 3KIAA 1LZ0A 1R81A 5FYEA 1H5RA 2O1GA 2WE9A 1NQIB 2JCOA 3I0EA 3V0PA 5C8RA 2YQCA 3RSBA 2YC3A 1O0RA 2QKXA 2DPWA 4G3PA 1WVCA 3RMWA 1MC3A 4ECMA 3JTJA 4Y7UA 1HM9A 4FRMA 2AECA 1VZTA 4CJBA 2P72A 1V82A 1H7TA 2WAWA 1LVWA 1G23A 1R7YA 5FU8A 2BO8A 2VFZA 2AH9A 1ZDFA 3V0LA 4L41C 3SXAA 3OH4A 2I5KA 4KXOA 4EEGA 1O23B 1ZCUA 5CMFX 2APCA 1H5RB 2AM4A 1QGSA 4B4MA 2FFVA 1ZJ3A 1VICA 1VM8A 4IRPA 1NWGB 4FCEA 1ON6A 2Y4JA 4FREA 4Y6UA 2GGOA 3N9WA 2FYAA 4HO0A 5CQNX 2XWNA 5C49A 5CQMX 4DE7A 1FGXA 2JCJA 4HO3A 2VSHA 3U2TA 4HO5A 1HJJA 2RJ9A 1LL3A 1YP3A 2PA4A 1GQCA 3D98A 4FRPA 3I0JA 1HV9A 2D0JA 1NHEB 1H5TA 1VGTA 5CQPA 1GX0A 1W77A 3SPTA 1FXOA 2V0IA 1JV3A 1LZ7A 1ON8A 1W57A 1MP3A 3V0MA 2I7BA 1QG8A 1G1LA 2P6WA 3SX3A 5C4DA 2XWMA 1JV1A 3POLA 3Q7UA 3U2WA 5CMIA 1FGGA 4UEGA 3K8DA 1JYKA 1R80A 1TZFA 3V91A 3OC9A 2OI7A 4B4GA 2UX8A 1H7FA 1MP4A 1ZCTA 5C4EA 1O7OA 2Y7AA 2ZU8A 1VH1A 4D0TA 1WT3A 2FYBA 4B2WA 1FG5N 1OQMB 2FY7A 1NF5B 2RJ1A 4DECA 3QVBA 4LW3A 5FTVA 2OEGA 4EEOA 3R3IA 3O3PA 5CQLX 2PGVA 3I0GA 2RJ5A 3CKJA 1MP5A 3CGXA 4KNRA 2AM3A 3V8ZA 4EE5A 1IIMA 4AYLA 5C48A 4DDZA 2P73A 2YQJA 2PX7A 5C47A 3OH0A 1K4VA 4D11A 1H5SA 3R2WA 2VS4A 5HS2A 1H7GA 1ZIZA 2FYDB 2FFUA 2Y4KA 2XMHA 2RITA 4K6RA 3D5NA 4B2XA 3I0KA 1H7QA 4CJ8A 1XHBA 4NALA 5JQQA 1G95A 5IFYA 4Y64A 1R82A 4KC2A 2AESA 2VSIA 2RJ6A 1HM0A 5IDSA 4MYBA
chains in the Genus database with same CATH superfamily
1ZI3A 4C2SA 3PNNA 2PGYA 1H5SC 4AYJA 2BO6A 3RMVA 3FWWA 4P00A 3CKQA 1GWVA 1VGZA 1G3LA 5EIYA 5AJPA 4NANA 3SXDA 3IOIA 2OI6A 3ZGFA 1NMMB 1NKHB 5CMJA 2CU2A 2D7IA 3EE5A 4M28A 5I1FA 4CVHA 3DJ4A 4ZDQA 3OH3A 5C1HA 1OMZA 2I5EA 4ASYA 3ZLLA 1R7UA 2RIXA 2A8UA 2VS5A 4KC4A 4HO6A 4EEAA 5BXCA 1FOAA 1IINA 4FRQA 4HO8A 1FRWA 1FO8A 2OI5A 4J18A 2RJ4A 5DDTA 4KNXA 5L6VA 1E5KA 1TW1A 1ZJPA 2XMEA 3T7NA 1S4NA 4Y62A 3U2XA 4FQWA 4KPXA 1I52A 2X5SA 3K8EA 1LL2A 3IOHA 2RIZA 2Z86A 4Y9XA 1INJA 4FRAA 2WVLA 1VGWA 4NAIA 2W0WA 4M2BA 2VD4A 1FWYA 4HO2A 3SX8A 3I0CA 4B42A 2RJ7A 3USRA 3SX5A 2AE7A 1HM8A 4EEMA 2BO7A 5FTSA 1QWJA 1GQ9A 4KRVA 3T7OA 3CKNA 2WGZA 4MIXA 2V0LA 4M2AA 1Z90A 1VZUA 4Y7GA 1LZIA 3BRKX 3E26A 5EJ1A 1WSZA 2YC5A 1OMXA 2ICYA 5CMHA 2VK9A 3I0IX 2Z87A 4D0ZA 3U0XA 1PZTA 2V0KA 4Y6NA 1LL0A 2XWLA 3D8VA 3E25A 1H5TB 4HO9A 4M4KA 4EE3A 5C4FA 4FIYA 2E8BA 1S4PA 4B3UA 5C3AA 3CU0A 1INIA 3OH2A 3U2VA 2W0VA 2YQHA 4KQLA 4EE4A 5C3DA 1H4CA 1YROB 4HO4A 2VXLA 3T7MA 2YESA 1FR9A 1VZXA 1SS9A 3OKRA 1FR8A 4LW6A 3I0HA 5FV9A 3I0LA 3U2UA 1YP4A 1PZYB 4G3SA 3V0OA 2FYCB 1ZCYA 4Y7FA 4D11C 3GUEA 2Y4MA 2ICXA 3Q4SA 2X60A 1S4OA 4JD0A 1G97A 2WVKA 2V0HA 4O6MA 4P02A 4R7PA 1H5SB 1ZHJA 3OGZA 3NGWA 1GX4A 3V8YA 1H7HA 3SXCA 2Y4LA 5C38A 3JUJA 4BQHA 3OH1A 2JCKA 1V84A 1LZJA 3PKPA 1R7VA 1JVDA 3ZLKA 1H4EA 1GA8A 1QGQA 2GGQA 1ZCVA 5C1LA 1H4DA 1G8OA 1YP2A 4HOCA 4EVWA 3PKQA 1ZJOA 1G2VA 1H5SD 3SXBA 1KWSA 1H7EA 1ZI1A 4FRDA 4ARWA 1TW5A 4FRLA 2JCLA 2X65A 1ZI5A 2WEEA 3I0FA 2V0JA 2C0NA 2RIYA 4D48A 3V90A 4G3QA 3LW6A 5CQOA 1G9RA 5C4BA 1EYRA 5C4CA 2WVMA 5FUHA 5DDVA 3JUKA 3ZGGA 4Y7TA 4KPZA 1ZI4A 2RJ0A 4Y7VA 3ZF8A 1G93A 4AC3A 5C3BA 1R7TA 3TZTA 4XWIA 3IOJA 4MNDA 4JISA 3V0QA 2RJ8A 3F1CA 4KC1A 1FZWA 1WT1A 4GBPA 1WT0A 4FIXA 1H3MA 1JYLA 3SX7A 1VGUA 4HG6A 4AAWA 2O1FA 3CKOA 4Y63A 4KT7A 1JVGA 3F1YA 4HCQA 3U0YA 5L6SA 1W55A 2Q4JA 5CMGX 5D91A 1H7LA 2O1HA 3OAMA 5FU0A 2A8WA 1G0RA 1XZ6A 4FRBA 1V83A 4Q7CA 4B4BA 2MZBA 5AJNA 1R7XA 4CJCA 4O6NA 1VPAA 2J0AA 1TVYA 4FCUA 3DUVA 3USQA 2BO4A 3BCVA 2ZU9A 1HJLA 1VH3A 2QGIA 2QH5A 1ZJ0A 3ST8A 3DK5A 2OEFA 1ZJ1A 3CKVA 4B5BA 1GWWA 3HL3A 3V0NA 3FOQA 1WT2A 1O7QA 5J49A 4IRQA 4FROA 2Y6PA 5EJZA 2YCMA 5AJOA 3TQDA 2YQSA 2X5ZA 2VXMA 4NAKA 2VS3A 2AGDA 5C1GA 2E3DA 4BMAA 1ZDGA 4E1KA 2NXVA 4G87A 5C36A 4ASJA 1FXJA 4FRHA 3Q80A 1ZJ2A 4YS8A 1EZIA 3SXEA 2ZU7A 2D7RA 5IDTA 1FO9A 3I0DA 3SXGA 2AM5A 3KIAA 1LZ0A 1R81A 5FYEA 1H5RA 2O1GA 2WE9A 1NQIB 2JCOA 3I0EA 3V0PA 5C8RA 2YQCA 3RSBA 2YC3A 1O0RA 2QKXA 2DPWA 4G3PA 1WVCA 3RMWA 1MC3A 4ECMA 3JTJA 4Y7UA 1HM9A 4FRMA 2AECA 1VZTA 4CJBA 2P72A 1V82A 1H7TA 2WAWA 1LVWA 1G23A 1R7YA 5FU8A 2BO8A 2VFZA 2AH9A 1ZDFA 3V0LA 4L41C 3SXAA 3OH4A 2I5KA 4KXOA 4EEGA 1O23B 1ZCUA 5CMFX 2APCA 1H5RB 2AM4A 1QGSA 4B4MA 2FFVA 1ZJ3A 1VICA 1VM8A 4IRPA 1NWGB 4FCEA 1ON6A 2Y4JA 4FREA 4Y6UA 2GGOA 3N9WA 2FYAA 4HO0A 5CQNX 2XWNA 5C49A 5CQMX 4DE7A 1FGXA 2JCJA 2J0BA 4HO3A 2VSHA 3U2TA 4HO5A 1HJJA 2RJ9A 1LL3A 1YP3A 2PA4A 1GQCA 3D98A 4FRPA 3I0JA 1HV9A 2D0JA 1NHEB 1H5TA 1VGTA 5CQPA 1GX0A 1W77A 3SPTA 1FXOA 2V0IA 1JV3A 1LZ7A 1ON8A 1W57A 1MP3A 3V0MA 5D92A 2I7BA 1QG8A 1G1LA 2P6WA 3SX3A 5C4DA 2XWMA 1JV1A 3POLA 3Q7UA 3U2WA 5CMIA 1FGGA 4UEGA 3K8DA 1JYKA 1R80A 1TZFA 3V91A 3OC9A 2OI7A 4B4GA 2UX8A 1H7FA 1MP4A 1ZCTA 5C4EA 1O7OA 2Y7AA 2ZU8A 1VH1A 4D0TA 1WT3A 2FYBA 4B2WA 1FG5N 1OQMB 2FY7A 1NF5B 2RJ1A 4DECA 3QVBA 4LW3A 5FTVA 2OEGA 4EEOA 3R3IA 3O3PA 5CQLX 2PGVA 3I0GA 2RJ5A 3CKJA 1MP5A 3CGXA 4KNRA 2AM3A 3V8ZA 4EE5A 1IIMA 4AYLA 5C48A 4DDZA 2P73A 2YQJA 2PX7A 5C47A 3OH0A 1K4VA 4D11A 1H5SA 3R2WA 2VS4A 5HS2A 1H7GA 1ZIZA 2FYDB 2FFUA 2Y4KA 2XMHA 2RITA 4K6RA 3D5NA 4B2XA 3I0KA 1H7QA 4CJ8A 1XHBA 4NALA 5JQQA 1G95A 5IFYA 4Y64A 1R82A 4KC2A 2AESA 2VSIA 2RJ6A 1HM0A 5IDSA 4MYBA
chains in the Genus database with same CATH topology
1ZI3A 4C2SA 3PNNA 2PGYA 1H5SC 4AYJA 2BO6A 3RMVA 3FWWA 4P00A 3CKQA 1GWVA 1VGZA 1G3LA 5EIYA 5AJPA 4NANA 3SXDA 3IOIA 2OI6A 3ZGFA 1NMMB 1NKHB 5CMJA 2CU2A 2D7IA 3EE5A 4M28A 5I1FA 4CVHA 3DJ4A 4ZDQA 3OH3A 5C1HA 1OMZA 2I5EA 4ASYA 3ZLLA 1R7UA 2RIXA 2A8UA 2VS5A 4KC4A 4HO6A 4EEAA 5BXCA 1FOAA 1IINA 4FRQA 4HO8A 1FRWA 1FO8A 2OI5A 4J18A 2RJ4A 5DDTA 4KNXA 5L6VA 1E5KA 1TW1A 1ZJPA 2XMEA 3T7NA 1S4NA 4Y62A 3U2XA 4FQWA 4KPXA 1I52A 2X5SA 3K8EA 1LL2A 3IOHA 2RIZA 2Z86A 4Y9XA 1INJA 4FRAA 2WVLA 1VGWA 4NAIA 2W0WA 4M2BA 2VD4A 1FWYA 4HO2A 3SX8A 3I0CA 4B42A 2RJ7A 3USRA 3SX5A 2AE7A 1HM8A 4EEMA 2BO7A 5FTSA 1QWJA 1GQ9A 4KRVA 3T7OA 3CKNA 2WGZA 4MIXA 2V0LA 4M2AA 1Z90A 1VZUA 4Y7GA 1LZIA 3BRKX 3E26A 5EJ1A 1WSZA 2YC5A 1OMXA 2ICYA 5CMHA 2VK9A 3I0IX 2Z87A 4D0ZA 3U0XA 1PZTA 2V0KA 4Y6NA 1LL0A 2XWLA 3D8VA 3E25A 1H5TB 4HO9A 4M4KA 4EE3A 5C4FA 4FIYA 2E8BA 1S4PA 4B3UA 5C3AA 3CU0A 1INIA 3OH2A 3U2VA 2W0VA 2YQHA 4KQLA 4EE4A 5C3DA 1H4CA 1YROB 4HO4A 2VXLA 3T7MA 2YESA 1FR9A 1VZXA 1SS9A 3OKRA 1FR8A 4LW6A 3I0HA 5FV9A 3I0LA 3U2UA 1YP4A 1PZYB 4G3SA 3V0OA 2FYCB 1ZCYA 4Y7FA 4D11C 3GUEA 2Y4MA 2ICXA 3Q4SA 2X60A 1S4OA 4JD0A 1G97A 2WVKA 2V0HA 4O6MA 4P02A 4R7PA 1H5SB 1ZHJA 3OGZA 3NGWA 1GX4A 3V8YA 1H7HA 3SXCA 2Y4LA 5C38A 3JUJA 4BQHA 3OH1A 2JCKA 1V84A 1LZJA 3PKPA 1R7VA 1JVDA 3ZLKA 1H4EA 1GA8A 1QGQA 2GGQA 1ZCVA 5C1LA 1H4DA 1G8OA 1YP2A 4HOCA 4EVWA 3PKQA 1ZJOA 1G2VA 1H5SD 3SXBA 1KWSA 1H7EA 1ZI1A 4FRDA 4ARWA 1TW5A 4FRLA 2JCLA 2X65A 1ZI5A 2WEEA 3I0FA 2V0JA 2C0NA 2RIYA 4D48A 3V90A 4G3QA 3LW6A 5CQOA 1G9RA 5C4BA 1EYRA 5C4CA 2WVMA 5FUHA 5DDVA 3JUKA 3ZGGA 4Y7TA 4KPZA 1ZI4A 2RJ0A 4Y7VA 3ZF8A 1G93A 4AC3A 5C3BA 1R7TA 3TZTA 4XWIA 3IOJA 4MNDA 4JISA 3V0QA 2RJ8A 3F1CA 4KC1A 1FZWA 1WT1A 4GBPA 1WT0A 4FIXA 1H3MA 1JYLA 3SX7A 1VGUA 4HG6A 4AAWA 2O1FA 3CKOA 4Y63A 4KT7A 1JVGA 3F1YA 4HCQA 3U0YA 5L6SA 1W55A 2Q4JA 5CMGX 5D91A 1H7LA 2O1HA 3OAMA 5FU0A 2A8WA 1G0RA 1XZ6A 4FRBA 1V83A 4Q7CA 4B4BA 2MZBA 5AJNA 1R7XA 4CJCA 4O6NA 1VPAA 2J0AA 1TVYA 4FCUA 3DUVA 3USQA 2BO4A 3BCVA 2ZU9A 1HJLA 1VH3A 2QGIA 2QH5A 1ZJ0A 3ST8A 3DK5A 2OEFA 1ZJ1A 3CKVA 4B5BA 1GWWA 3HL3A 3V0NA 3FOQA 1WT2A 1O7QA 5J49A 4IRQA 4FROA 2Y6PA 5EJZA 2YCMA 5AJOA 3TQDA 2YQSA 2X5ZA 2VXMA 4NAKA 2VS3A 2AGDA 5C1GA 2E3DA 4BMAA 1ZDGA 4E1KA 2NXVA 4G87A 5C36A 4ASJA 1FXJA 4FRHA 3Q80A 1ZJ2A 4YS8A 1EZIA 3SXEA 2ZU7A 2D7RA 5IDTA 1FO9A 3I0DA 3SXGA 2AM5A 3KIAA 1LZ0A 1R81A 5FYEA 1H5RA 2O1GA 2WE9A 1NQIB 2JCOA 3I0EA 3V0PA 5C8RA 2YQCA 3RSBA 2YC3A 1O0RA 2QKXA 2DPWA 4G3PA 1WVCA 3RMWA 1MC3A 4ECMA 3JTJA 4Y7UA 1HM9A 4FRMA 2AECA 1VZTA 4CJBA 2P72A 1V82A 1H7TA 2WAWA 1LVWA 1G23A 1R7YA 5FU8A 2BO8A 2VFZA 2AH9A 1ZDFA 3V0LA 4L41C 3SXAA 3OH4A 2I5KA 4KXOA 4EEGA 1O23B 1ZCUA 5CMFX 2APCA 1H5RB 2AM4A 1QGSA 4B4MA 2FFVA 1ZJ3A 1VICA 1VM8A 4IRPA 1NWGB 4FCEA 1ON6A 2Y4JA 4FREA 4Y6UA 2GGOA 3N9WA 2FYAA 4HO0A 5CQNX 2XWNA 5C49A 5CQMX 4DE7A 1FGXA 2JCJA 2J0BA 4HO3A 2VSHA 3U2TA 4HO5A 1HJJA 2RJ9A 1LL3A 1YP3A 2PA4A 1GQCA 3D98A 4FRPA 3I0JA 1HV9A 2D0JA 1NHEB 1H5TA 1VGTA 5CQPA 1GX0A 1W77A 3SPTA 1FXOA 2V0IA 1JV3A 1LZ7A 1ON8A 1W57A 1MP3A 3V0MA 5D92A 2I7BA 1QG8A 1G1LA 2P6WA 3SX3A 5C4DA 2XWMA 1JV1A 3POLA 3Q7UA 3U2WA 5CMIA 1FGGA 4UEGA 3K8DA 1JYKA 1R80A 1TZFA 3V91A 3OC9A 2OI7A 4B4GA 2UX8A 1H7FA 1MP4A 1ZCTA 5C4EA 1O7OA 2Y7AA 2ZU8A 1VH1A 4D0TA 1WT3A 2FYBA 4B2WA 1FG5N 1OQMB 2FY7A 1NF5B 2RJ1A 4DECA 3QVBA 4LW3A 5FTVA 2OEGA 4EEOA 3R3IA 3O3PA 5CQLX 2PGVA 3I0GA 2RJ5A 3CKJA 1MP5A 3CGXA 4KNRA 2AM3A 3V8ZA 4EE5A 1IIMA 4AYLA 5C48A 4DDZA 2P73A 2YQJA 2PX7A 5C47A 3OH0A 1K4VA 4D11A 1H5SA 3R2WA 2VS4A 5HS2A 1H7GA 1ZIZA 2FYDB 2FFUA 2Y4KA 2XMHA 2RITA 4K6RA 3D5NA 4B2XA 3I0KA 1H7QA 4CJ8A 1XHBA 4NALA 5JQQA 1G95A 5IFYA 4Y64A 1R82A 4KC2A 2AESA 2VSIA 2RJ6A 1HM0A 5IDSA 4MYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZI3 A;  4C2S A;  3PNN A;  2PGY A;  1H5S C;  4AYJ A;  2BO6 A;  3RMV A;  3FWW A;  4P00 A;  3CKQ A;  1GWV A;  1VGZ A;  1G3L A;  5EIY A;  5AJP A;  4NAN A;  3SXD A;  3IOI A;  2OI6 A;  3ZGF A;  1NMM B;  1NKH B;  5CMJ A;  2CU2 A;  2D7I A;  3EE5 A;  4M28 A;  5I1F A;  4CVH A;  3DJ4 A;  4ZDQ A;  3OH3 A;  5C1H A;  1OMZ A;  2I5E A;  4ASY A;  3ZLL A;  1R7U A;  2RIX A;  2A8U A;  2VS5 A;  4KC4 A;  4HO6 A;  4EEA A;  5BXC A;  1FOA A;  1IIN A;  4FRQ A;  4HO8 A;  1FRW A;  1FO8 A;  2OI5 A;  4J18 A;  2RJ4 A;  5DDT A;  4KNX A;  5L6V A;  1E5K A;  1TW1 A;  1ZJP A;  2XME A;  3T7N A;  1S4N A;  4Y62 A;  3U2X A;  4FQW A;  4KPX A;  1I52 A;  2X5S A;  3K8E A;  1LL2 A;  3IOH A;  2RIZ A;  2Z86 A;  4Y9X A;  1INJ A;  4FRA A;  2WVL A;  1VGW A;  4NAI A;  2W0W A;  4M2B A;  2VD4 A;  1FWY A;  4HO2 A;  3SX8 A;  3I0C A;  4B42 A;  2RJ7 A;  3USR A;  3SX5 A;  2AE7 A;  1HM8 A;  4EEM A;  2BO7 A;  5FTS A;  1QWJ A;  1GQ9 A;  4KRV A;  3T7O A;  3CKN A;  2WGZ A;  2V0L A;  4M2A A;  1Z90 A;  1VZU A;  4Y7G A;  1LZI A;  3BRK X;  3E26 A;  5EJ1 A;  1WSZ A;  2YC5 A;  1OMX A;  2ICY A;  5CMH A;  3I0I X;  2Z87 A;  4D0Z A;  3U0X A;  1PZT A;  2V0K A;  4Y6N A;  1LL0 A;  2XWL A;  3D8V A;  3E25 A;  1H5T B;  4HO9 A;  4M4K A;  4EE3 A;  5C4F A;  2E8B A;  1S4P A;  4B3U A;  5C3A A;  3CU0 A;  1INI A;  3OH2 A;  3U2V A;  2W0V A;  2YQH A;  4KQL A;  4EE4 A;  5C3D A;  1H4C A;  1YRO B;  4HO4 A;  2VXL A;  3T7M A;  2YES A;  1FR9 A;  1VZX A;  1SS9 A;  3OKR A;  1FR8 A;  4LW6 A;  3I0H A;  5FV9 A;  3I0L A;  3U2U A;  1YP4 A;  1PZY B;  4G3S A;  3V0O A;  2FYC B;  1ZCY A;  4Y7F A;  4D11 C;  3GUE A;  2Y4M A;  2ICX A;  3Q4S A;  2X60 A;  1S4O A;  4JD0 A;  1G97 A;  2WVK A;  2V0H A;  4P02 A;  4R7P A;  1H5S B;  1ZHJ A;  3OGZ A;  3NGW A;  1GX4 A;  3V8Y A;  1H7H A;  3SXC A;  2Y4L A;  5C38 A;  3JUJ A;  4BQH A;  3OH1 A;  2JCK A;  1V84 A;  1LZJ A;  3PKP A;  1R7V A;  1JVD A;  3ZLK A;  1H4E A;  1GA8 A;  1QGQ A;  2GGQ A;  1ZCV A;  5C1L A;  1H4D A;  1G8O A;  1YP2 A;  4HOC A;  4EVW A;  3PKQ A;  1ZJO A;  1G2V A;  1H5S D;  3SXB A;  1KWS A;  1H7E A;  1ZI1 A;  4FRD A;  4ARW A;  1TW5 A;  4FRL A;  2JCL A;  2X65 A;  1ZI5 A;  2WEE A;  3I0F A;  2V0J A;  2RIY A;  4D48 A;  3V90 A;  4G3Q A;  3LW6 A;  5CQO A;  1G9R A;  5C4B A;  1EYR A;  5C4C A;  2WVM A;  5FUH A;  5DDV A;  3JUK A;  3ZGG A;  4Y7T A;  4KPZ A;  1ZI4 A;  2RJ0 A;  4Y7V A;  3ZF8 A;  1G93 A;  4AC3 A;  5C3B A;  1R7T A;  3TZT A;  4XWI A;  3IOJ A;  4MND A;  4JIS A;  3V0Q A;  2RJ8 A;  3F1C A;  4KC1 A;  1FZW A;  1WT1 A;  4GBP A;  1WT0 A;  1H3M A;  1JYL A;  3SX7 A;  1VGU A;  4HG6 A;  4AAW A;  2O1F A;  3CKO A;  4Y63 A;  4KT7 A;  1JVG A;  3F1Y A;  4HCQ A;  3U0Y A;  5L6S A;  1W55 A;  2Q4J A;  5CMG X;  1H7L A;  2O1H A;  3OAM A;  5FU0 A;  2A8W A;  1G0R A;  1XZ6 A;  4FRB A;  1V83 A;  4B4B A;  2MZB A;  5AJN A;  1R7X A;  4CJC A;  1VPA A;  1TVY A;  4FCU A;  3DUV A;  3USQ A;  2BO4 A;  3BCV A;  2ZU9 A;  1HJL A;  1VH3 A;  2QGI A;  2QH5 A;  1ZJ0 A;  3ST8 A;  3DK5 A;  2OEF A;  1ZJ1 A;  3CKV A;  4B5B A;  1GWW A;  3HL3 A;  3V0N A;  3FOQ A;  1WT2 A;  1O7Q A;  5J49 A;  4IRQ A;  4FRO A;  2Y6P A;  5EJZ A;  2YCM A;  5AJO A;  3TQD A;  2YQS A;  2X5Z A;  2VXM A;  4NAK A;  2VS3 A;  2AGD A;  5C1G A;  2E3D A;  4BMA A;  1ZDG A;  4E1K A;  2NXV A;  4G87 A;  5C36 A;  4ASJ A;  1FXJ A;  4FRH A;  3Q80 A;  1ZJ2 A;  4YS8 A;  1EZI A;  3SXE A;  2ZU7 A;  2D7R A;  5IDT A;  1FO9 A;  3I0D A;  3SXG A;  2AM5 A;  3KIA A;  1LZ0 A;  1R81 A;  5FYE A;  1H5R A;  2O1G A;  2WE9 A;  1NQI B;  2JCO A;  3I0E A;  3V0P A;  5C8R A;  2YQC A;  3RSB A;  2YC3 A;  1O0R A;  2QKX A;  2DPW A;  4G3P A;  1WVC A;  3RMW A;  1MC3 A;  4ECM A;  3JTJ A;  4Y7U A;  1HM9 A;  4FRM A;  2AEC A;  1VZT A;  4CJB A;  2P72 A;  1V82 A;  1H7T A;  2WAW A;  1LVW A;  1G23 A;  1R7Y A;  5FU8 A;  2BO8 A;  2VFZ A;  2AH9 A;  1ZDF A;  3V0L A;  4L41 C;  3SXA A;  3OH4 A;  2I5K A;  4KXO A;  4EEG A;  1O23 B;  1ZCU A;  5CMF X;  2APC A;  1H5R B;  2AM4 A;  1QGS A;  4B4M A;  2FFV A;  1ZJ3 A;  1VIC A;  1VM8 A;  4IRP A;  1NWG B;  4FCE A;  1ON6 A;  2Y4J A;  4FRE A;  4Y6U A;  2GGO A;  3N9W A;  2FYA A;  4HO0 A;  5CQN X;  2XWN A;  5C49 A;  5CQM X;  4DE7 A;  1FGX A;  2JCJ A;  4HO3 A;  2VSH A;  3U2T A;  4HO5 A;  1HJJ A;  2RJ9 A;  1LL3 A;  1YP3 A;  2PA4 A;  1GQC A;  3D98 A;  4FRP A;  3I0J A;  1HV9 A;  2D0J A;  1NHE B;  1H5T A;  1VGT A;  5CQP A;  1GX0 A;  1W77 A;  3SPT A;  1FXO A;  2V0I A;  1JV3 A;  1LZ7 A;  1ON8 A;  1W57 A;  1MP3 A;  3V0M A;  2I7B A;  1QG8 A;  1G1L A;  2P6W A;  3SX3 A;  5C4D A;  2XWM A;  1JV1 A;  3POL A;  3Q7U A;  3U2W A;  5CMI A;  1FGG A;  4UEG A;  3K8D A;  1JYK A;  1R80 A;  1TZF A;  3V91 A;  3OC9 A;  2OI7 A;  4B4G A;  2UX8 A;  1H7F A;  1MP4 A;  1ZCT A;  5C4E A;  1O7O A;  2Y7A A;  2ZU8 A;  1VH1 A;  4D0T A;  1WT3 A;  2FYB A;  4B2W A;  1FG5 N;  1OQM B;  2FY7 A;  1NF5 B;  2RJ1 A;  4DEC A;  3QVB A;  4LW3 A;  5FTV A;  2OEG A;  4EEO A;  3R3I A;  3O3P A;  5CQL X;  2PGV A;  3I0G A;  2RJ5 A;  3CKJ A;  1MP5 A;  3CGX A;  4KNR A;  2AM3 A;  3V8Z A;  4EE5 A;  1IIM A;  4AYL A;  5C48 A;  4DDZ A;  2P73 A;  2YQJ A;  2PX7 A;  5C47 A;  3OH0 A;  1K4V A;  4D11 A;  1H5S A;  3R2W A;  2VS4 A;  5HS2 A;  1H7G A;  1ZIZ A;  2FYD B;  2FFU A;  2Y4K A;  2XMH A;  2RIT A;  4K6R A;  3D5N A;  4B2X A;  3I0K A;  1H7Q A;  4CJ8 A;  1XHB A;  4NAL A;  5JQQ A;  1G95 A;  5IFY A;  4Y64 A;  1R82 A;  4KC2 A;  2AES A;  2VSI A;  2RJ6 A;  1HM0 A;  5IDS A;  4MYB A; 
#chains in the Genus database with same CATH topology
 1ZI3 A;  4C2S A;  3PNN A;  2PGY A;  1H5S C;  4AYJ A;  2BO6 A;  3RMV A;  3FWW A;  4P00 A;  3CKQ A;  1GWV A;  1VGZ A;  1G3L A;  5EIY A;  5AJP A;  4NAN A;  3SXD A;  3IOI A;  2OI6 A;  3ZGF A;  1NMM B;  1NKH B;  5CMJ A;  2CU2 A;  2D7I A;  3EE5 A;  4M28 A;  5I1F A;  4CVH A;  3DJ4 A;  4ZDQ A;  3OH3 A;  5C1H A;  1OMZ A;  2I5E A;  4ASY A;  3ZLL A;  1R7U A;  2RIX A;  2A8U A;  2VS5 A;  4KC4 A;  4HO6 A;  4EEA A;  5BXC A;  1FOA A;  1IIN A;  4FRQ A;  4HO8 A;  1FRW A;  1FO8 A;  2OI5 A;  4J18 A;  2RJ4 A;  5DDT A;  4KNX A;  5L6V A;  1E5K A;  1TW1 A;  1ZJP A;  2XME A;  3T7N A;  1S4N A;  4Y62 A;  3U2X A;  4FQW A;  4KPX A;  1I52 A;  2X5S A;  3K8E A;  1LL2 A;  3IOH A;  2RIZ A;  2Z86 A;  4Y9X A;  1INJ A;  4FRA A;  2WVL A;  1VGW A;  4NAI A;  2W0W A;  4M2B A;  2VD4 A;  1FWY A;  4HO2 A;  3SX8 A;  3I0C A;  4B42 A;  2RJ7 A;  3USR A;  3SX5 A;  2AE7 A;  1HM8 A;  4EEM A;  2BO7 A;  5FTS A;  1QWJ A;  1GQ9 A;  4KRV A;  3T7O A;  3CKN A;  2WGZ A;  4MIX A;  2V0L A;  4M2A A;  1Z90 A;  1VZU A;  4Y7G A;  1LZI A;  3BRK X;  3E26 A;  5EJ1 A;  1WSZ A;  2YC5 A;  1OMX A;  2ICY A;  5CMH A;  2VK9 A;  3I0I X;  2Z87 A;  4D0Z A;  3U0X A;  1PZT A;  2V0K A;  4Y6N A;  1LL0 A;  2XWL A;  3D8V A;  3E25 A;  1H5T B;  4HO9 A;  4M4K A;  4EE3 A;  5C4F A;  4FIY A;  2E8B A;  1S4P A;  4B3U A;  5C3A A;  3CU0 A;  1INI A;  3OH2 A;  3U2V A;  2W0V A;  2YQH A;  4KQL A;  4EE4 A;  5C3D A;  1H4C A;  1YRO B;  4HO4 A;  2VXL A;  3T7M A;  2YES A;  1FR9 A;  1VZX A;  1SS9 A;  3OKR A;  1FR8 A;  4LW6 A;  3I0H A;  5FV9 A;  3I0L A;  3U2U A;  1YP4 A;  1PZY B;  4G3S A;  3V0O A;  2FYC B;  1ZCY A;  4Y7F A;  4D11 C;  3GUE A;  2Y4M A;  2ICX A;  3Q4S A;  2X60 A;  1S4O A;  4JD0 A;  1G97 A;  2WVK A;  2V0H A;  4O6M A;  4P02 A;  4R7P A;  1H5S B;  1ZHJ A;  3OGZ A;  3NGW A;  1GX4 A;  3V8Y A;  1H7H A;  3SXC A;  2Y4L A;  5C38 A;  3JUJ A;  4BQH A;  3OH1 A;  2JCK A;  1V84 A;  1LZJ A;  3PKP A;  1R7V A;  1JVD A;  3ZLK A;  1H4E A;  1GA8 A;  1QGQ A;  2GGQ A;  1ZCV A;  5C1L A;  1H4D A;  1G8O A;  1YP2 A;  4HOC A;  4EVW A;  3PKQ A;  1ZJO A;  1G2V A;  1H5S D;  3SXB A;  1KWS A;  1H7E A;  1ZI1 A;  4FRD A;  4ARW A;  1TW5 A;  4FRL A;  2JCL A;  2X65 A;  1ZI5 A;  2WEE A;  3I0F A;  2V0J A;  2C0N A;  2RIY A;  4D48 A;  3V90 A;  4G3Q A;  3LW6 A;  5CQO A;  1G9R A;  5C4B A;  1EYR A;  5C4C A;  2WVM A;  5FUH A;  5DDV A;  3JUK A;  3ZGG A;  4Y7T A;  4KPZ A;  1ZI4 A;  2RJ0 A;  4Y7V A;  3ZF8 A;  1G93 A;  4AC3 A;  5C3B A;  1R7T A;  3TZT A;  4XWI A;  3IOJ A;  4MND A;  4JIS A;  3V0Q A;  2RJ8 A;  3F1C A;  4KC1 A;  1FZW A;  1WT1 A;  4GBP A;  1WT0 A;  4FIX A;  1H3M A;  1JYL A;  3SX7 A;  1VGU A;  4HG6 A;  4AAW A;  2O1F A;  3CKO A;  4Y63 A;  4KT7 A;  1JVG A;  3F1Y A;  4HCQ A;  3U0Y A;  5L6S A;  1W55 A;  2Q4J A;  5CMG X;  5D91 A;  1H7L A;  2O1H A;  3OAM A;  5FU0 A;  2A8W A;  1G0R A;  1XZ6 A;  4FRB A;  1V83 A;  4Q7C A;  4B4B A;  2MZB A;  5AJN A;  1R7X A;  4CJC A;  4O6N A;  1VPA A;  2J0A A;  1TVY A;  4FCU A;  3DUV A;  3USQ A;  2BO4 A;  3BCV A;  2ZU9 A;  1HJL A;  1VH3 A;  2QGI A;  2QH5 A;  1ZJ0 A;  3ST8 A;  3DK5 A;  2OEF A;  1ZJ1 A;  3CKV A;  4B5B A;  1GWW A;  3HL3 A;  3V0N A;  3FOQ A;  1WT2 A;  1O7Q A;  5J49 A;  4IRQ A;  4FRO A;  2Y6P A;  5EJZ A;  2YCM A;  5AJO A;  3TQD A;  2YQS A;  2X5Z A;  2VXM A;  4NAK A;  2VS3 A;  2AGD A;  5C1G A;  2E3D A;  4BMA A;  1ZDG A;  4E1K A;  2NXV A;  4G87 A;  5C36 A;  4ASJ A;  1FXJ A;  4FRH A;  3Q80 A;  1ZJ2 A;  4YS8 A;  1EZI A;  3SXE A;  2ZU7 A;  2D7R A;  5IDT A;  1FO9 A;  3I0D A;  3SXG A;  2AM5 A;  3KIA A;  1LZ0 A;  1R81 A;  5FYE A;  1H5R A;  2O1G A;  2WE9 A;  1NQI B;  2JCO A;  3I0E A;  3V0P A;  5C8R A;  2YQC A;  3RSB A;  2YC3 A;  1O0R A;  2QKX A;  2DPW A;  4G3P A;  1WVC A;  3RMW A;  1MC3 A;  4ECM A;  3JTJ A;  4Y7U A;  1HM9 A;  4FRM A;  2AEC A;  1VZT A;  4CJB A;  2P72 A;  1V82 A;  1H7T A;  2WAW A;  1LVW A;  1G23 A;  1R7Y A;  5FU8 A;  2BO8 A;  2VFZ A;  2AH9 A;  1ZDF A;  3V0L A;  4L41 C;  3SXA A;  3OH4 A;  2I5K A;  4KXO A;  4EEG A;  1O23 B;  1ZCU A;  5CMF X;  2APC A;  1H5R B;  2AM4 A;  1QGS A;  4B4M A;  2FFV A;  1ZJ3 A;  1VIC A;  1VM8 A;  4IRP A;  1NWG B;  4FCE A;  1ON6 A;  2Y4J A;  4FRE A;  4Y6U A;  2GGO A;  3N9W A;  2FYA A;  4HO0 A;  5CQN X;  2XWN A;  5C49 A;  5CQM X;  4DE7 A;  1FGX A;  2JCJ A;  2J0B A;  4HO3 A;  2VSH A;  3U2T A;  4HO5 A;  1HJJ A;  2RJ9 A;  1LL3 A;  1YP3 A;  2PA4 A;  1GQC A;  3D98 A;  4FRP A;  3I0J A;  1HV9 A;  2D0J A;  1NHE B;  1H5T A;  1VGT A;  5CQP A;  1GX0 A;  1W77 A;  3SPT A;  1FXO A;  2V0I A;  1JV3 A;  1LZ7 A;  1ON8 A;  1W57 A;  1MP3 A;  3V0M A;  5D92 A;  2I7B A;  1QG8 A;  1G1L A;  2P6W A;  3SX3 A;  5C4D A;  2XWM A;  1JV1 A;  3POL A;  3Q7U A;  3U2W A;  5CMI A;  1FGG A;  4UEG A;  3K8D A;  1JYK A;  1R80 A;  1TZF A;  3V91 A;  3OC9 A;  2OI7 A;  4B4G A;  2UX8 A;  1H7F A;  1MP4 A;  1ZCT A;  5C4E A;  1O7O A;  2Y7A A;  2ZU8 A;  1VH1 A;  4D0T A;  1WT3 A;  2FYB A;  4B2W A;  1FG5 N;  1OQM B;  2FY7 A;  1NF5 B;  2RJ1 A;  4DEC A;  3QVB A;  4LW3 A;  5FTV A;  2OEG A;  4EEO A;  3R3I A;  3O3P A;  5CQL X;  2PGV A;  3I0G A;  2RJ5 A;  3CKJ A;  1MP5 A;  3CGX A;  4KNR A;  2AM3 A;  3V8Z A;  4EE5 A;  1IIM A;  4AYL A;  5C48 A;  4DDZ A;  2P73 A;  2YQJ A;  2PX7 A;  5C47 A;  3OH0 A;  1K4V A;  4D11 A;  1H5S A;  3R2W A;  2VS4 A;  5HS2 A;  1H7G A;  1ZIZ A;  2FYD B;  2FFU A;  2Y4K A;  2XMH A;  2RIT A;  4K6R A;  3D5N A;  4B2X A;  3I0K A;  1H7Q A;  4CJ8 A;  1XHB A;  4NAL A;  5JQQ A;  1G95 A;  5IFY A;  4Y64 A;  1R82 A;  4KC2 A;  2AES A;  2VSI A;  2RJ6 A;  1HM0 A;  5IDS A;  4MYB A; 
#chains in the Genus database with same CATH homology
 1ZI3 A;  4C2S A;  3PNN A;  2PGY A;  1H5S C;  4AYJ A;  2BO6 A;  3RMV A;  3FWW A;  4P00 A;  3CKQ A;  1GWV A;  1VGZ A;  1G3L A;  5EIY A;  5AJP A;  4NAN A;  3SXD A;  3IOI A;  2OI6 A;  3ZGF A;  1NMM B;  1NKH B;  5CMJ A;  2CU2 A;  2D7I A;  3EE5 A;  4M28 A;  5I1F A;  4CVH A;  3DJ4 A;  4ZDQ A;  3OH3 A;  5C1H A;  1OMZ A;  2I5E A;  4ASY A;  3ZLL A;  1R7U A;  2RIX A;  2A8U A;  2VS5 A;  4KC4 A;  4HO6 A;  4EEA A;  5BXC A;  1FOA A;  1IIN A;  4FRQ A;  4HO8 A;  1FRW A;  1FO8 A;  2OI5 A;  4J18 A;  2RJ4 A;  5DDT A;  4KNX A;  5L6V A;  1E5K A;  1TW1 A;  1ZJP A;  2XME A;  3T7N A;  1S4N A;  4Y62 A;  3U2X A;  4FQW A;  4KPX A;  1I52 A;  2X5S A;  3K8E A;  1LL2 A;  3IOH A;  2RIZ A;  2Z86 A;  4Y9X A;  1INJ A;  4FRA A;  2WVL A;  1VGW A;  4NAI A;  2W0W A;  4M2B A;  2VD4 A;  1FWY A;  4HO2 A;  3SX8 A;  3I0C A;  4B42 A;  2RJ7 A;  3USR A;  3SX5 A;  2AE7 A;  1HM8 A;  4EEM A;  2BO7 A;  5FTS A;  1QWJ A;  1GQ9 A;  4KRV A;  3T7O A;  3CKN A;  2WGZ A;  4MIX A;  2V0L A;  4M2A A;  1Z90 A;  1VZU A;  4Y7G A;  1LZI A;  3BRK X;  3E26 A;  5EJ1 A;  1WSZ A;  2YC5 A;  1OMX A;  2ICY A;  5CMH A;  2VK9 A;  3I0I X;  2Z87 A;  4D0Z A;  3U0X A;  1PZT A;  2V0K A;  4Y6N A;  1LL0 A;  2XWL A;  3D8V A;  3E25 A;  1H5T B;  4HO9 A;  4M4K A;  4EE3 A;  5C4F A;  4FIY A;  2E8B A;  1S4P A;  4B3U A;  5C3A A;  3CU0 A;  1INI A;  3OH2 A;  3U2V A;  2W0V A;  2YQH A;  4KQL A;  4EE4 A;  5C3D A;  1H4C A;  1YRO B;  4HO4 A;  2VXL A;  3T7M A;  2YES A;  1FR9 A;  1VZX A;  1SS9 A;  3OKR A;  1FR8 A;  4LW6 A;  3I0H A;  5FV9 A;  3I0L A;  3U2U A;  1YP4 A;  1PZY B;  4G3S A;  3V0O A;  2FYC B;  1ZCY A;  4Y7F A;  4D11 C;  3GUE A;  2Y4M A;  2ICX A;  3Q4S A;  2X60 A;  1S4O A;  4JD0 A;  1G97 A;  2WVK A;  2V0H A;  4O6M A;  4P02 A;  4R7P A;  1H5S B;  1ZHJ A;  3OGZ A;  3NGW A;  1GX4 A;  3V8Y A;  1H7H A;  3SXC A;  2Y4L A;  5C38 A;  3JUJ A;  4BQH A;  3OH1 A;  2JCK A;  1V84 A;  1LZJ A;  3PKP A;  1R7V A;  1JVD A;  3ZLK A;  1H4E A;  1GA8 A;  1QGQ A;  2GGQ A;  1ZCV A;  5C1L A;  1H4D A;  1G8O A;  1YP2 A;  4HOC A;  4EVW A;  3PKQ A;  1ZJO A;  1G2V A;  1H5S D;  3SXB A;  1KWS A;  1H7E A;  1ZI1 A;  4FRD A;  4ARW A;  1TW5 A;  4FRL A;  2JCL A;  2X65 A;  1ZI5 A;  2WEE A;  3I0F A;  2V0J A;  2C0N A;  2RIY A;  4D48 A;  3V90 A;  4G3Q A;  3LW6 A;  5CQO A;  1G9R A;  5C4B A;  1EYR A;  5C4C A;  2WVM A;  5FUH A;  5DDV A;  3JUK A;  3ZGG A;  4Y7T A;  4KPZ A;  1ZI4 A;  2RJ0 A;  4Y7V A;  3ZF8 A;  1G93 A;  4AC3 A;  5C3B A;  1R7T A;  3TZT A;  4XWI A;  3IOJ A;  4MND A;  4JIS A;  3V0Q A;  2RJ8 A;  3F1C A;  4KC1 A;  1FZW A;  1WT1 A;  4GBP A;  1WT0 A;  4FIX A;  1H3M A;  1JYL A;  3SX7 A;  1VGU A;  4HG6 A;  4AAW A;  2O1F A;  3CKO A;  4Y63 A;  4KT7 A;  1JVG A;  3F1Y A;  4HCQ A;  3U0Y A;  5L6S A;  1W55 A;  2Q4J A;  5CMG X;  5D91 A;  1H7L A;  2O1H A;  3OAM A;  5FU0 A;  2A8W A;  1G0R A;  1XZ6 A;  4FRB A;  1V83 A;  4Q7C A;  4B4B A;  2MZB A;  5AJN A;  1R7X A;  4CJC A;  4O6N A;  1VPA A;  2J0A A;  1TVY A;  4FCU A;  3DUV A;  3USQ A;  2BO4 A;  3BCV A;  2ZU9 A;  1HJL A;  1VH3 A;  2QGI A;  2QH5 A;  1ZJ0 A;  3ST8 A;  3DK5 A;  2OEF A;  1ZJ1 A;  3CKV A;  4B5B A;  1GWW A;  3HL3 A;  3V0N A;  3FOQ A;  1WT2 A;  1O7Q A;  5J49 A;  4IRQ A;  4FRO A;  2Y6P A;  5EJZ A;  2YCM A;  5AJO A;  3TQD A;  2YQS A;  2X5Z A;  2VXM A;  4NAK A;  2VS3 A;  2AGD A;  5C1G A;  2E3D A;  4BMA A;  1ZDG A;  4E1K A;  2NXV A;  4G87 A;  5C36 A;  4ASJ A;  1FXJ A;  4FRH A;  3Q80 A;  1ZJ2 A;  4YS8 A;  1EZI A;  3SXE A;  2ZU7 A;  2D7R A;  5IDT A;  1FO9 A;  3I0D A;  3SXG A;  2AM5 A;  3KIA A;  1LZ0 A;  1R81 A;  5FYE A;  1H5R A;  2O1G A;  2WE9 A;  1NQI B;  2JCO A;  3I0E A;  3V0P A;  5C8R A;  2YQC A;  3RSB A;  2YC3 A;  1O0R A;  2QKX A;  2DPW A;  4G3P A;  1WVC A;  3RMW A;  1MC3 A;  4ECM A;  3JTJ A;  4Y7U A;  1HM9 A;  4FRM A;  2AEC A;  1VZT A;  4CJB A;  2P72 A;  1V82 A;  1H7T A;  2WAW A;  1LVW A;  1G23 A;  1R7Y A;  5FU8 A;  2BO8 A;  2VFZ A;  2AH9 A;  1ZDF A;  3V0L A;  4L41 C;  3SXA A;  3OH4 A;  2I5K A;  4KXO A;  4EEG A;  1O23 B;  1ZCU A;  5CMF X;  2APC A;  1H5R B;  2AM4 A;  1QGS A;  4B4M A;  2FFV A;  1ZJ3 A;  1VIC A;  1VM8 A;  4IRP A;  1NWG B;  4FCE A;  1ON6 A;  2Y4J A;  4FRE A;  4Y6U A;  2GGO A;  3N9W A;  2FYA A;  4HO0 A;  5CQN X;  2XWN A;  5C49 A;  5CQM X;  4DE7 A;  1FGX A;  2JCJ A;  2J0B A;  4HO3 A;  2VSH A;  3U2T A;  4HO5 A;  1HJJ A;  2RJ9 A;  1LL3 A;  1YP3 A;  2PA4 A;  1GQC A;  3D98 A;  4FRP A;  3I0J A;  1HV9 A;  2D0J A;  1NHE B;  1H5T A;  1VGT A;  5CQP A;  1GX0 A;  1W77 A;  3SPT A;  1FXO A;  2V0I A;  1JV3 A;  1LZ7 A;  1ON8 A;  1W57 A;  1MP3 A;  3V0M A;  5D92 A;  2I7B A;  1QG8 A;  1G1L A;  2P6W A;  3SX3 A;  5C4D A;  2XWM A;  1JV1 A;  3POL A;  3Q7U A;  3U2W A;  5CMI A;  1FGG A;  4UEG A;  3K8D A;  1JYK A;  1R80 A;  1TZF A;  3V91 A;  3OC9 A;  2OI7 A;  4B4G A;  2UX8 A;  1H7F A;  1MP4 A;  1ZCT A;  5C4E A;  1O7O A;  2Y7A A;  2ZU8 A;  1VH1 A;  4D0T A;  1WT3 A;  2FYB A;  4B2W A;  1FG5 N;  1OQM B;  2FY7 A;  1NF5 B;  2RJ1 A;  4DEC A;  3QVB A;  4LW3 A;  5FTV A;  2OEG A;  4EEO A;  3R3I A;  3O3P A;  5CQL X;  2PGV A;  3I0G A;  2RJ5 A;  3CKJ A;  1MP5 A;  3CGX A;  4KNR A;  2AM3 A;  3V8Z A;  4EE5 A;  1IIM A;  4AYL A;  5C48 A;  4DDZ A;  2P73 A;  2YQJ A;  2PX7 A;  5C47 A;  3OH0 A;  1K4V A;  4D11 A;  1H5S A;  3R2W A;  2VS4 A;  5HS2 A;  1H7G A;  1ZIZ A;  2FYD B;  2FFU A;  2Y4K A;  2XMH A;  2RIT A;  4K6R A;  3D5N A;  4B2X A;  3I0K A;  1H7Q A;  4CJ8 A;  1XHB A;  4NAL A;  5JQQ A;  1G95 A;  5IFY A;  4Y64 A;  1R82 A;  4KC2 A;  2AES A;  2VSI A;  2RJ6 A;  1HM0 A;  5IDS A;  4MYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...